ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F862	Uncharacterized protein	Low	9.3	1	342-367	NYWPTRFMRTRKYKYHRNVCWKLDFP	nucl(13),cyto(7.5),pero(5),cyto_mito(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYD5	Dynein heavy chain, cytoplasmic	Low	6.8	1	4896-4915	AGIVHRGRFERKKLHVRDGA	plas(9),cyto_nucl(6.5),nucl(6),cyto(5),mito(3),pero(2),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYF3	Endo/exonuclease/phosphatase domain-containing protein	Low	5	1	386-407	MIAKYVRRERSQRRWRLAHFLV	plas(13),mito(6.5),cyto_mito(5.5),cyto(3.5),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZW7	Actin polymerization protein Bzz1, putative	Low	9.9	1	51-74	TKLTALCKKYSDRKAKKSSSLSVG	nucl(17.5),mito_nucl(11),cyto(4),mito(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0G8	Uncharacterized protein	Low	8	1	17-42	TSPYNFRPREKYSKRATWKDDTLKRQ	mito(12),nucl(9.5),cyto_nucl(7),cyto(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4H1	Fungal_trans domain-containing protein	Low	7.1	1	48-71	KVSKTSLKTCKRGQHIQKWRSMGR	cyto(8),mito(7),cyto_nucl(7),nucl(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7R8	Zn(2)-C6 fungal-type domain-containing protein	Low	6.9	1	6-45	PQESPEPEGNRKRRRTVLACNECREKKRKCDGIKPVCGAC	plas(19),nucl(5),cyto(1),golg(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FE76	Uncharacterized protein	Low	5.4	1	40-59	VRKLAFIPSHRKNRRQTVGA	mito(10),extr(10),cyto(4),nucl(1),pero(1),E.R.(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM65	Serine/threonine protein kinase, putative	Low	7.3	1	1102-1125	GLDPVSRQERRRSRQEEKMREQEY	nucl(6),mito(6),mito_nucl(6),cyto(5),extr(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUN9	Cysteine synthase B, putative	Low	8.5	1	468-489	SSTPQGKVSRRRRFARWIPCLE	nucl(12.5),cyto_nucl(10.5),cyto(7.5),pero(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZF9	FAD_binding_3 domain-containing protein	Low	5	1	122-142	LYERLKDKSKVHPNQRVKDVL	plas(24),E.R.(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZN8	MFS transporter	Low	5	1	582-601	SKEHKETKTGLKKKSDPDTP	plas(26)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4E4	Phosphotransferase family protein	Low	9.2	1	500-527	DIQKGSSRWLIPKKRKHGWTNCGHIRIL	nucl(14.5),cyto_nucl(10.5),cyto(5.5),pero(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5H5	Ferric-chelate reductase	Low	5	1	550-573	GSLSDSIRRACRKRQTQTHIDFIE	plas(22),E.R.(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G944	Serine/threonine protein kinase, putative	Low	9	1	565-587	NTSFLIKQKNIKDRKPQRSLASE	nucl(13.5),cyto_nucl(10),cyto(5.5),pero(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F967	Thioredoxin domain-containing protein	Low	7.6	1	275-294	VLPGKKRPIRYYLKNRSKST	cyto(13),cyto_nucl(12.5),nucl(10),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM09	Uncharacterized protein	Low	8	1	67-94	EGKKAGKKSTTRRMYKLNRKLRRNVYLV	plas(20),cyto(2),E.R.(2),mito(1),extr(1),cyto_nucl(1),vacu(1),cyto_pero(1)	KKAGKKSTTRRMYKLNRKLR (69-88, prob:0.791)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMV7	MFS domain-containing protein	Low	5	1	519-538	FNMPWRVTNRRKPQDSSPVL	plas(19),E.R.(4),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FR62	Uncharacterized protein	Low	9.5	1	24-46	KSPIVYREKRVRTKEDSERQRED	nucl(18),cyto_nucl(14),cyto(8)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUW0	Glutaredoxin domain protein	Low	9.9	1	269-290	DPNGAKPKRSAKRRTTRPPAIS	E.R.(7),nucl(5.5),mito(5),cyto_nucl(4.5),golg(3),cyto(2.5),extr(2)	AKPKRSAKRRTT (273-284, prob:0.853)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8E7	Tyrosine--tRNA ligase	Low	8	1	362-392	QEITTKAYPPPEKKQKKVKDKGSRYPGAKQE	mito(16.5),cyto_mito(10.5),plas(4),cyto(3.5)	EKKQKKVKDKGSRY (373-386, prob:0.841)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAN7	DNA ligase	Low	9.7	1	1-21	MPSPAKKRKVNEPEAPQQRMR	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQF9	RNA-directed RNA polymerase	Low	9.7	1	212-231	MGLSRFPRTKEPQRNRISQL	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0L0	Alpha,alpha-trehalose phosphate synthase subunit TPS3, putative	Low	8.1	1	841-860	VWRYCLERGKRDNQDYRPDF	nucl(10),cyto(9),cyto_mito(7.5),mito(4),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4A1	Cystathionine beta-synthase	Low	5	1	453-472	VDAKESSKPKGKRHRFVEIT	cyto(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5X3	Ferulic acid decarboxylase 1	Low	5.8	1	477-499	PMLPYMTRAKKNKQIKNPGIGGR	mito(16),cyto(7),nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAA7	DNA mismatch repair protein MSH3	Low	5	1	1777-1796	GTSFKWKKIGEQFRARFKTT	plas(19),E.R.(4),vacu(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAD2	Uncharacterized protein	Low	6.8	1	360-380	SYNSTKSRKPVMKERGKQDIT	mito(11),cyto(7),nucl(5),cyto_pero(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKQ5	Uncharacterized protein	Low	8.7	1	12-37	TNEARLEFCRRHKRSKEQCLPCQLPE	nucl(13),mito(10),cyto_nucl(9),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN81	Arginine transporter, putative	Low	5	1	54-74	ESNPLPDLKRKLKSRHLQMIA	plas(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQB7	Curved DNA-binding protein	Low	9.2	1	380-412	ERPISKSTGAKGKKNKKKKKPAKKTAQGEEESS	cyto(20.5),cyto_nucl(13.333),nucl(5),mito_nucl(3.333)	SKSTGAKGKKNKKKKKPAKK (384-403, prob:0.998)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUV6	Uncharacterized protein	Low	9.6	1	279-303	TLVNSSVQRQRRRCRERPTKDDLCH	nucl(13),cyto(5),mito(3),cyto_pero(3),plas(2),golg(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1J7	C2H2 finger domain protein, putative	Low	9.4	1	101-122	YQNHVKSSKHKLRESRMKNKDV	nucl(17.5),cyto_nucl(12.5),mito(5),cyto(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3G5	Fatty acid hydroxylase domain-containing protein	Low	6.2	1	297-319	DHDLHHRKGYRKSHNYGKQSRVW	cyto(10.5),cyto_pero(8),mito(6),pero(4.5),nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8X8	GP-PDE domain-containing protein	Low	6.3	1	677-699	SISQEKKRDFRVSKVDHRPHCLV	cyto(9.5),cyto_nucl(7.5),nucl(4.5),mito(4),plas(4),cysk(1),E.R.