Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C9SUT2

Protein Details
Accession C9SUT2    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKSARASTRKANNRRLKQNVFGHydrophilic
86-119AKPASKPKSAGKVQKKRKTSRIVFPKYKDRKGKKBasic
NLS Segment(s)
PositionSequence
87-119KPASKPKSAGKVQKKRKTSRIVFPKYKDRKGKK
Subcellular Location(s) nucl 20, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG val:VDBG_08657  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARASTRKANNRRLKQNVFGPVESARTERLSAKLLELAAQPKPQKEQDTTMDVEDLDAEIANEPAAEASEPVEDSNTMDIEGAKPASKPKSAGKVQKKRKTSRIVFPKYKDRKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.87
3 0.88
4 0.83
5 0.8
6 0.78
7 0.76
8 0.7
9 0.6
10 0.52
11 0.44
12 0.4
13 0.34
14 0.27
15 0.2
16 0.17
17 0.18
18 0.17
19 0.18
20 0.19
21 0.18
22 0.18
23 0.18
24 0.17
25 0.17
26 0.16
27 0.16
28 0.15
29 0.19
30 0.2
31 0.19
32 0.23
33 0.24
34 0.26
35 0.27
36 0.29
37 0.29
38 0.31
39 0.31
40 0.28
41 0.25
42 0.21
43 0.18
44 0.13
45 0.09
46 0.05
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.05
61 0.05
62 0.06
63 0.05
64 0.06
65 0.07
66 0.07
67 0.06
68 0.06
69 0.07
70 0.07
71 0.08
72 0.08
73 0.08
74 0.09
75 0.14
76 0.17
77 0.19
78 0.22
79 0.27
80 0.36
81 0.43
82 0.53
83 0.59
84 0.67
85 0.76
86 0.82
87 0.85
88 0.84
89 0.86
90 0.87
91 0.83
92 0.83
93 0.84
94 0.85
95 0.84
96 0.83
97 0.84
98 0.83
99 0.85