Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2GZM8

Protein Details
Accession Q2GZM8   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MASRSGSEEKKPRRQQQTYESEGHydrophilic
25-52ESEEYQSPPPRRKRNQRQKKGGQGPLDNHydrophilic
NLS Segment(s)
PositionSequence
34-45PRRKRNQRQKKG
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 2
Family & Domain DBs
Amino Acid Sequences MASRSGSEEKKPRRQQQTYESEGEESEEYQSPPPRRKRNQRQKKGGQGPLDNLALDNVQNTAGGLVNSATGALGGVAGNAVQNQGGGDGGGKSDTLRLRLDLNLDIEITLKAKIHGDLELALFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.84
4 0.83
5 0.78
6 0.72
7 0.63
8 0.53
9 0.45
10 0.39
11 0.28
12 0.2
13 0.16
14 0.14
15 0.14
16 0.17
17 0.24
18 0.27
19 0.35
20 0.44
21 0.52
22 0.61
23 0.71
24 0.79
25 0.84
26 0.9
27 0.92
28 0.93
29 0.93
30 0.93
31 0.91
32 0.86
33 0.81
34 0.72
35 0.63
36 0.55
37 0.46
38 0.35
39 0.25
40 0.19
41 0.13
42 0.1
43 0.08
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.09
81 0.11
82 0.13
83 0.14
84 0.15
85 0.17
86 0.18
87 0.21
88 0.19
89 0.2
90 0.18
91 0.17
92 0.16
93 0.15
94 0.14
95 0.12
96 0.1
97 0.09
98 0.1
99 0.11
100 0.13
101 0.13
102 0.14
103 0.14
104 0.15