(1),pero(1),extr(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAU9	Protein dopey	Low	5.4	1	22-44	TRPRVRGKEETLRKDKNYRRYAS	plas(21),cyto(3),nucl(1),mito(1),vacu(1),mito_nucl(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCC9	Lipase/serine esterase, putative	Low	7.6	1	28-57	LETLRESKRCQDSRCKQDKKREPDKIGVIG	nucl(9),cyto_nucl(8),mito(5),cyto(5),E.R.(2),pero(2),plas(1),golg(1),cysk(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJZ6	Uncharacterized protein	Low	9.8	1	86-107	VMAEHRRKKRLQDIERYQKTRF	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKY6	Uncharacterized protein	Low	7.8	1	15-40	VTTTPTRPRPTKGQRSQMRRRVMREI	mito(15),nucl(7),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLK6	Pentafunctional AROM polypeptide, putative	Low	7.6	1	605-627	LVTPLMKQMKQKQRSSRGWIVVD	cyto_nucl(10),nucl(9.5),cyto(7.5),cysk(6),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMR9	Urea active transporter, putative	Low	8	1	3-40	DEERRTKRSRFDQTEPEPRRSRFDRRSRSPSARQSEST	plas(25)	RRS (27-29, prob:0.615)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSI7	116 kDa U5 small nuclear ribonucleoprotein component	Low	8.4	1	161-180	LNERLEKRTGRRRDEQLRYT	nucl(12.5),cyto_nucl(12.5),cyto(11.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW94	Uncharacterized protein	Low	5	1	356-383	ITFAKSMRRKDVKHTKKSRETKQADSEN	plas(23),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZ63	R3H domain protein	Low	8.2	1	448-468	SSSASGRKKTHRQKTPHDDSF	nucl(13.5),cyto_nucl(10.333),mito(7.5),cyto_mito(6.499),cyto(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZK5	Uncharacterized protein	Low	8	1	187-208	LLFLWKKRKARKQAEEERRKEV	extr(19),cyto(3),mito(2),cyto_nucl(2)	KKRKARKQAE (192-201, prob:0.826)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1M9	Obg-like ATPase 1	Low	9	1	164-187	SDVVKVKKKGKKMGPKKAVKEEKV	cyto(14.5),cyto_nucl(9.5),mito(6),nucl(3.5)	KVKKKGKKMGPKKAVKEEK (168-186, prob:0.978)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4I7	AT DNA binding protein	Low	9.9	1	74-94	QSKPSSKPKAEKKTTQKTNTE	nucl(18.5),mito_nucl(13),mito(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I562	YagE family protein	Low	9.6	1	174-194	LAEEEFKKRRRVPPERAKSYA	plas(16),nucl(4.5),mito(4),cyto_nucl(3.5)	KKRRRVPPERAKSYAERLPKARRAEK (180-205, prob:0.935)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9J9	Chromatin-remodeling complex subunit ies6	Low	5.4	1	22-49	AHLPRPFRSQNWKPSQRRNKNVKQLLAE	plas(22),E.R.(2),nucl(1),golg(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC97	Protein-serine/threonine kinase	Low	9.5	1	461-480	TQALRSKVRNREVSERKQVG	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FL21	Uncharacterized protein	Low	9	1	138-160	QPNRGRPKNTHSRHKRHESQYDG	nucl(15),cyto_nucl(10.5),mito(8),cyto(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNL0	MFS polyamine transporter, putative	Low	5	1	421-440	IPWILFKFGRRLRQNSRFIP	plas(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPJ2	Uncharacterized protein	Low	6.8	1	193-213	EKESRRRDPRTPVTPTRRANH	cyto(10),cyto_nucl(9),cysk(8),nucl(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUA0	acidPPc domain-containing protein	Low	8	1	28-54	IQLLVPHRMRRKLRSKLRSRVSPTSSI	plas(22),mito(2),E.R.(2)	RRKLRSK (37-43, prob:0.688)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWE2	Uncharacterized protein	Low	8	1	171-197	RSEKKALLAGRRRRRSRRRSTVYSEAP	extr(19),mito(4),plas(3)	RSEKKALLAGRRRRRSRRR (171-189, prob:0.978)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXC8	Protein SSH4	Low	5.8	1	950-969	AYVPSKSRKRDDTPSQRSGR	extr(8),cyto(6.5),cyto_nucl(5),E.R.(3),nucl(2.5),mito(2),plas(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXH7	Uncharacterized protein	Low	8	1	15-40	SPFGRRFRLDRSGHRRERKGSRFSTE	plas(25)	RSGHRRERK (25-33, prob:0.716)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYI4	Mannosylphosphorylation protein (Mnn4), putative	Low	9.9	1	263-285	WVPDPDAKKKFSKRSRIFRATEG	nucl(6),cyto(4.5),cyto_mito(4.5),mito(3.5),extr(3),golg(2),E.R.(2),pero(2),plas(2),vacu(2)	KKKFSKRSRI (270-279, prob:0.712)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYZ8	Conserved serine-threonine rich protein	Low	7.7	1	74-95	MEKQRRNYMSRRARALRRQAFL	mito(16),nucl(7),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZA2	Uncharacterized protein	Low	5	1	23-42	FSPTPPPPQRRISNPRRIAV	mito(12),cyto(6),extr(5),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2I8	FAD_binding_3 domain-containing protein	Low	5	1	348-370	ALAVYQKCRKKRTERIVERSSLQ	extr(16),plas(5),cyto(2),pero(2),cyto_pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1Z1	DNA polymerase epsilon catalytic subunit	Low	9.2	1	1274-1298	GFLKYQKQKWKIQKQARVRRRQLFG	mito(13),nucl(11),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMW6	Aminotransferase	Low	6.4	1	251-275	YKLPIGSWPKDKKKKEQGKYQLVQQ	cyto(8.5),plas(7),cyto_nucl(7),mito(5),nucl(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN57	Bcs1 AAA-type ATPase, putative	Low	5.9	1	517-541	AQGFLLQYKRRPRKACEKAAHWADE	plas(14),cyto(4),nucl(3),cyto_mito(3),mito(2),E.R.(2),vacu(2),cyto_pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQB4	C-4 methylsterol oxidase, putative (Fragment)	Low	7.3	1	388-411	TEYSPESMKRKREQRLAKAANKSE	plas(9),nucl(7),cyto(7),cyto_nucl(7)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRX5	Uncharacterized protein	Low	6.2	1	33-56	ESQSYSKSYSFRRKRPFLSRLLSF	plas(8),mito(6),cyto(4.5),cyto_nucl(4.5),nucl(3.5),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTY8	Anaphase-promoting complex subunit 11	Low	8.2	1	22-41	AAPISPRSTKRKRNAAAAAS	mito(15),nucl(8),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU65	Isocitrate lyase	Low	7.1	1	18-38	DAVKRWWQDPRWRYTKRPFTA	cyto_nucl(10),cyto(9.5),pero(8),nucl(7.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW97	Uncharacterized protein	Low	5	1	289-310	GLQKVLDHKKWKRRNRAFIGLA	plas(24),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXJ3	Cortical patch protein SUR7	Low	8	1	216-242	GTIRKDKGYTGRKQRRRGFFGPRRSGS	plas(18),mito(4),extr(2),E.R.(2),cyto_mito(2),mito_nucl(2)	GRKQRRRGFF (226-235, prob:0.766)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYP2	Glycosyl transferase, group 1 family protein	Low	5	1	41-61	YSTIKRLYKFYKLKSKQESVS	plas(19),E.R.