Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C9SVJ3

Protein Details
Accession C9SVJ3    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
285-311GSNTRSKSYTGRKKKTRVVNLRRTKTAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 8, cyto 4, extr 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027536  Mdm34  
IPR031468  SMP_LBD  
Gene Ontology GO:0032865  C:ERMES complex  
GO:0008289  F:lipid binding  
GO:0006869  P:lipid transport  
GO:0007005  P:mitochondrion organization  
KEGG val:VDBG_08918  -  
PROSITE View protein in PROSITE  
PS51847  SMP  
CDD cd21673  SMP_Mdm34  
Amino Acid Sequences MSYSGDAFLTLKTRVQANPLASYLYSKPTFTSPQPLAASSGLTIPLSITLSDIKLSAFIILVFSKQKGLTLVFRNDPLESLKVSSTFDSIQFVRDYLQRTIEGQLRTLMMDELPAIIHRLSLQLWCPDQAQKKDEEAAKEQADETAVDPFSSPPLDPVDAHGNLLDPNDIASMSLEGGPEVQSLFSQKNLLRLGALNDSHRTFSLFTPNIRDVVFRAWTGNVVSDSACNTPPTATPSLSKTNSFAGTATATTYTFSDTASASHGYLPSRPSLVSLNSAMSGLAMGSNTRSKSYTGRKKKTRVVNLRRTKTALPEESEAGDTNSDSASVAASSTEPLMTSSISEEPEDEVRLPKVFPTAPIVADNARDVQPTPSTPLRRVEKARRFEAENAPSENLEPDWIMKMAGEIARRVYDEKNRHQQQGGLWDERDPMPPPAYEATN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.31
4 0.32
5 0.35
6 0.33
7 0.33
8 0.29
9 0.32
10 0.28
11 0.3
12 0.28
13 0.24
14 0.25
15 0.28
16 0.33
17 0.32
18 0.39
19 0.33
20 0.4
21 0.41
22 0.4
23 0.38
24 0.33
25 0.31
26 0.22
27 0.22
28 0.15
29 0.13
30 0.12
31 0.09
32 0.1
33 0.1
34 0.09
35 0.09
36 0.1
37 0.11
38 0.11
39 0.11
40 0.1
41 0.1
42 0.1
43 0.09
44 0.07
45 0.07
46 0.08
47 0.09
48 0.11
49 0.12
50 0.13
51 0.15
52 0.15
53 0.16
54 0.16
55 0.19
56 0.24
57 0.3
58 0.35
59 0.35
60 0.37
61 0.37
62 0.35
63 0.33
64 0.29
65 0.24
66 0.19
67 0.19
68 0.17
69 0.17
70 0.18
71 0.18
72 0.17
73 0.16
74 0.16
75 0.17
76 0.16
77 0.18
78 0.17
79 0.16
80 0.16
81 0.18
82 0.22
83 0.2
84 0.23
85 0.21
86 0.22
87 0.26
88 0.3
89 0.27
90 0.23
91 0.23
92 0.21
93 0.2
94 0.19
95 0.15
96 0.09
97 0.09
98 0.08
99 0.07
100 0.06
101 0.06
102 0.07
103 0.06
104 0.07
105 0.07
106 0.08
107 0.08
108 0.1
109 0.12
110 0.15
111 0.16
112 0.17
113 0.18
114 0.23
115 0.3
116 0.33
117 0.33
118 0.32
119 0.33
120 0.38
121 0.39
122 0.37
123 0.34
124 0.35
125 0.33
126 0.31
127 0.29
128 0.24
129 0.21
130 0.17
131 0.13
132 0.11
133 0.11
134 0.1
135 0.1
136 0.1
137 0.11
138 0.11
139 0.1
140 0.08
141 0.11
142 0.12
143 0.11
144 0.15
145 0.19
146 0.19
147 0.19
148 0.17
149 0.15
150 0.15
151 0.15
152 0.12
153 0.05
154 0.06
155 0.06
