Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SVE9

Protein Details
Accession C9SVE9   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRTPRSKRGAKKNKERKILTCPBasic
65-84MIRSNKKKAAKAKAAAKKKAHydrophilic
NLS Segment(s)
PositionSequence
5-17RSKRGAKKNKERK
69-84NKKKAAKAKAAAKKKA
Subcellular Location(s) mito 14, cyto 5, plas 4, nucl 1, pero 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0016757  F:glycosyltransferase activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
KEGG val:VDBG_08874  -  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MRTPRSKRGAKKNKERKILTCPQPFVDDDHPLQSLFPARVWAIRIPVILILLASAVVGSFLGTVMIRSNKKKAAKAKAAAKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.87
3 0.81
4 0.8
5 0.79
6 0.78
7 0.75
8 0.68
9 0.6
10 0.57
11 0.51
12 0.46
13 0.39
14 0.33
15 0.26
16 0.25
17 0.24
18 0.21
19 0.2
20 0.16
21 0.14
22 0.11
23 0.1
24 0.1
25 0.09
26 0.1
27 0.12
28 0.12
29 0.11
30 0.12
31 0.11
32 0.1
33 0.1
34 0.09
35 0.07
36 0.06
37 0.04
38 0.03
39 0.03
40 0.03
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.03
49 0.03
50 0.04
51 0.07
52 0.13
53 0.18
54 0.22
55 0.27
56 0.34
57 0.41
58 0.48
59 0.55
60 0.6
61 0.65
62 0.7
63 0.76
64 0.78