(4),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9W7	Dimethylaniline monooxygenase, putative	Low	8.8	1	454-479	VLPLKEKHWKSVRERPSKLRQERAKL	mito(14),pero(7),nucl(2),extr(2)	KSVRERPSKLRQERA (463-477, prob:0.686)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HW26	Presequence translocated-associated motor subunit PAM17, mitochondrial	Low	5	1	481-502	QGYRQWLKDQRAYNRKKNRFIL	plas(18),mito(5),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2T1	Uncharacterized protein	Low	9.5	1	456-476	ATAAKVLQRRACRMKKKTRSN	nucl(16.5),cyto_nucl(11),mito(5),cyto(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F742	Beta-glucosidase	Low	9.6	1	151-175	FLLLGKSKKGKKGKHPQRKATGIVL	mito(6),plas(6),nucl(4),cyto(3),extr(2),pero(2),golg(2)	KSKKGKKGKHPQRK (156-169, prob:0.961)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBW7	MFS transporter	Low	5	1	599-620	ITQHSRSRSRSAHSRRKGWFPL	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJP6	Dihydroxy acid dehydratase, putative	Low	6.6	1	543-565	SEKDLHQRLTRRRQKIENDADST	cyto(15),cyto_nucl(12.5),nucl(6),pero(2),cysk(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FL27	RRM domain-containing protein	Low	5	1	152-171	SLVYKRYRERPQRPIKIWAF	plas(19),vacu(3),mito(2),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FS80	Uncharacterized protein	Low	6.6	1	75-94	GCQRLPKQRAHCRLHRERAE	cyto(10.5),cyto_nucl(8.5),mito(6),nucl(5.5),extr(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWX5	Uncharacterized protein	Low	9.8	1	20-45	EGHHHVHRHRHRSSHRSKSHHGRSPA	nucl(20.5),cyto_nucl(14.833),cyto(4),cyto_pero(3.165)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0L7	LysM domain protein, putative	Low	9.9	1	18-38	SATSRRSTSTVRPRNRRLISV	nucl(16.5),cyto_nucl(10),mito(7)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWP6	Plasma membrane ATPase	Low	5.4	1	58-84	AAHDESPKKRRWFTPWRRKSGPGDDNF	plas(24),nucl(1),E.R.(1),golg(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYK9	RING finger ubiquitin ligase (Tul1), putative	Low	5	1	721-747	TRTDSNSHTRQHKDKKKKIFDCAICMQ	plas(24),extr(1),E.R.(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FA15	Amidohydro-rel domain-containing protein	Low	5.7	1	355-377	EEKWNHFKKNSRRHVEKLPQQAH	plas(14),mito(3),E.R.(3),vacu(3),nucl(2),cyto_mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCZ7	Uncharacterized protein	Low	7.4	1	27-48	QSDLRSHLRSSKKKDERTITYK	cyto_nucl(9),cysk(9),nucl(8.5),cyto(8.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWN8	Fatty acid hydroxylase domain-containing protein	Low	8.9	2	199-218, 297-317	GPLWKFHRRHHLTKHPNPLL, DHDLHHRKGWRKSHNYGKQTM	plas(9),nucl(5.5),mito(5),cyto_nucl(4),pero(3),golg(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXI9	Uncharacterized protein	Low	8.9	1	133-155	PSESEHEKHHHHRQRKLLDRIDL	nucl(15.5),cyto_nucl(15.5),cyto(8.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXM8	Ribose-phosphate diphosphokinase	Low	6.8	1	83-102	KSITGCRDPSKKKSHRGAIT	cyto(13.5),cyto_nucl(11.666),cyto_mito(9.833),nucl(8.5),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXS5	DRAP deaminase, putative	Low	6.1	1	213-233	SPEERQRQEQMPRNPKKRMMG	mito(20.5),cyto_mito(12),nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0H6	Translation initiation regulator (Gcn20), putative	Low	8.4	1	133-163	VESRVDRKKLEKAEKKIRAKQEKKVMKNVEY	plas(19),E.R.(3),vacu(2),nucl(1),pero(1),golg(1)	RVDRKKLEKAEKKIRAKQEKK (136-156, prob:0.954)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G160	Uncharacterized protein	Low	5	1	627-650	VAYVFLRRFHRRHRLTRMQEESDE	extr(16),mito(3),golg(3),pero(2),E.R.(2),cyto_mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7R5	Pfs, NACHT and ankyrin domain protein, partial	Low	9	2	168-190, 207-227	KAINRTSRTRKNFGRPNPQSDRL, CPSDWEEKRLHRQHRNPILHY	cyto(8.5),cyto_nucl(8),nucl(6.5),mito(4),plas(4),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUL3	Protein SDS23	Low	9.3	1	512-532	AETRSNRRRRSSSASVNVRKS	nucl(16),cyto_nucl(13),cyto(8)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1Z6	Polynucleotide 5'-hydroxyl-kinase GRC3	Low	9.1	1	46-90	EEPPTKKTKPSPPTDEKWADSTKPRTDKRRRKRKLAAEGRQDDSM	mito(16.5),cyto_mito(11.5),cyto(5.5),nucl(4)	STKPRTDKRRRKRKL (66-80, prob:0.973)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I310	IPPc domain-containing protein	Low	8.1	1	1047-1069	VEVPHKDKERRAWEERRRNIIEP	nucl(10),cyto_nucl(8.5),cyto(5),mito(4),plas(3),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHD1	Leucine carboxyl methyltransferase 2	Low	7.3	1	42-67	YPQPHFFRYFVKKPQRRAPLINRGYW	cyto(10),cyto_nucl(10),nucl(8),pero(7)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHY2	Uncharacterized protein	Low	5	1	504-526	TAESERPRRQNTRRISNNYQFER	plas(17),mito(3),extr(2),pero(2),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU89	C6 zinc finger domain protein	Low	8.9	1	482-501	YDTVWRWRQRFRPTKPTDDT	nucl(13.5),cyto_nucl(10),cyto(5.5),pero(4),plas(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FV81	Probable E3 ubiquitin ligase complex SCF subunit sconB	Low	8.1	1	133-153	AAQPRWKATKRGKDGKLLPPA	nucl(10.5),cyto_nucl(9),cyto(6.5),mito(6),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0J5	Signal peptide peptidase, putative	Low	8	1	49-70	RPSSAAKSSKSRKKEHESSSEE	plas(17),E.R.(5),vacu(2),mito(1),extr(1),golg(1)	KRVRR (608-612, prob:0.634)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1P5	Actin-bundling protein Sac6	Low	6.4	1	3-24	GIPWAYRCLIRRKYPQFQQDEI	plas(16),nucl(4),cyto(4),cyto_nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3I4	Beige/BEACH domain protein	Low	9.1	1	1024-1047	KSPSVLRKKKSFRLDPRLRRRSPS	plas(18),nucl(3),extr(2),cyto_nucl(2),mito_nucl(2)	RKKKSFRLDPRLRRR (1030-1044, prob:0.779)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4Y9	Very-long-chain 3-oxoacyl-CoA reductase	Low	8	1	325-346	MHESIRKRALRKAEREKGKKAI	mito(16),cyto(9)	IRKRALRKAEREKGKKAI (329-346, prob:0.961)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9N0	Uncharacterized protein	Low	9.1	1	199-226	YEAEMAPDPKRPRRQRRIRGGPITQLVR	plas(12),E.R.