Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SJD3

Protein Details
Accession C9SJD3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
155-174SQAYRSYRYHRSSRGPRRHVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR015876  Acyl-CoA_DS  
Gene Ontology GO:0016020  C:membrane  
GO:0016717  F:oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water  
KEGG val:VDBG_04404  -  
Amino Acid Sequences MTVPRTMSPSAVPGPTPRSLTSPPSPSLGVTGGFTSTGSTPSSFSSFPPLGSSPLTGFRSSGRRLSSLLFTTSTLVSVSQQATIAFGLTHPTRASLPLKIYLAAVGAGAVEGSIRWWSREHRAHHRYTDTVKDPLLCPQGSSVLSPRLDGHEAGSQAYRSYRYHRSSRGPRRHVAAHSLPQVVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.32
4 0.28
5 0.3
6 0.33
7 0.38
8 0.41
9 0.42
10 0.4
11 0.39
12 0.38
13 0.33
14 0.32
15 0.26
16 0.19
17 0.15
18 0.14
19 0.11
20 0.11
21 0.1
22 0.09
23 0.09
24 0.09
25 0.1
26 0.1
27 0.1
28 0.12
29 0.15
30 0.14
31 0.14
32 0.2
33 0.19
34 0.19
35 0.21
36 0.2
37 0.19
38 0.2
39 0.2
40 0.15
41 0.21
42 0.22
43 0.19
44 0.19
45 0.2
46 0.25
47 0.26
48 0.29
49 0.24
50 0.24
51 0.25
52 0.26
53 0.27
54 0.23
55 0.22
56 0.18
57 0.17
58 0.17
59 0.16
60 0.14
61 0.1
62 0.09
63 0.08
64 0.09
65 0.09
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.05
73 0.05
74 0.07
75 0.07
76 0.08
77 0.07
78 0.08
79 0.08
80 0.12
81 0.13
82 0.12
83 0.14
84 0.15
85 0.16
86 0.15
87 0.15
88 0.12
89 0.11
90 0.09
91 0.07
92 0.04
93 0.04
94 0.03
95 0.03
96 0.02
97 0.02
98 0.02
99 0.02
100 0.05
101 0.05
102 0.06
103 0.08
104 0.11
105 0.21
106 0.28
107 0.34
108 0.43
109 0.5
110 0.54
111 0.58
112 0.59
113 0.54
114 0.51
115 0.52
116 0.44
117 0.4
118 0.36
119 0.32
120 0.29
121 0.31
122 0.32
123 0.25
124 0.21
125 0.2
126 0.23
127 0.22
128 0.23
129 0.2
130 0.21
131 0.21
132 0.22
133 0.22
134 0.22
135 0.23
136 0.22
137 0.21
138 0.2
139 0.2
140 0.2
141 0.21
142 0.17
143 0.17
144 0.18
145 0.19
146 0.17
147 0.23
148 0.31
149 0.36
150 0.44
151 0.5
152 0.59
153 0.67
154 0.76
155 0.81
156 0.79
157 0.78
158 0.76
159 0.76
160 0.69
161 0.67
162 0.64
163 0.61
164 0.59