Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SQ05

Protein Details
Accession C9SQ05    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
89-110RERAPRRSSPRRGRSPSPRRSTBasic
NLS Segment(s)
PositionSequence
87-126RDRERAPRRSSPRRGRSPSPRRSTRDYSPPPRKEDRRDRD
132-138GRDRSRS
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG val:VDBG_07040  -  
Amino Acid Sequences MSRGGGTTLYVTGFSHGTRARDLAYEFERFAFVEYEDRRDSDDAYHEMHNKRIGRDDVLKIEVAPTDLLHSGPAHLLLPLGGSTPGRDRERAPRRSSPRRGRSPSPRRSTRDYSPPPRKEDRRDRDYDRDSGRDRSRSPDRRGDSPRDAKDDRDAKDDRDAKDDRDDRDRRDSGANGDDRKPIDSPPPVHDDLDVAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.15
3 0.17
4 0.19
5 0.2
6 0.21
7 0.21
8 0.23
9 0.24
10 0.24
11 0.24
12 0.25
13 0.23
14 0.23
15 0.22
16 0.19
17 0.2
18 0.15
19 0.13
20 0.18
21 0.19
22 0.24
23 0.24
24 0.25
25 0.26
26 0.25
27 0.26
28 0.2
29 0.23
30 0.2
31 0.21
32 0.24
33 0.28
34 0.28
35 0.31
36 0.34
37 0.32
38 0.32
39 0.36
40 0.34
41 0.33
42 0.38
43 0.38
44 0.35
45 0.34
46 0.33
47 0.26
48 0.25
49 0.2
50 0.15
51 0.11
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.08
61 0.06
62 0.06
63 0.06
64 0.05
65 0.05
66 0.04
67 0.05
68 0.05
69 0.04
70 0.05
71 0.08
72 0.14
73 0.15
74 0.17
75 0.18
76 0.29
77 0.38
78 0.45
79 0.48
80 0.51
81 0.59
82 0.68
83 0.76
84 0.76
85 0.76
86 0.79
87 0.79
88 0.78
89 0.8
90 0.81
91 0.8
92 0.79
93 0.77
94 0.72
95 0.74
96 0.72
97 0.67
98 0.67
99 0.66
100 0.67
101 0.7
102 0.7
103 0.69
104 0.72
105 0.73
106 0.72
107 0.74
108 0.73
109 0.71
110 0.72
111 0.72
112 0.73
113 0.7
114 0.67
115 0.6
116 0.56
117 0.51
118 0.53
119 0.51
120 0.47
121 0.44
122 0.45
123 0.52
124 0.55
125 0.58
126 0.6
127 0.59
128 0.62
129 0.68
130 0.68
131 0.67
132 0.67
133 0.65
134 0.63
135 0.61
136 0.54
137 0.56
138 0.55
139 0.48
140 0.45
141 0.43
142 0.38
143 0.46
144 0.5
145 0.43
146 0.43
147 0.42
148 0.38
149 0.46
150 0.49
151 0.43
152 0.48
153 0.51
154 0.49
155 0.57
156 0.55
157 0.48
158 0.49
159 0.47
160 0.42
161 0.46
162 0.47
163 0.41
164 0.43
165 0.44
166 0.4
167 0.4
168 0.36
169 0.3
170 0.32
171 0.35
172 0.36
173 0.37
174 0.44
175 0.43
176 0.43
177 0.41