Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SP93

Protein Details
Accession C9SP93    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
385-404RSSAQDLKPKGKSRRESNVTHydrophilic
NLS Segment(s)
PositionSequence
437-441RKGRK
Subcellular Location(s) plas 11, cyto 8.5, cyto_mito 6.5, mito 3.5, nucl 1, extr 1, pero 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR002076  ELO_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0009922  F:fatty acid elongase activity  
GO:0102756  F:very-long-chain 3-ketoacyl-CoA synthase activity  
GO:0006633  P:fatty acid biosynthetic process  
KEGG val:VDBG_06718  -  
Pfam View protein in Pfam  
PF01151  ELO  
Amino Acid Sequences MSGTTILSELPNSSLFQFPPSHYPIGVPPPPPGVSSSNFAIPDHIYNAVLDPRVPITIAATYAVTIKLLNRYNTSTNKRPWAISKTGPFKVFVILHNIFLAVYSAWTFWGMLGGMRRAIWTSINGAISLSANGNPSTDVYGRLWNEGLSFYGWIFYLSKFYEVLDTFIILAKGKLSSTLQTYHHAGAMMCMWAGMRYMSAPIWMFVLVNSFIHALMYTYYTITAFNIRVPTPIKRSLTTMQITQFLVGASYAMLHSFVSYTVPVTVYTEKSASAAAAASASSSSSLPTAEAIVKASVGAIESIKNMIYGAASESAVAAAASDATGAAAAAAAAAVPAGLQAETVWVTQPCITTSGETFGIWLNVLYLAPLTYLFGMFFVRSYLRRSSAQDLKPKGKSRRESNVTLAEKAGWDAAKEVSSEIYNQGAEEAVVTGPKTRKGRKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.21
4 0.23
5 0.24
6 0.3
7 0.34
8 0.34
9 0.3
10 0.32
11 0.33
12 0.39
13 0.41
14 0.36
15 0.33
16 0.36
17 0.37
18 0.36
19 0.34
20 0.29
21 0.27
22 0.29
23 0.29
24 0.29
25 0.29
26 0.28
27 0.27
28 0.24
29 0.24
30 0.22
31 0.21
32 0.16
33 0.16
34 0.18
35 0.18
36 0.17
37 0.15
38 0.14
39 0.14
40 0.14
41 0.14
42 0.12
43 0.11
44 0.12
45 0.13
46 0.12
47 0.11
48 0.1
49 0.11
50 0.11
51 0.09
52 0.08
53 0.1
54 0.16
55 0.21
56 0.24
57 0.26
58 0.31
59 0.37
60 0.46
61 0.52
62 0.54
63 0.55
64 0.61
65 0.6
66 0.59
67 0.59
68 0.57
69 0.55
70 0.54
71 0.57
72 0.56
73 0.58
74 0.56
75 0.51
76 0.44
77 0.43
78 0.38
79 0.3
80 0.31
81 0.27
82 0.26
83 0.25
84 0.24
85 0.18
86 0.16
87 0.15
88 0.07
89 0.06
90 0.06
91 0.06
92 0.06
93 0.07
94 0.07
95 0.06
96 0.07
97 0.06
98 0.08
99 0.1
100 0.11
101 0.11
102 0.11
103 0.12
104 0.11
105 0.12
106 0.11
107 0.1
108 0.12
109 0.15
110 0.15
111 0.15
112 0.14
113 0.13
114 0.13
115 0.12
116 0.1
117 0.08
118 0.09
119 0.09
120 0.09
121 0.09
122 0.09
123 0.12
124 0.11
125 0.12
126 0.13
127 0.18
128 0.19
129 0.19
130 0.19
131 0.16
132 0.16
133 0.14
134 0.14
135 0.09
136 0.08
137 0.07
138 0.07
139 0.07
140 0.08
141 0.08
142 0.08
143 0.1
144 0.1
145 0.11
146 0.11
147 0.11
148 0.14
149 0.13
150 0.14
151 0.11
152 0.11
