Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q2HGK0

Protein Details
Accession Q2HGK0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
168-189VEAPAQPRKRGRPPKNKETAAPHydrophilic
NLS Segment(s)
PositionSequence
150-200APAPKRRGRPPKIKETAAVEAPAQPRKRGRPPKNKETAAPEPKRQRATPSR
Subcellular Location(s) nucl 13, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MHMNQRKEFFEVTSYQNTKTKLQYLSRTWLGPLTTAISYKGLDLINSEYKHALAALPAEDGHRSTKEITALPPCDDDFCTVGLQFGIPCRHKIYQLLLHGQERVDYSAPTAFGGLKSYWVARQPPPPPEPRDDTPREEAPREEAAVEAPAPAPKRRGRPPKIKETAAVEAPAQPRKRGRPPKNKETAAPEPKRQRATPSRGPPAGTIGVGIASQGGVRTQVVVGATGKTTRSGRQVQLTKKAAEAGSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.4
4 0.42
5 0.42
6 0.43
7 0.44
8 0.42
9 0.47
10 0.52
11 0.53
12 0.58
13 0.57
14 0.53
15 0.47
16 0.43
17 0.36
18 0.28
19 0.24
20 0.19
21 0.17
22 0.17
23 0.17
24 0.15
25 0.15
26 0.14
27 0.16
28 0.13
29 0.12
30 0.13
31 0.17
32 0.23
33 0.23
34 0.24
35 0.21
36 0.2
37 0.2
38 0.19
39 0.14
40 0.08
41 0.09
42 0.08
43 0.08
44 0.09
45 0.09
46 0.09
47 0.1
48 0.12
49 0.12
50 0.13
51 0.14
52 0.16
53 0.18
54 0.19
55 0.21
56 0.25
57 0.26
58 0.26
59 0.26
60 0.24
61 0.23
62 0.22
63 0.2
64 0.14
65 0.13
66 0.13
67 0.11
68 0.11
69 0.09
70 0.09
71 0.07
72 0.1
73 0.15
74 0.15
75 0.17
76 0.21
77 0.23
78 0.24
79 0.26
80 0.28
81 0.29
82 0.32
83 0.35
84 0.33
85 0.33
86 0.32
87 0.3
88 0.25
89 0.19
90 0.17
91 0.12
92 0.1
93 0.1
94 0.1
95 0.1
96 0.09
97 0.09
98 0.07
99 0.07
100 0.09
101 0.08
102 0.08
103 0.08
104 0.09
105 0.09
106 0.12
107 0.15
108 0.15
109 0.23
110 0.25
111 0.31
112 0.34
113 0.39
114 0.4
115 0.41
116 0.44
117 0.4
118 0.44
119 0.42
120 0.43
121 0.42
122 0.43
123 0.42
124 0.37
125 0.34
126 0.3
127 0.27
128 0.23
129 0.19
130 0.14
131 0.12
132 0.11
133 0.11
134 0.07
135 0.06
136 0.08
137 0.1
138 0.11
139 0.16
140 0.2
141 0.27
142 0.36
143 0.47
144 0.54
145 0.63
146 0.7
147 0.75
148 0.78
149 0.72
150 0.66
151 0.6
152 0.56
153 0.46
154 0.39
155 0.28
156 0.26
157 0.28
158 0.31
159 0.27
160 0.26
161 0.31
162 0.38
163 0.48
164 0.54
165 0.62
166 0.67
167 0.76
168 0.83
169 0.87
170 0.83
171 0.76
172 0.74
173 0.74
174 0.73
175 0.69
176 0.67
177 0.66
178 0.7
179 0.71
180 0.64
181 0.63
182 0.62
183 0.65
184 0.67
185 0.67
186 0.69
187 0.66
188 0.66
189 0.57
190 0.52
191 0.45
192 0.34
193 0.25
194 0.16
195 0.14
196 0.12
197 0.11
198 0.06
199 0.04
200 0.05
201 0.05
202 0.05
203 0.05
204 0.06
205 0.07
206 0.07
207 0.08
208 0.09
209 0.1
210 0.11
211 0.11
212 0.12
213 0.13
214 0.14
215 0.17
216 0.19
217 0.21
218 0.28
219 0.33
220 0.38
221 0.46
222 0.54
223 0.58
224 0.66
225 0.67
226 0.61
227 0.56
228 0.55