(5),nucl(3),mito(3),cyto_nucl(3),extr(2)	KRPRRQRRIR (208-217, prob:0.829)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBL8	Tubulin-folding cofactor C	Low	9.9	1	100-121	ASVAPRQKFAFKRKKNPSAVSL	nucl(20.5),cyto_nucl(15),cyto(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIL9	GAS2 domain protein	Low	9.3	1	15-39	LNPAKIRRPSRSSSRSPERKSQFSY	nucl(14.5),mito(11),cyto_nucl(8.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU15	DnaJ domain protein	Low	6.5	1	20-45	SSSPSPFVNRHRPSRRSREHARAAAL	mito(11),extr(9),nucl(4),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZC6	MFS transporter	Low	5	1	516-535	GPGVIRPRRHHNWAARNPGV	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1N3	Lon protease homolog, mitochondrial	Low	8.5	1	133-155	LEEESKKDRPKEQPKPEEDKIEE	mito(21.5),cyto_mito(12.833),mito_nucl(12.666),nucl(2.5)	KKGRK (181-185, prob:0.632)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2S2	Mitochondrial genome maintenance protein MGM101	Low	9.2	1	299-319	EHVVNKRKTKIWLRKDDEVSY	nucl(17),cyto_nucl(14),cyto(9)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3K2	Vegetative incompatibility protein HET-E-1	Low	7.1	1	89-120	EKLHATRPNKKNVGNQKRDKVRKHFNWRSITW	cyto(7.5),cyto_nucl(7.5),nucl(6.5),E.R.(5),plas(3),extr(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAD1	C-3 sterol dehydrogenase/C-4 decarboxylase	Low	6.6	1	135-154	GFENCKDKEHKKNMKLYITK	cyto(13.5),cyto_nucl(10),nucl(5.5),mito(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAL1	Carboxypeptidase	Low	5	1	538-561	GYLIWRSRRSRRGYREVPLRGRRS	extr(9),plas(4),E.R.(4),golg(4),vacu(3),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVF5	ABC transporter domain-containing protein	Low	5	1	1275-1301	RNAKHWFSARKTQKGSKDQRTRSVEEK	plas(21),E.R.(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1P1	Actin-interacting protein	Low	8.6	1	124-148	NLLHGLKKKQARLRSRQTRDDGRAS	nucl(18),cyto_nucl(11.833),mito_nucl(11.833),mito(4.5),cyto(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG90	MYND-type zinc finger protein samB	Low	8	1	572-602	KWEEFQRQFAKCRRCRRTKYCSKDCQKAAWV	nucl(10.5),mito(9),cyto_nucl(9),cyto(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK51	Fungal_trans domain-containing protein	Low	9.1	1	3-32	PRELRKLSARRDKCHIRPHVRRDIAKQYDK	plas(20),nucl(3),mito(2),cyto_nucl(2)	SRKRARE (233-239, prob:0.689)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLA6	DNA-directed RNA polymerase subunit	Low	9.6	1	127-146	ALRTRDPKRRFDQIWRLSKD	cyto_mito(8.333),cyto(8),cyto_nucl(7.833),mito(7.5),nucl(6.5),plas(3)	SNRPVKAIRGRLKGKEGRL (333-351, prob:0.862)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMY3	Amidase domain-containing protein	Low	5.9	1	569-592	EDLQRRSGTKHKRSQPTWRGYMQR	extr(19),cyto(3.5),cyto_nucl(3.5),nucl(2.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUB5	MFS multidrug transporter	Low	5	1	538-558	MQEDKKKLEGKRQLRRDQEAA	plas(26)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVC4	Uncharacterized protein	Low	9.6	1	260-284	HRVAREAKRTWPRVKRKSDCPQRSG	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX03	Uncharacterized protein	Low	5	1	211-235	ILWRYITKRKQQGRQQQNRMSQRST	plas(10),extr(9),E.R.(4),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G016	Uncharacterized protein	Low	8	1	780-804	CFVFSEDKPKRNGKRKGKEWLALQT	extr(10),cyto(4),plas(3),cyto_nucl(3),E.R.(3),cyto_pero(3)	KPKRNGKRKGK (787-797, prob:0.834)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6Q7	Cell surface protein Mas1, putative	Low	5	1	273-292	AAKKRSIEYRMRKRHFARGI	extr(22),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G997	Zn(2)-C6 fungal-type domain-containing protein	Low	6.9	1	10-41	ACLVCRHRKVACDRRRPKCGLCQKNNFDCQYK	plas(10),nucl(5),mito(4),E.R.(4),cyto(2),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDD3	Uncharacterized protein	Low	5.8	1	790-812	SSNSRGRREPGWRRPGNRYTRGD	plas(17),E.R.(5),nucl(2),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEX8	4-nitrophenylphosphatase	Low	6.6	1	61-82	VTNNSTKSRKDYKKKLDGLQIP	cyto(17),cyto_nucl(13.5),nucl(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWS5	ADP-ribosylation factor family protein	Low	5	1	231-251	AVEWVRSRVKWNKEGRPPVMR	cyto(15),mito(10)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYZ8	Ankyrin repeat protein	Low	6.4	1	595-618	WSTSKVYREKDRRCQKRKIELLIS	cyto(9),plas(5),cyto_mito(5),cyto_pero(5),nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5W8	Uncharacterized protein	Low	9.6	1	217-250	GSFFSRTKSPEKDNKNKLKDKKEDDEKEQKQPRK	mito(14),cyto(5),nucl(4),pero(2)	KNKLKDKK (231-238, prob:0.638)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9F1	IQ and HECT domain protein	Low	5.8	1	249-271	LSASRRIQRTWRGYRSRKITRSI	plas(18),mito(6),nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBN4	Monooxygenase, putative	Low	7.7	1	94-115	SPLLPLKYHPHRVRRTRLQSAL	cyto(9.5),nucl(9),cyto_mito(7.5),mito(4.5),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FD48	Mitochondrial 54S ribosomal protein YmL10/YmL18	Low	8	1	282-302	ADRKSTAGVKKEKKLPENRLW	mito(18),extr(6),cyto(3)	KRIRRGRGPASGKGKTSGRGHKGQ (52-75, prob:0.961)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQC7	ATPase synthesis protein 25	Low	8	1	192-212	GRNELKIKLRRKARRARIASS	mito(20),cyto(5)	KIKLRRKARRAR (197-208, prob:0.893)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQS2	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	Low	5	1	74-95	SSFYKTLKDKIRHAKRRVYLST	mito(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU04	Cytochrome P450 phenylacetate 2-hydroxylase	Low	6.2	1	507-526	VTQPKPFKVRFQPRNEVQLE	extr(10),cyto(7.5),cyto_nucl(6),nucl(3.5),E.R.(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVD9	Uncharacterized protein	Low	8	1	110-140	SDIVAEQRRRRRELRRRTKIRRATPLQEAPS	plas(19),mito(4),E.R.