Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C9SJ29

Protein Details
Accession C9SJ29    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
3-30NHVSPASSLKRRRPTRARRHDGVPRRCLHydrophilic
NLS Segment(s)
PositionSequence
12-22KRRRPTRARRH
47-67GRVRHKSLKSRPGALKRKEKV
Subcellular Location(s) mito 20.5, cyto_mito 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG val:VDBG_05061  -  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MINHVSPASSLKRRRPTRARRHDGVPRRCLPELTNEADGNVAQLREGRVRHKSLKSRPGALKRKEKVVRGEMARFGASMAALAATPEAAAAAAENQTMTVEDTADTPAAPAPATTNRWAALRRHISTTMEQNPAFTGQGAGKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.82
4 0.85
5 0.89
6 0.88
7 0.83
8 0.84
9 0.84
10 0.83
11 0.82
12 0.79
13 0.74
14 0.7
15 0.66
16 0.59
17 0.49
18 0.48
19 0.44
20 0.39
21 0.37
22 0.31
23 0.3
24 0.29
25 0.27
26 0.19
27 0.15
28 0.1
29 0.06
30 0.08
31 0.1
32 0.13
33 0.15
34 0.19
35 0.23
36 0.29
37 0.36
38 0.42
39 0.5
40 0.55
41 0.62
42 0.61
43 0.64
44 0.66
45 0.69
46 0.71
47 0.7
48 0.71
49 0.64
50 0.7
51 0.67
52 0.64
53 0.59
54 0.54
55 0.52
56 0.45
57 0.45
58 0.36
59 0.33
60 0.28
61 0.22
62 0.17
63 0.11
64 0.08
65 0.06
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.03
79 0.03
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.06
86 0.05
87 0.05
88 0.05
89 0.06
90 0.07
91 0.07
92 0.07
93 0.06
94 0.07
95 0.07
96 0.07
97 0.06
98 0.08
99 0.14
100 0.17
101 0.19
102 0.2
103 0.21
104 0.24
105 0.27
106 0.27
107 0.32
108 0.38
109 0.38
110 0.41
111 0.43
112 0.44
113 0.45
114 0.51
115 0.48
116 0.45
117 0.43
118 0.39
119 0.37
120 0.36
121 0.31
122 0.23
123 0.18