Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C9SMR9

Protein Details
Accession C9SMR9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-28NSACLNCKRRKVEVRSCNRACHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG val:VDBG_06193  -  
CDD cd00067  GAL4  
Amino Acid Sequences MGSKKHVNSACLNCKRRKVEVRSCNRACDGTKTCSNCSTAQLDCVYNAESDMRKISAKRVILDLRLRVAELEGVLRDNNTERPQASSPDTSEATTADSRTMSTTYSHDIAPAPLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.73
3 0.74
4 0.75
5 0.74
6 0.75
7 0.78
8 0.81
9 0.83
10 0.8
11 0.74
12 0.66
13 0.59
14 0.5
15 0.48
16 0.43
17 0.38
18 0.42
19 0.42
20 0.42
21 0.41
22 0.42
23 0.34
24 0.32
25 0.3
26 0.24
27 0.23
28 0.22
29 0.2
30 0.17
31 0.17
32 0.14
33 0.11
34 0.11
35 0.1
36 0.09
37 0.09
38 0.1
39 0.1
40 0.1
41 0.11
42 0.14
43 0.18
44 0.19
45 0.19
46 0.22
47 0.23
48 0.26
49 0.28
50 0.26
51 0.22
52 0.21
53 0.2
54 0.15
55 0.14
56 0.1
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.07
64 0.08
65 0.12
66 0.14
67 0.16
68 0.16
69 0.21
70 0.22
71 0.25
72 0.28
73 0.27
74 0.26
75 0.28
76 0.29
77 0.24
78 0.23
79 0.2
80 0.19
81 0.18
82 0.17
83 0.13
84 0.13
85 0.13
86 0.14
87 0.15
88 0.12
89 0.12
90 0.15
91 0.18
92 0.2
93 0.19
94 0.19
95 0.19