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.06
162 0.05
163 0.05
164 0.06
165 0.06
166 0.06
167 0.05
168 0.05
169 0.04
170 0.06
171 0.07
172 0.07
173 0.11
174 0.11
175 0.17
176 0.18
177 0.18
178 0.17
179 0.17
180 0.19
181 0.19
182 0.19
183 0.15
184 0.16
185 0.17
186 0.17
187 0.16
188 0.15
189 0.13
190 0.13
191 0.2
192 0.2
193 0.2
194 0.24
195 0.25
196 0.25
197 0.23
198 0.22
199 0.15
200 0.16
201 0.17
202 0.12
203 0.12
204 0.11
205 0.11
206 0.11
207 0.11
208 0.08
209 0.07
210 0.07
211 0.07
212 0.08
213 0.09
214 0.09
215 0.08
216 0.08
217 0.09
218 0.09
219 0.14
220 0.14
221 0.14
222 0.15
223 0.19
224 0.25
225 0.26
226 0.25
227 0.22
228 0.23
229 0.22
230 0.21
231 0.17
232 0.12
233 0.12
234 0.11
235 0.1
236 0.08
237 0.07
238 0.08
239 0.08
240 0.08
241 0.07
242 0.07
243 0.07
244 0.07
245 0.07
246 0.09
247 0.1
248 0.09
249 0.1
250 0.11
251 0.11
252 0.13
253 0.13
254 0.12
255 0.12
256 0.12
257 0.12
258 0.13
259 0.14
260 0.15
261 0.15
262 0.14
263 0.13
264 0.13
265 0.12
266 0.09
267 0.08
268 0.05
269 0.04
270 0.04
271 0.03
272 0.05
273 0.09
274 0.09
275 0.11
276 0.12
277 0.13
278 0.21
279 0.32
280 0.41
281 0.49
282 0.59
283 0.67
284 0.74
285 0.81
286 0.84
287 0.84
288 0.84
289 0.84
290 0.85
291 0.86
292 0.84
293 0.79
294 0.73
295 0.63
296 0.59
297 0.57
298 0.5
299 0.43
300 0.39
301 0.37
302 0.35
303 0.34
304 0.27
305 0.19
306 0.15
307 0.11
308 0.1
309 0.08
310 0.07
311 0.06
312 0.06
313 0.05
314 0.05
315 0.05
316 0.05
317 0.05
318 0.06
319 0.06
320 0.06
321 0.06
322 0.06
323 0.07
324 0.07
325 0.07
326 0.09
327 0.11
328 0.12
329 0.12
330 0.12
331 0.13
332 0.15
333 0.16
334 0.14
335 0.15
336 0.15
337 0.16
338 0.16
339 0.15
340 0.18
341 0.17
342 0.18
343 0.21
344 0.22
345 0.22
346 0.23
347 0.24
348 0.21
349 0.21
350 0.21
351 0.18
352 0.16
353 0.16
354 0.15
355 0.17
356 0.19
357 0.19
358 0.24
359 0.29
360 0.32
361 0.35
362 0.43
363 0.46
364 0.51
365 0.59
366 0.64
367 0.66
368 0.7
369 0.73
370 0.69
371 0.67
372 0.66
373 0.67
374 0.63
375 0.58
376 0.54
377 0.49
378 0.45
379 0.4
380 0.35
381 0.25
382 0.19
383 0.15
384 0.12
385 0.13
386 0.13
387 0.12
388 0.11
389 0.11
390 0.14
391 0.16
392 0.17
393 0.16
394 0.18
395 0.2
396 0.22
397 0.24
398 0.26
399 0.33
400 0.41
401 0.5
402 0.58
403 0.63
404 0.67
405 0.66
406 0.63
407 0.59
408 0.6
409 0.56
410 0.5
411 0.44
412 0.41
413 0.42
414 0.4
415 0.38
416 0.31
417 0.29
418 0.27
419 0.26
420 0.29