Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9S8H9

Protein Details
Accession C9S8H9    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
4-33EAPAEPVKRGRGRPRKPDSEKKQKPRVDDGBasic
NLS Segment(s)
PositionSequence
10-50VKRGRGRPRKPDSEKKQKPRVDDGTPRRGRGRPKGSLGKPK
101-109KRGRGRPRK
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
IPR000637  HMGI/Y_DNA-bd_CS  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG val:VDBG_00047  -  
Pfam View protein in Pfam  
PF02178  AT_hook  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences MASEAPAEPVKRGRGRPRKPDSEKKQKPRVDDGTPRRGRGRPKGSLGKPKVLTAAAGVSKSTSAMNTRSTGTRGRPRKSDAAAASTTSTTKAAGATQTPSKRGRGRPRKSDAAASSPAVEREEPESAASEADVPATDESPRSKSAASSEAEQDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.68
3 0.77
4 0.82
5 0.84
6 0.87
7 0.9
8 0.9
9 0.9
10 0.91
11 0.91
12 0.91
13 0.84
14 0.81
15 0.79
16 0.76
17 0.73
18 0.73
19 0.71
20 0.72
21 0.72
22 0.69
23 0.64
24 0.61
25 0.6
26 0.6
27 0.6
28 0.56
29 0.6
30 0.67
31 0.69
32 0.75
33 0.72
34 0.69
35 0.62
36 0.55
37 0.49
38 0.39
39 0.32
40 0.22
41 0.21
42 0.14
43 0.13
44 0.12
45 0.1
46 0.1
47 0.1
48 0.09
49 0.07
50 0.08
51 0.09
52 0.12
53 0.13
54 0.14
55 0.15
56 0.16
57 0.19
58 0.23
59 0.3
60 0.36
61 0.38
62 0.4
63 0.43
64 0.47
65 0.45
66 0.46
67 0.38
68 0.34
69 0.31
70 0.28
71 0.25
72 0.2
73 0.18
74 0.12
75 0.11
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.08
82 0.11
83 0.17
84 0.19
85 0.22
86 0.24
87 0.29
88 0.35
89 0.43
90 0.52
91 0.56
92 0.64
93 0.7
94 0.75
95 0.78
96 0.74
97 0.73
98 0.65
99 0.59
100 0.53
101 0.44
102 0.38
103 0.3
104 0.29
105 0.23
106 0.19
107 0.15
108 0.16
109 0.17
110 0.15
111 0.15
112 0.16
113 0.15
114 0.15
115 0.14
116 0.11
117 0.09
118 0.09
119 0.08
120 0.08
121 0.08
122 0.09
123 0.09
124 0.11
125 0.14
126 0.17
127 0.19
128 0.19
129 0.19
130 0.2
131 0.24
132 0.28
133 0.27
134 0.28
135 0.31