Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2GVX9

Protein Details
Accession Q2GVX9   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
194-216VLPLRLGARRRRRQPLHRGKGAABasic
NLS Segment(s)
PositionSequence
200-216GARRRRRQPLHRGKGAA
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
Amino Acid Sequences MAWDSKAARPRQSSAASGTRSIAIHAKQQAKRATQPQSQHVADPFLQDFLSPSFDAASYLNATLPPLQTSSRTPGNQASSQGAVPLAELSIQTQATLSQLNAHTTRLTNTLTELTNDILRSGGRLAYEVELLRGETLGLSETLTETLEDDIAKFVPGGLRTLTLVRSRLDAVIKTFGEAMEFVFPPSEVFSQLVLPLRLGARRRRRQPLHRGKGAAGAARVEGRDCGLKDLAAVWKGTAEEKGRARFIESLAKMVEDRHRELLREVELAGRSRAGAKPQVEVGGGSGGGAAGVSGAGQAAEAKGYGAYGLISQLQKLRNGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.47
4 0.44
5 0.41
6 0.36
7 0.32
8 0.31
9 0.3
10 0.23
11 0.28
12 0.34
13 0.42
14 0.42
15 0.5
16 0.55
17 0.55
18 0.61
19 0.63
20 0.64
21 0.61
22 0.64
23 0.64
24 0.65
25 0.61
26 0.56
27 0.49
28 0.45
29 0.39
30 0.37
31 0.3
32 0.22
33 0.21
34 0.17
35 0.17
36 0.14
37 0.17
38 0.13
39 0.12
40 0.12
41 0.12
42 0.13
43 0.12
44 0.13
45 0.11
46 0.11
47 0.11
48 0.1
49 0.11
50 0.13
51 0.13
52 0.12
53 0.12
54 0.13
55 0.15
56 0.18
57 0.23
58 0.28
59 0.27
60 0.29
61 0.33
62 0.37
63 0.38
64 0.36
65 0.34
66 0.28
67 0.27
68 0.25
69 0.19
70 0.13
71 0.11
72 0.09
73 0.06
74 0.05
75 0.05
76 0.05
77 0.08
78 0.07
79 0.07
80 0.07
81 0.07
82 0.08
83 0.09
84 0.08
85 0.1
86 0.12
87 0.15
88 0.16
89 0.16
90 0.17
91 0.17
92 0.18
93 0.16
94 0.16
95 0.13
96 0.14
97 0.16
98 0.15
99 0.15
100 0.14
101 0.13
102 0.13
103 0.13
104 0.11
105 0.09
106 0.09
107 0.08
108 0.08
109 0.08
110 0.07
111 0.07
112 0.08
113 0.09
114 0.1
115 0.1
116 0.09
117 0.08
118 0.08
119 0.08
120 0.06
121 0.06
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.06
143 0.06
144 0.07
145 0.07
146 0.07
147 0.08
148 0.09
149 0.11
150 0.11
151 0.12
152 0.11
153 0.12
154 0.13
155 0.14
156 0.14
157 0.13
158 0.13
159 0.16
160 0.15
161 0.14
162 0.14
163 0.12
164 0.11
165 0.1
166 0.09
167 0.07
168 0.08
169 0.07
170 0.07
171 0.07
172 0.07
173 0.09
174 0.09
175 0.07
176 0.08
177 0.08
178 0.09
179 0.1
180 0.13
181 0.11
182 0.1
183 0.11
184 0.11
185 0.14
186 0.18
187 0.25
188 0.34
189 0.43
190 0.51
191 0.6
192 0.68
193 0.75
194 0.83
195 0.85
196 0.84
197 0.81
198 0.76
199 0.66
200 0.63
201 0.55
202 0.45
203 0.34
204 0.25
205 0.19
206 0.18
207 0.17
208 0.11
209 0.1
210 0.09
211 0.12
212 0.11
213 0.14
214 0.13
215 0.13
216 0.13
217 0.15
218 0.17
219 0.15
220 0.15
221 0.11
222 0.12
223 0.13
224 0.14
225 0.15
226 0.15
227 0.19
228 0.25
229 0.28
230 0.29
231 0.29
232 0.31
233 0.29
234 0.29
235 0.33
236 0.28
237 0.27
238 0.25
239 0.26
240 0.23
241 0.24
242 0.28
243 0.24
244 0.27
245 0.31
246 0.32
247 0.33
248 0.35
249 0.36
250 0.32
251 0.28
252 0.25
253 0.22
254 0.23
255 0.24
256 0.23
257 0.18
258 0.16
259 0.19
260 0.2
261 0.21
262 0.25
263 0.25
264 0.27
265 0.28
266 0.3
267 0.27
268 0.24
269 0.21
270 0.15
271 0.13
272 0.1
273 0.08
274 0.06
275 0.06
276 0.05
277 0.04
278 0.02
279 0.02
280 0.02
281 0.02
282 0.02
283 0.03
284 0.03
285 0.04
286 0.04
287 0.05
288 0.05
289 0.05
290 0.05
291 0.05
292 0.05
293 0.05
294 0.05
295 0.05
296 0.07
297 0.11
298 0.12
299 0.14
300 0.19
301 0.22