(3)	RRRRRELRRRTKIRR (117-131, prob:0.956)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVH5	Fe-S cluster assembly protein DRE2	Low	6.7	1	207-230	VQPPECQPKPGKRRRACKDCTCGL	cyto(15.5),cyto_nucl(12.5),nucl(6.5),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6X4	Uncharacterized protein	Low	8	1	143-166	VQLYNQRNSKPQRKPGGGKHQAGR	mito(25),cyto(1.5),cyto_nucl(1.5)	RKPGGGK (155-161, prob:0.658)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAR8	Uncharacterized protein	Low	9.6	1	1-23	MEPKTSRHRRNISSRSSRPRSST	nucl(17),cyto_nucl(11),mito(6),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HU29	SET domain-containing protein	Low	8.8	1	417-444	QDRLAKEKEKPSANKKSKGKGKGKKAKH	cyto(19.5),cyto_nucl(12.833),cyto_mito(11.166),nucl(4)	AKEKEKPSANKKSKGKGKGKKAKH (421-444, prob:0.998)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FA05	Nuclear pore complex protein An-Nup82	Low	8.5	1	76-99	EWQLEARSKRKSAKKEDNTQNESV	mito(15),nucl(9),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQR0	DnaJ domain protein Psi	Low	5.9	1	22-46	IKKAYRKAALKWHPDKNKNNPQAAE	cyto(14),cyto_nucl(9.5),mito(8),nucl(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU34	MFS domain-containing protein	Low	8	1	491-523	TTIWGPKWRQKVDEKNRRKRIRRSNADAQRQAA	plas(27)	KVDEKNRRKRIRR (501-513, prob:0.866)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0Z3	Uncharacterized protein	Low	5	1	343-365	NERIMRSGKSRHRRRSSQGVSSN	plas(14),mito(9),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5Y7	Uncharacterized protein	Low	9.8	1	43-69	KVAEDKRQLSLKKRWRKRGPGDGEDII	plas(18),nucl(5.5),cyto_nucl(3.5),mito(1),golg(1),vacu(1)	LKKRWRKRG (53-61, prob:0.821)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FA79	Ubiquitin conjugation factor E4	Low	9.1	1	190-209	LLPCWKRVSRLYKGFKKSRD	nucl(15.5),cyto_nucl(11),mito(6),cyto(5.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMJ9	60S ribosomal protein L10	Low	8.8	1	1-31	MARRPARCYRYCKNKPYPKSRFNRGVPDPKI	nucl(11),cyto(9),mito_nucl(9)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPL2	HEAT repeat protein	Low	9.1	1	273-302	PEVRIEPIPKIKKPKRQSKKPAPRSGDEEE	plas(13),cyto_nucl(4),nucl(3.5),cyto(3.5),E.R.(3),mito(1),pero(1),golg(1),vacu(1)	PIPKIKKPKRQSKKPAPR (279-296, prob:0.972)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTJ8	DUF500 domain protein	Low	7.5	1	74-97	DEERMKRDSKGRIDRPQGKQRVVK	nucl(9),cyto_nucl(9),cyto(7),mito(4),pero(3),plas(1),golg(1),cysk(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6L8	Translocation protein SEC62	Low	8.6	1	314-344	DSFKPLWGWQEKKKKKSKKSEKTAKIDEKSA	plas(14),mito(5),nucl(2),cyto(2),cyto_nucl(2),pero(2),E.R.(2),cyto_pero(2)	KKKKKSKKSEKTAK (325-338, prob:0.973)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9C0	Uncharacterized protein	Low	9.6	1	502-527	LFDCLFIWRKYKRKSHQQSAPQSSQF	nucl(12),mito(7),cyto(3),pero(2),golg(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCB8	Mitochondrial 54S ribosomal protein YmL7/YmL5	Low	5	1	11-32	SPVWNFLARRRRQLHPRQQDIA	mito(23),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEW8	Uncharacterized protein	Low	8	1	544-572	WAYVRLLDHFRRQRKRKQKLSRGDLHDFV	plas(11),extr(9),golg(3),E.R.(2),vacu(2)	RQRKRKQK (555-562, prob:0.74)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAN1	EF hand domain protein	Low	8.5	1	40-65	ASSSHTSLRRRNAVRRHRRHDFDEDI	nucl(12.5),mito_nucl(11),mito(8.5),cyto(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGT7	Mitochondrial large ribosomal subunit protein L1	Low	8	1	39-73	QIRGAKSNPQAKNKKTKTKKKEKGAREFKQKDLKD	mito(24),mito_nucl(13.666),cyto_mito(13.166)	KSNPQAKNKKTKTKKKEKGAREFK (44-67, prob:0.985)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP59	Integral peroxisomal membrane protein	Low	8	1	414-434	RQDGWGRYTRRRKWYRDAELV	plas(24),E.R.(2)	K (481-481, prob:0.603)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2M5	Acetamidase	Low	6.4	1	7-29	YFEYIKVRDLKRRERAHRFASLS	cyto(11),mito(10),cyto_nucl(9),nucl(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3X8	Transcription factor TFIIIC complex subunit Tfc6	Low	7.2	1	104-125	QKAASARKSRPRKTVDSRPEDT	mito(15),nucl(7.5),cyto_nucl(6.5),cyto(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7V1	Mitochondrial ribosomal protein DAP3, putative	Low	8	1	22-64	YAPPLKKKSKSMEGPAKYRQAKSAKMKKKKQVDRPRPPPVGER	mito(21),cyto(4)	LKKKSKSMEGPAKYRQAKSAKMKKKKQVDRPRPPPVGERRALRKR (26-70, prob:0.998)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA41	Serine/threonine protein kinase	Low	9.1	1	1689-1714	QVKLARLKKIPNKKVVLKYVTKKRIL	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(3),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4B5	MIP transporter, putative	Low	8.4	1	614-646	NYPWERTQRAMRKSKAKWKRRLHMHLGKKDKEY	plas(15),extr(6),mito(2),nucl(1),pero(1),E.R.(1),vacu(1),cyto_mito(1)	RAMRKSKAKWKRRLHMHLGKK (622-642, prob:0.94)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5X0	Uncharacterized protein	Low	8.5	1	1-30	MPKPKSFLKETSKTKKKTKQQQEPQTADEF	nucl(12.5),cyto_nucl(10),pero(5),cyto(4.5),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7Z3	C6 finger domain protein, putative	Low	9.1	1	72-92	CENCRLKKTRCDESRPKCGLC	nucl(11),plas(10),mito(2),cyto(2),cyto_mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIB4	Uncharacterized protein	Low	5	1	321-343	EESKRSWTSSPRPKNSRSDDERE	plas(20),E.R.(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWQ9	Uncharacterized protein	Low	7.8	1	1085-1109	GPDYYIKSQSRRKIKPKSTHLDSVE	cyto(11.5),cyto_nucl(11.5),nucl(10.5),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZD7	Transcription initiation factor TFIID subunit 8	Low	9.8	1	19-42	SDQAGLKRIKRHYHHHHRLQYPVT	nucl(19.5),cyto_nucl(14.5),cyto(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZV6	Septin AspA, putative	Low	6.6	1	1-24	MSSALNAIRRKKNVKKGIQFCLMV	mito(18),nucl(5),cyto_nucl(5),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2C6	MAP kinase kinase kinase Ste11	Low	6.5	1	122-142	IKQLRNKAISNRKKQNIKALA	mito(11.5),cyto_mito(9.833),cyto_nucl(7.333),cyto(7),nucl(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3M9	Uncharacterized protein	Low	7.4	1	678-700	IPSRSASHSQRNNANRNNRRSST	nucl(7.5),extr(7),cyto_nucl(6.5),cyto(4.5),mito(4),golg(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7L2	Uncharacterized protein	Low	9.1	1	76-95	FEKRARRTFSWQSCQRRFKA	nucl(15.5),mito_nucl(13),mito(9.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I686	Uncharacterized protein	Low	6.4	1	193-214	PIETKKSKEFRAIKKHPNMHIA	mito(17),nucl(4),pero(3),extr(2),cyto_pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBS7	Protein arginine methyltransferase NDUFAF7	Low	7.9	1	40-64	CRDHRQCRTFLTRRGQTKRRGTDDS	mito(13),nucl(9.5),cyto_nucl(7),cyto(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGZ1	Plasma membrane stress response protein	Low	5	1	462-487	WRMYREYKNRKMEKNVRRRQRTQTLD	plas(22),E.R.