Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SIU2

Protein Details
Accession C9SIU2    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-33DSGNLSPPDPKRRRTRKPAKQNGKMEDDFHydrophilic
NLS Segment(s)
PositionSequence
14-24PKRRRTRKPAK
Subcellular Location(s) nucl 19, cyto 7
Family & Domain DBs
KEGG val:VDBG_04974  -  
Amino Acid Sequences MSATDSGNLSPPDPKRRRTRKPAKQNGKMEDDFAEPYNMDMESGRKRLEEINAKFTAARDRLLADYEAEQRDLSDTLLKALEKQMSIQHSIHVLAEAAQDRLDAEERIQAHVDGAQARFERLETLLRVVVQGRIEEAEAALLEAGGLVKAEGLGVKHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.57
3 0.67
4 0.77
5 0.81
6 0.86
7 0.86
8 0.92
9 0.95
10 0.95
11 0.94
12 0.93
13 0.88
14 0.85
15 0.74
16 0.64
17 0.55
18 0.46
19 0.38
20 0.3
21 0.24
22 0.15
23 0.15
24 0.14
25 0.11
26 0.09
27 0.08
28 0.11
29 0.15
30 0.17
31 0.18
32 0.17
33 0.18
34 0.21
35 0.28
36 0.34
37 0.32
38 0.37
39 0.37
40 0.37
41 0.36
42 0.34
43 0.34
44 0.25
45 0.22
46 0.16
47 0.17
48 0.17
49 0.18
50 0.18
51 0.11
52 0.12
53 0.15
54 0.15
55 0.14
56 0.13
57 0.12
58 0.13
59 0.12
60 0.1
61 0.09
62 0.08
63 0.08
64 0.1
65 0.09
66 0.09
67 0.11
68 0.12
69 0.09
70 0.1
71 0.13
72 0.14
73 0.17
74 0.17
75 0.15
76 0.15
77 0.15
78 0.14
79 0.11
80 0.09
81 0.07
82 0.08
83 0.08
84 0.08
85 0.07
86 0.07
87 0.07
88 0.08
89 0.09
90 0.07
91 0.07
92 0.1
93 0.11
94 0.13
95 0.13
96 0.12
97 0.11
98 0.12
99 0.13
100 0.12
101 0.12
102 0.15
103 0.14
104 0.15
105 0.15
106 0.14
107 0.13
108 0.12
109 0.16
110 0.13
111 0.15
112 0.16
113 0.16
114 0.17
115 0.16
116 0.18
117 0.15
118 0.14
119 0.13
120 0.12
121 0.12
122 0.12
123 0.11
124 0.08
125 0.07
126 0.07
127 0.06
128 0.05
129 0.04
130 0.04
131 0.04
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.04
138 0.05