Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SFQ1

Protein Details
Accession C9SFQ1   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
335-360AIEESRREKHQDKRKQAPGDEQKQSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto_nucl 5, nucl 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023398  TIF_eIF4e-like  
IPR001040  TIF_eIF_4E  
IPR019770  TIF_eIF_4E_CS  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0003723  F:RNA binding  
GO:0003743  F:translation initiation factor activity  
KEGG val:VDBG_04105  -  
Pfam View protein in Pfam  
PF01652  IF4E  
PROSITE View protein in PROSITE  
PS00813  IF4E  
Amino Acid Sequences MDNNLWTRRTNSGKLSLSTPSHGNSTSTGGDSARNGSGSFSKRFGGATSSQGKNDPFSATAATTPGGSSLASPTTGASNAFGLGSGAFASFGSAKTPKTPGNPFELAMGKAPASKTPGADGKAPSMASIAETGSSANFRTGQGSQTSSARGSSEVARPQAGLKVHPLKYEWVTWCRPCQPKGQPYEEYAKSLTAMVHCKSIEEFVVGFRHLKHPSELPVGWEYHFFKRGIRPIWEDEINRSGGKWVLRLKKGIADRYWEDTRFALLGEAFQDVGEEICGGVVSIRNGEDVISIWTRSTGGRVLKIRETWKNYLQCPPNTIFEFKSHDESIQHRAAIEESRREKHQDKRKQAPGDEQKQSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.51
4 0.47
5 0.44
6 0.4
7 0.33
8 0.31
9 0.3
10 0.28
11 0.23
12 0.24
13 0.23
14 0.22
15 0.21
16 0.18
17 0.19
18 0.19
19 0.21
20 0.18
21 0.17
22 0.16
23 0.17
24 0.23
25 0.26
26 0.28
27 0.26
28 0.25
29 0.26
30 0.26
31 0.25
32 0.23
33 0.21
34 0.25
35 0.31
36 0.33
37 0.33
38 0.36
39 0.36
40 0.33
41 0.32
42 0.27
43 0.2
44 0.19
45 0.2
46 0.17
47 0.17
48 0.16
49 0.14
50 0.12
51 0.11
52 0.1
53 0.08
54 0.07
55 0.07
56 0.08
57 0.09
58 0.09
59 0.09
60 0.09
61 0.1
62 0.11
63 0.11
64 0.09
65 0.09
66 0.09
67 0.09
68 0.08
69 0.07
70 0.06
71 0.06
72 0.05
73 0.05
74 0.04
75 0.04
76 0.05
77 0.06
78 0.06
79 0.09
80 0.11
81 0.12
82 0.15
83 0.19
84 0.21
85 0.27
86 0.33
87 0.32
88 0.38
89 0.39
90 0.36
91 0.36
92 0.34
93 0.29
94 0.24
95 0.22
96 0.15
97 0.15
98 0.15
99 0.13
100 0.15
101 0.16
102 0.15
103 0.18
104 0.22
105 0.22
106 0.25
107 0.24
108 0.22
109 0.23
110 0.23
111 0.19
112 0.15
113 0.13
114 0.1
115 0.1
116 0.08
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.07
125 0.07
126 0.1
127 0.1
128 0.12
129 0.13
130 0.15
131 0.15
132 0.15
133 0.17
134 0.14
135 0.14
136 0.13
137 0.11
138 0.11
139 0.13
140 0.16
141 0.18
142 0.18
143 0.18
144 0.18
145 0.18
146 0.2
147 0.18
148 0.14
149 0.17
150 0.24
151 0.25
152 0.25
153 0.26
154 0.25
155 0.26
156 0.3
157 0.27
158 0.24
159 0.27
160 0.27
161 0.3
162 0.35
163 0.38
164 0.35
165 0.4
166 0.44
167 0.47
168 0.51
169 0.53
170 0.48
171 0.46
172 0.52
173 0.44
174 0.37
175 0.31
176 0.25
177 0.2
178 0.18
179 0.16
180 0.11
181 0.14
182 0.12
183 0.15
184 0.14
185 0.14
186 0.14
187 0.14
188 0.12
189 0.09
190 0.09
191 0.08
192 0.09
193 0.1
194 0.1
195 0.1
196 0.15
197 0.16
198 0.17
199 0.18
200 0.19
201 0.22
202 0.26
203 0.25
204 0.23
205 0.23
206 0.23
207 0.22
208 0.23
209 0.23
210 0.21
211 0.24
212 0.21
213 0.22
214 0.27
215 0.33
216 0.34
217 0.34
218 0.36
219 0.36
220 0.41
221 0.43
222 0.37
223 0.34
224 0.33
225 0.3
226 0.26
227 0.22
228 0.18
229 0.17
230 0.17
231 0.18
232 0.23
233 0.3
234 0.32
235 0.34
236 0.34
237 0.38
238 0.43
239 0.44
240 0.38
241 0.36
242 0.37
243 0.42
244 0.44
245 0.39
246 0.35
247 0.29
248 0.28
249 0.22
250 0.19
251 0.13
252 0.09
253 0.09
254 0.09
255 0.09
256 0.07
257 0.07
258 0.07
259 0.06
260 0.06
261 0.05
262 0.04
263 0.04
264 0.04
265 0.04
266 0.03
267 0.04
268 0.05
269 0.06
270 0.07
271 0.08
272 0.08
273 0.08
274 0.09
275 0.08
276 0.08
277 0.11
278 0.11
279 0.11
280 0.11
281 0.12
282 0.12
283 0.12
284 0.14
285 0.15
286 0.18
287 0.25
288 0.29
289 0.33
290 0.38
291 0.43
292 0.48
293 0.51
294 0.55
295 0.55
296 0.59
297 0.61
298 0.59
299 0.63
300 0.64
301 0.58
302 0.56
303 0.53
304 0.51
305 0.48
306 0.48
307 0.4
308 0.37
309 0.41
310 0.38
311 0.41
312 0.35
313 0.34
314 0.34
315 0.36
316 0.39
317 0.36
318 0.33
319 0.27
320 0.27
321 0.27
322 0.31
323 0.33
324 0.35
325 0.38
326 0.42
327 0.45
328 0.52
329 0.57
330 0.59
331 0.64
332 0.66
333 0.7
334 0.76
335 0.82
336 0.84
337 0.82
338 0.83
339 0.84
340 0.82