(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPS7	mRNA-nucleus export ATPase (Elf1), putative	Low	9	1	1058-1092	EDTGELKFKAKKKKKMTRAQLKERETRRRLRHIEW	cyto(11.5),cyto_nucl(8),mito(7),nucl(3.5),extr(2),pero(2)	KFKAKKKKKMTRAQLKERETRRRLR (1064-1088, prob:0.986)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPV4	C2H2 finger domain protein (Zms1), putative	Low	7.6	1	121-147	ESPCSSCVKRNLKCNNQRKKSLKEAVN	mito(9.5),nucl(8),cyto_mito(7),cyto(3.5),E.R.(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQH4	Zn(2)-C6 fungal-type domain-containing protein	Low	8	1	34-55	GFTCRWSDRKRTAAKDTRRDAQ	plas(11),nucl(8),mito(4),cyto(1),E.R.(1),golg(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW73	Uncharacterized protein	Low	5	1	237-261	LEERLRDQSKRMRERQRYNRSLDTS	cysk(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW78	Mannosyltransferase	Low	7.7	2	655-699, 737-759	QDSRDSARKKEQIQRDKKFDRIIETFRRQAKPQKSWWRQPSWSYP, LKLPSWPFSSKKKKSVLDRELWE	plas(22),nucl(2),cyto(2),cyto_nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G485	Uncharacterized protein	Low	8	1	17-38	VSIVRLKKGKKRFELACYKNKL	mito(25.5),mito_nucl(13.5)	KKGGKGSK (245-252, prob:0.666)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6I0	Uncharacterized protein	Low	9.8	1	11-30	VQQKTFTKWLNNKLKIRNIA	nucl(12),cyto(6),mito(5),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAP8	MFS multidrug transporter	Low	5	1	372-392	AWMSRRAKRIRTRPEPEFRLW	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVW4	Autophagy-related protein	Low	5	1	57-86	DADKERRPRATYRCSRKVKSSRSRQRDLGE	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBT6	Uncharacterized protein	Low	9.2	1	835-855	LPSNSRTERPEQNRPPRPDDA	nucl(15.5),mito_nucl(12),mito(7.5),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK43	Molybdenum cofactor sulfurase	Low	8.2	1	640-667	RFPPQTSPRYSKPRRPFIRRTKHTGSDM	nucl(12),cyto_nucl(10),cyto(6),pero(5),mito(2),plas(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FR58	Uncharacterized protein	Low	8	1	716-744	MLLSCLIRRCRQPKRPKGAGRPPPGRYPP	extr(25)	QPKRPKGAGRPPPGR (727-741, prob:0.874)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXR6	Chloride channel protein	Low	5	1	53-76	EQPQEPISFKPRHKRPSRFSLSNL	plas(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1Q1	Kinesin motor domain-containing protein	Low	9.1	1	661-681	LAEITKPKQKRAKTNSPAVTE	mito(20),mito_nucl(13.333),cyto_mito(11.333),nucl(5.5)	QIKKPEIAKRASPLKRKSDTFKSPRPRSAKGL (442-473, prob:0.948)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G349	TPR domain protein	Low	9.4	1	545-592	ALAKKHVPIVKKRTKRFFRHQSDRFARVDPSWRKPKGIDNCVRRRFKG	pero(11),cyto(9.5),cyto_nucl(7.5),nucl(4.5)	KMALAKKHVPIVKKRTKRFFR (543-563, prob:0.871)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HT09	rRNA processing protein Pwp1, putative	Low	9	1	246-269	EESGEVKKPKKKKKTKANDEFHVD	cyto_mito(11.833),cyto(11.5),mito(10),cyto_nucl(8.666),nucl(4.5)	KKPKKKKKTK (252-261, prob:0.964)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWP0	SIN3 transcription regulator homolog B	Low	9.7	1	143-164	GPSYRLLPKRERQKPCSGRDQL	nucl(15),cyto(8.5),cyto_mito(6),mito(2.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HX81	Aminotran_1_2 domain-containing protein	Low	5	1	68-87	ECNQYSPTKGRPRLKKAIAD	mito(15),cyto(8),mito_nucl(8)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZ85	Uncharacterized protein	Low	8.4	1	258-280	RFPPPPKYIKVKLHNKKQKTFDH	nucl(11),cyto(9.5),cyto_mito(7.5),mito(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0L3	Eukaryotic translation initiation factor 3 subunit M	Low	7.4	1	432-453	GRAGGDRRRNQQQQQQQPREVE	cyto_nucl(9.5),cyto(9),nucl(8),cysk(7)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3H6	Uncharacterized protein	Low	5.9	1	853-874	YLAHENCKRKKGRQTSLSSDYV	cyto(5.5),plas(5),cyto_nucl(4.5),E.R.(4),golg(4),extr(3),nucl(2.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGL3	Cytochrome c oxidase assembly protein COX20, mitochondrial	Low	8.9	1	160-183	VEMMKELKLKKQREKEQKQAEEAA	nucl(13.5),cyto_nucl(10),pero(6),cyto(5.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FL07	21S rRNA (Uridine(2791)-2'-O)-methyltransferase MRM2	Low	5	1	21-46	AIFPKRHSSSKRWQARQSKDHFTREA	extr(18),mito(4),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM60	Magnesium dependent phosphatase, putative	Low	8.3	1	194-215	RGVWEWRRRRGIKPEDVKEKQD	nucl(9),cyto(9),cyto_nucl(9)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX70	Hsp70 family chaperone Lhs1/Orp150, putative	Low	8	1	957-994	GNSNEGSSKKNGKKNNSKKDKKQQKQDKEEKKSRKDEL	mito(14.5),cyto_mito(12.166),mito_nucl(9.999),cyto(7.5),cyto_nucl(6.499)	SKKNGKKNNSKKDKKQQKQDKEEKKSRK (964-991, prob:0.981)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYE9	Uncharacterized protein	Low	6.1	1	62-82	YFAHKNSTKKRWSRTPEPIGL	cyto(12.5),cyto_mito(10),mito(6.5),nucl(4),pero(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3B4	Atypical serine/threonine protein kinase BUD32	Low	5.8	1	49-68	LKIRPSKPYRHPILDKRLTR	cyto(14),mito(9),nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G731	ABC transporter domain-containing protein	Low	8.8	1	840-864	RLLKAPSKAGGNRKKRKRTEKTYIG	mito(17),cyto(7),nucl(2)	KAPSKAGGNRKKRKRT (843-858, prob:0.969)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUX1	Uncharacterized protein	Low	9	1	1-20	MKSRSRSQSRSPDGHHHKYR	nucl(14.5),cyto_nucl(11.5),cyto(7.5),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5B0	BTB/POZ domain protein	Low	8.2	1	290-310	EKESWLRCTKCRTRHFPVGFP	nucl(11.5),cyto_nucl(11.5),cyto(10.5),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCY0	Chromatin assembly factor 1 subunit B, putative	Low	9.3	1	700-722	KGQSNESQPQQSKKRRIAPTLVS	nucl(17.5),cyto_nucl(14),cyto(9.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXH0	Vacuolar membrane PQ loop repeat protein	Low	8	1	99-124	ISQCLYYKFRNKRREAHRRRSSTPDP	plas(22),E.R.