153 0.11
154 0.11
155 0.12
156 0.08
157 0.08
158 0.07
159 0.07
160 0.06
161 0.08
162 0.08
163 0.09
164 0.11
165 0.15
166 0.17
167 0.19
168 0.22
169 0.2
170 0.2
171 0.2
172 0.17
173 0.13
174 0.12
175 0.09
176 0.07
177 0.06
178 0.05
179 0.04
180 0.05
181 0.04
182 0.03
183 0.04
184 0.05
185 0.05
186 0.06
187 0.06
188 0.06
189 0.07
190 0.07
191 0.06
192 0.05
193 0.07
194 0.06
195 0.06
196 0.07
197 0.06
198 0.06
199 0.06
200 0.06
201 0.04
202 0.05
203 0.06
204 0.05
205 0.05
206 0.05
207 0.06
208 0.06
209 0.06
210 0.08
211 0.07
212 0.08
213 0.1
214 0.1
215 0.12
216 0.14
217 0.17
218 0.2
219 0.26
220 0.27
221 0.25
222 0.3
223 0.3
224 0.34
225 0.32
226 0.3
227 0.25
228 0.26
229 0.25
230 0.21
231 0.19
232 0.12
233 0.11
234 0.08
235 0.07
236 0.04
237 0.04
238 0.04
239 0.03
240 0.04
241 0.03
242 0.04
243 0.04
244 0.04
245 0.05
246 0.05
247 0.05
248 0.06
249 0.06
250 0.06
251 0.09
252 0.11
253 0.11
254 0.12
255 0.12
256 0.11
257 0.11
258 0.11
259 0.09
260 0.07
261 0.06
262 0.05
263 0.05
264 0.04
265 0.04
266 0.04
267 0.04
268 0.04
269 0.04
270 0.05
271 0.05
272 0.05
273 0.05
274 0.06
275 0.07
276 0.07
277 0.08
278 0.08
279 0.08
280 0.08
281 0.08
282 0.07
283 0.06
284 0.05
285 0.05
286 0.05
287 0.05
288 0.06
289 0.07
290 0.07
291 0.07
292 0.06
293 0.06
294 0.05
295 0.05
296 0.06
297 0.07
298 0.07
299 0.07
300 0.07
301 0.07
302 0.07
303 0.06
304 0.04
305 0.03
306 0.03
307 0.03
308 0.03
309 0.03
310 0.03
311 0.03
312 0.02
313 0.02
314 0.02
315 0.02
316 0.02
317 0.02
318 0.02
319 0.02
320 0.02
321 0.02
322 0.02
323 0.02
324 0.02
325 0.03
326 0.03
327 0.03
328 0.05
329 0.06
330 0.06
331 0.08
332 0.08
333 0.1
334 0.11
335 0.12
336 0.12
337 0.13
338 0.14
339 0.14
340 0.14
341 0.17
342 0.16
343 0.15
344 0.14
345 0.13
346 0.13
347 0.11
348 0.1
349 0.07
350 0.07
351 0.07
352 0.06
353 0.06
354 0.05
355 0.05
356 0.06
357 0.06
358 0.06
359 0.06
360 0.06
361 0.07
362 0.08
363 0.07
364 0.07
365 0.09
366 0.11
367 0.13
368 0.17
369 0.22
370 0.25
371 0.29
372 0.33
373 0.4
374 0.47
375 0.52
376 0.57
377 0.6
378 0.65
379 0.7
380 0.74
381 0.75
382 0.76
383 0.78
384 0.78
385 0.81
386 0.8
387 0.77
388 0.75
389 0.75
390 0.69
391 0.61
392 0.53
393 0.42
394 0.36
395 0.31
396 0.27
397 0.17
398 0.14
399 0.14
400 0.15
401 0.15
402 0.15
403 0.14
404 0.13
405 0.14
406 0.15
407 0.15
408 0.16
409 0.15
410 0.14
411 0.14
412 0.12
413 0.11
414 0.1
415 0.09
416 0.07
417 0.08
418 0.09
419 0.15
420 0.18
421 0.26
422 0.34