Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SHW0

Protein Details
Accession C9SHW0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
224-243EPYFRVKRDYIRAREKKSGVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016563  Npl4  
IPR024682  Npl4_Ub-like_dom  
IPR007716  NPL4_Zn-bd_put  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0006511  P:ubiquitin-dependent protein catabolic process  
KEGG val:VDBG_04642  -  
Pfam View protein in Pfam  
PF11543  UN_NPL4  
PF05020  zf-NPL4  
Amino Acid Sequences MLLRVRGPDGMSRLTVDQNDNFGDLGRQLLPNLPTTVDPTTITLSNNPNGNDSKRLGDIANFKLGQIGLKHGDLIFITYKHQDALSNGDAHGATPSTSAQILPSSNRLNGKPILPAEDVPIDPLPSTSATVERISKPWEVVKQSALDDRLDKKNGKIPRGRDHKMCKHGPKGMCDYCMPLDPFNAKYLDEKKIKYLSIHSYLRKNNAATNKPELGSSFIPPLQEPYFRVKRDYIRAREKKSGVLGRVVEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.28
4 0.26
5 0.26
6 0.26
7 0.24
8 0.22
9 0.19
10 0.17
11 0.13
12 0.14
13 0.12
14 0.12
15 0.12
16 0.16
17 0.17
18 0.19
19 0.2
20 0.18
21 0.17
22 0.21
23 0.22
24 0.19
25 0.18
26 0.17
27 0.19
28 0.2
29 0.2
30 0.21
31 0.23
32 0.25
33 0.28
34 0.27
35 0.27
36 0.3
37 0.31
38 0.31
39 0.29
40 0.28
41 0.25
42 0.26
43 0.23
44 0.24
45 0.28
46 0.26
47 0.3
48 0.28
49 0.26
50 0.27
51 0.26
52 0.24
53 0.18
54 0.19
55 0.15
56 0.15
57 0.16
58 0.14
59 0.15
60 0.12
61 0.14
62 0.12
63 0.1
64 0.12
65 0.12
66 0.13
67 0.13
68 0.13
69 0.12
70 0.11
71 0.17
72 0.17
73 0.17
74 0.17
75 0.17
76 0.17
77 0.16
78 0.15
79 0.09
80 0.07
81 0.06
82 0.07
83 0.06
84 0.06
85 0.06
86 0.06
87 0.08
88 0.08
89 0.09
90 0.13
91 0.14
92 0.16
93 0.19
94 0.19
95 0.21
96 0.21
97 0.21
98 0.2
99 0.19
100 0.21
101 0.19
102 0.19
103 0.17
104 0.17
105 0.16
106 0.14
107 0.14
108 0.1
109 0.09
110 0.09
111 0.08
112 0.07
113 0.07
114 0.06
115 0.07
116 0.09
117 0.1
118 0.13
119 0.13
120 0.14
121 0.16
122 0.16
123 0.16
124 0.17
125 0.2
126 0.21
127 0.21
128 0.22
129 0.21
130 0.21
131 0.23
132 0.21
133 0.18
134 0.18
135 0.21
136 0.24
137 0.26
138 0.26
139 0.25
140 0.3
141 0.34
142 0.38
143 0.4
144 0.42
145 0.48
146 0.56
147 0.59
148 0.61
149 0.66
150 0.68
151 0.7
152 0.72
153 0.69
154 0.67
155 0.7
156 0.65
157 0.61
158 0.61
159 0.55
160 0.49
161 0.42
162 0.39
163 0.32
164 0.34
165 0.29
166 0.21
167 0.21
168 0.21
169 0.22
170 0.21
171 0.2
172 0.16
173 0.2
174 0.24
175 0.3
176 0.33
177 0.33
178 0.36
179 0.39
180 0.4
181 0.37
182 0.38
183 0.37
184 0.4
185 0.46
186 0.45
187 0.49
188 0.52
189 0.56
190 0.55
191 0.49
192 0.47
193 0.5
194 0.51
195 0.48
196 0.51
197 0.48
198 0.44
199 0.43
200 0.38
201 0.34
202 0.3
203 0.27
204 0.24
205 0.22
206 0.22
207 0.22
208 0.26
209 0.24
210 0.24
211 0.25
212 0.3
213 0.38
214 0.38
215 0.42
216 0.43
217 0.48
218 0.56
219 0.64
220 0.64
221 0.67
222 0.75
223 0.79
224 0.82
225 0.76
226 0.72
227 0.71
228 0.69
229 0.61
230 0.59