(3)	KRREAHRR (110-117, prob:0.667)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FY97	Pheromone-regulated membrane protein, putative	Low	7.7	2	199-222, 290-310	VRGFSGRERLRRRFKPQQTPIASG, HNTPKREKIKWYKKENSRSAV	plas(21),nucl(2),mito(1),cyto(1),E.R.(1),golg(1),cyto_mito(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G806	Ubiquinol-cytochrome c reductase iron-sulfur subunit	Low	7.2	1	98-117	PKTTTYKQFKEKKAKEAAKN	cyto(15),cyto_nucl(13.333),nucl(9.5),mito_nucl(5.666)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD37	Uncharacterized protein	Low	9.7	1	59-78	SELLSRHKNKERTPNRNWAI	nucl(18),cyto_nucl(12.5),cyto(5),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQT9	Delta(14)-sterol reductase	Low	5	1	356-375	GANSQKNRFRQNPNDPRVKH	plas(24),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTD7	Uncharacterized protein	Low	7.3	1	355-375	EVTPHRSSHHHHKHVRRSGVI	cyto_nucl(9.5),mito(9),cyto(9),nucl(8)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVB8	Glycerol kinase	Low	9	1	546-568	LLELKKIEIQKRIKKLRRVKYSG	cyto(11.5),cyto_nucl(8),cysk(7),pero(5),nucl(3.5)	KRIKKLRRV (556-564, prob:0.763)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJ17	t-SNARE coiled-coil homology domain-containing protein	Low	7.2	1	230-252	QSRLDNAKRRLNKIRKNASDNWS	cyto_nucl(8),nucl(7.5),cyto(7.5),extr(5),mito(2),pero(2),golg(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPQ8	Uncharacterized protein	Low	8.9	1	345-367	RSPETGSPNRRKRIQQWLRSVDE	nucl(14.5),cyto_nucl(11),cyto(6.5),pero(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRW1	Ubiquitin-protein ligase	Low	8	1	540-563	ITELEASRRRRRRPRLGGRSEMRD	plas(19),vacu(3),mito(2),E.R.(2)	RRRRRRPRLGGR (547-558, prob:0.921)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVK4	Septin-type G domain-containing protein	Low	9.8	1	245-270	PLPPQSTRSRSRNRSRRTKSSPSISE	nucl(13),cyto(5),mito(4),pero(2),plas(1),golg(1),cysk(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZS7	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial	Low	8	1	65-93	QLKAEAKALKARKREKKDQEETSRQRWEL	mito(25)	KQLKAEAKALKARKREKK (64-81, prob:0.91)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0N9	Uncharacterized protein	Low	6.2	1	1-21	MESVRQKCRPKHQVLILKCYP	mito(22),nucl(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1D3	Seryl-tRNA synthetase	Low	9.5	2	9-30, 438-465	SERGGDPKKVKESQRRRFAPEE, VKELPKDTTSQKKGKQEKKQAPKTGDVA	cyto(13.5),cyto_nucl(12.833),nucl(11),mito_nucl(6.333)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G332	Conserved serine proline-rich protein	Low	9.8	1	187-206	LSGPREPKPLKRRPLPIDPT	mito_nucl(11.166),mito(11),nucl(10),cyto_mito(9.166),cyto_nucl(8.666),cyto(6)	PKPLKRR (193-199, prob:0.662)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7I5	DUF2293 domain-containing protein	Low	9.3	1	146-166	RFVPAPPKRTRPRNDGIDRRG	nucl(14.5),mito(11),cyto_nucl(8.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I666	DNA helicase, putative	Low	5	1	803-822	EKSATKAKSKRTQNDKAEDG	cysk(21),cyto(3.5),cyto_nucl(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F6Z0	UvrD-like helicase ATP-binding domain-containing protein	Low	9.9	2	231-251, 1921-1940	LDSNDKKSNRARKETAPRFEI, VTRLQRRWRHILPRIRSARE	cyto_nucl(11),nucl(10),cyto(10),plas(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLE2	Uncharacterized protein	Low	9.8	1	104-124	FDNTRFPARRRPSRDPLPPGC	nucl(13),cyto(7),mito_nucl(7)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FME6	CID domain-containing protein	Low	8.6	1	799-818	ESETQPSTRKPRPKAEDMFA	nucl(13.5),cyto_nucl(13),cyto(11.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXD7	Patatin-like phospholipase domain-containing protein	Low	8	1	47-81	VAINDWRPIRQRVRKPGRRRKAPKRSKDETREGVV	plas(20),cyto(3),golg(2)	IRQRVRKPGRRRKAPKRSK (55-73, prob:0.995)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G167	Uncharacterized protein	Low	9.5	1	1-22	MGAARQEKRKRKEWERPLGGGA	cyto(9.5),cyto_mito(7.5),cysk(7),nucl(5),mito(4.5)	KRKRK (8-12, prob:0.709)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G624	Uncharacterized protein	Low	8.6	1	126-145	KSSARSWSKALRHPRRKALS	mito(12),nucl(9),cyto(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G772	Salicylate hydroxylase, putative	Low	5.7	1	371-391	TEVFEKFNRVRRPRINKIYEI	cyto(13),cysk(10),nucl(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDE7	Abhydrolase_3 domain-containing protein	Low	5	1	39-66	FYSIYYIPRSRRQHRKWTHRQALWTQLF	plas(18),mito(4),E.R.(2),cyto_mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZC2	MICOS complex subunit MIC60	Low	8	1	101-120	ATPPPPPPPARKKGGFRRFL	mito(24.5),mito_nucl(13.5)	ARKK (110-113, prob:0.648)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1D4	Sorting nexin 3	Low	9.5	1	43-66	TLSVPRSPARRGPRTPRKISAQAT	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4I0	BTB domain-containing protein	Low	7.6	1	288-309	VVLRLHLSEKKVRKKWERTRTV	cyto_nucl(12.833),nucl(11.5),cyto(11),cyto_mito(8.499)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDN0	Pfs domain protein	Low	6.1	1	1219-1238	CDTSKLISRQPRSTKRPAIH	plas(19),nucl(3),cyto(3),cyto_nucl(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIJ5	Cytomegalovirus gH-receptor family protein, putative	Low	8	1	1544-1563	DPEGLKKVRDREERDKSGKD	plas(23),mito(1),cyto(1),E.R.(1),vacu(1),cyto_mito(1)	IRRIGRPGNLRHRR (1036-1049, prob:0.724)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWT3	APH domain-containing protein	Low	8.9	1	50-73	LPPGVLKRKYAKPRLYREQLRMNV	nucl(13.5),cyto_nucl(9.5),cyto(4.5),mito(3),pero(2),cysk(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX97	Mitochondrial export translocase Oxa2, putative	Low	8	1	131-153	VEMAKRQRTLRKRWKAARFHGQA	mito(23.5),cyto_mito(12.5)	TLRKRWK (139-145, prob:0.666)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G145	2-(3-amino-3-carboxypropyl)histidine synthase subunit 1	Low	8	1	20-41	AVQPVNQTRQPKKRFVGRRTAD	nucl(11.5),cyto_nucl(11.5),cyto(10.5),pero(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1P8	C6 transcription factor	Low	7	1	40-63	YVCQYLPSRRGGRRKARQTTGSLP	mito(14),nucl(6.5),cyto_nucl(6.5),cyto(5.