Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SXG3

Protein Details
Accession C9SXG3    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-34LGPKAASRDEKPKRRRRRPVWPVPTSTLHydrophilic
NLS Segment(s)
PositionSequence
11-25AASRDEKPKRRRRRP
Subcellular Location(s) mito 13, cyto 10, nucl 2, pero 2
Family & Domain DBs
KEGG val:VDBG_09463  -  
Amino Acid Sequences MAQLIGLGPKAASRDEKPKRRRRRPVWPVPTSTLSVPGRIVVLRSGRPEAEGTRRSVEARLDEGVVAHITTDEQLRSVVWGDPVAHSMRLYAGRVETLAVGAVLGRRGGPGED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.41
3 0.52
4 0.61
5 0.7
6 0.79
7 0.86
8 0.92
9 0.91
10 0.92
11 0.93
12 0.93
13 0.93
14 0.89
15 0.83
16 0.77
17 0.71
18 0.61
19 0.5
20 0.47
21 0.36
22 0.3
23 0.24
24 0.19
25 0.17
26 0.15
27 0.15
28 0.11
29 0.13
30 0.14
31 0.16
32 0.17
33 0.16
34 0.17
35 0.18
36 0.18
37 0.22
38 0.22
39 0.22
40 0.23
41 0.23
42 0.23
43 0.23
44 0.22
45 0.16
46 0.15
47 0.14
48 0.12
49 0.11
50 0.11
51 0.1
52 0.08
53 0.07
54 0.05
55 0.04
56 0.04
57 0.04
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.06
64 0.08
65 0.08
66 0.08
67 0.09
68 0.1
69 0.1
70 0.13
71 0.13
72 0.13
73 0.12
74 0.11
75 0.13
76 0.14
77 0.15
78 0.14
79 0.13
80 0.13
81 0.13
82 0.14
83 0.11
84 0.09
85 0.08
86 0.06
87 0.06
88 0.06
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07