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G564	DnaJ domain protein, putative	Low	5.7	1	40-60	IKKAYRTLSKKYHPDKNPGDE	E.R.(11),extr(7),cyto(3),golg(3),nucl(2),cyto_mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G613	DUF1275 domain protein	Low	5	1	186-206	VVDPRFLARKNRPRNRRVLFL	plas(22),E.R.(2),mito(1),pero(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYE0	Uncharacterized protein	Low	9.3	1	271-295	SSLSTRSRTLSQRRRNNLKNREGVD	nucl(15.5),cyto_nucl(10),mito(7),cyto(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDS0	Protein-lysine N-methyltransferase EFM6	Low	6.6	1	177-199	DTVCYFCFKRRRRADLRFIKLAK	cyto(18),cyto_nucl(13),nucl(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIV7	MFS domain-containing protein	Low	5	1	484-504	FEKGVKPWKTKVQYQNVRKME	plas(22),E.R.(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKB9	Uncharacterized protein	Low	7	2	11-31, 203-226	APWANQRRWVRPRQSGCCDKD, ALVGRCWRCWRCRRTSRGDRDDDA	mito(19),extr(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKR3	Carboxylic ester hydrolase	Low	5	1	480-505	RGTSATSPKYHRRHCRYPRRNVYVGP	extr(20),mito(3),cyto(2.5),cyto_nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FL30	Vps8 domain-containing protein	Low	6	1	1809-1830	IWRAWEKKQVEQRQHRELKRVE	plas(8),extr(7),cyto(4),nucl(3),E.R.(2),vacu(2),cyto_mito(2),cyto_pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ80	DNA-directed RNA polymerase	Low	8.8	1	46-69	SSTSTTTKERSRRPSFQSRRSLAT	mito(23),nucl(2)	ILAKRKSKMGRSK (507-519, prob:0.824)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRK6	40S ribosomal protein S4	Low	5	1	1-20	MGRGPKKHQKRLSAPSHWLL	mito(17),cyto(7),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G554	Asparginase	Low	6.5	1	529-552	SIAQGGRAYRHRRYRVRHFPAGDF	cyto(14.5),cyto_nucl(11.5),nucl(5.5),cysk(3),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G999	Ser/Thr protein phosphatase family protein	Low	9.2	1	587-611	RQPAEHKRPSPPGQPRKPNLKFFED	mito(12),cyto(6),cyto_nucl(6),nucl(4),extr(4)	RGRGGFGGRGRGRGSDRGGRGGRGRGGF (651-678, prob:0.961)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDG1	NADPH:adrenodoxin oxidoreductase, mitochondrial	Low	8	1	516-536	VEKERGKQKGKLREKFGRVEE	mito(24.5),cyto_mito(13.5)	ERGKQKGKLRE (519-529, prob:0.734)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDW6	RING finger domain protein	Low	5.8	1	481-509	VLYCRWKLAQTHRKRKVLNYDRAKKQVVG	plas(17),mito(6),nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HX73	Uncharacterized protein	Low	5	1	1193-1212	GKNFIFKKNRQGKLEKINIG	cysk(16),cyto(9.5),cyto_nucl(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9W3	CRAL/TRIO domain protein	Low	5	1	173-193	APPSPTQPKKTKRRSFFWGKG	mito(18.5),cyto_mito(12.5),cyto(5.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCA9	cAMP-dependent protein kinase type 2	Low	8.5	1	4-23	LGGLLKKKRTKDSNSLSKEI	nucl(11.5),cyto_nucl(9),pero(7),cyto(5.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKI5	MFS transporter, putative	Low	8	1	326-352	VPETFWDRRPRPRKRTKRPHMYRSVSD	plas(25)	RRPRPRKRTKRP (333-344, prob:0.933)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLD2	Uncharacterized protein	Low	9.5	1	135-158	AQRGRSAGRDRPRRQRRQSSEEEE	mito(20),nucl(4),cyto(3)	QKPRTDSRGRRPGPARFGAAQRGRSAGRDRPRRQRR (116-151, prob:0.969)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLK3	Uncharacterized protein	Low	8.9	1	967-989	SALPSRHNNNNSKNNHNHKRFES	nucl(14.5),cyto_nucl(10.5),cyto(5.5),plas(3),mito(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ20	Chromosome condensation protein (CrcB), putative	Low	5	1	85-105	APPPVPRQSSRRRPWDHQVSP	plas(26)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU75	Zn(2)-C6 fungal-type domain-containing protein	Low	9.8	1	68-87	CTPCRRLKTKCDGQNPCSNC	nucl(15),plas(8),mito_nucl(8)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2I1	Acyl-CoA thioesterase	Low	9.8	1	201-227	RVDMRKYNRTEKIRKNPHKYRQLQFYR	nucl(12),cyto(8),pero(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G422	MFS domain-containing protein	Low	5	1	450-470	FLFMRYTVKLRKRSKFSQSEV	plas(26)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9A4	Abhydrolase_3 domain-containing protein	Low	8.7	1	726-749	GRRSALPSPGKRRHRRSPLVMMWN	mito(10),extr(9),cyto(3),nucl(2),plas(2),cyto_pero(2)	RSALPSPGKRRHRR (728-741, prob:0.808)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWE5	TfdA family taurine dioxygenase, putative	Low	6.4	1	67-89	EGQKKIYKNRFNADRKKQSHKEG	mito(12.5),cyto_mito(9.5),cyto(5.5),nucl(5),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FH96	3-ketosteroid reductase	Low	8	1	390-415	VAVVEEDRRRRRKRGARDLTVEDRQR	plas(8),cyto(6.5),extr(6),cyto_nucl(4.5),mito(2),E.R.(2)	RRRRRKRGA (397-405, prob:0.878)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMN8	MFS monocarboxylic acid transporter, putative	Low	5	1	35-56	GPLRRPPGSRSRSRHSRPSTDD	plas(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU66	Uncharacterized protein	Low	5	1	470-492	IFLLCCRKRRAYRRSRDQELRKL	extr(20),mito(3),plas(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G025	SRP9-21 domain-containing protein	Low	8.8	1	31-53	YSYPSRSPKSHPRSKPKVTDPAA	mito(13),cyto(10.5),cyto_nucl(7),nucl(2.5)	AKGGKSKKKGGKGKR (155-169, prob:0.993)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0W2	Phospholipid-transporting ATPase	Low	8.3	1	740-759	KLIHKKRSTKGKKAMSRKSN	plas(22),cyto(2),nucl(1),E.R.(1),golg(1),cyto_mito(1),cyto_pero(1)	RAKLIHKKRSTKGKKAMSRKS (738-758, prob:0.956)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCM6	Uncharacterized protein	Low	6.5	1	47-72	IVSLLRFRRLKKLHKKYHYPTRESMT	mito(6),cyto(6),cyto_mito(6),nucl(5),pero(5),cysk(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HT05	WD domain protein	Low	9.4	1	307-333	SETEVQKSLARKRKRRKEKEAERATGD	cyto(11),cyto_mito(9.5),mito(6),nucl(5),pero(3)	LARKRKRRKEKE (315-326, prob:0.974)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F6W7	Uncharacterized protein	Low	6.4	1	42-68	RGSNRKERVLHAQRRHQKRTKDYMDAL	plas(6),extr(6),cyto(5),nucl(4),mito(4),mito_nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCU9	FGGY-family carbohydrate kinase, putative	Low	5	1	3-24	TSSLPYRRQSSRQMSRDPRDEI	mito(14),cyto_pero(6),cyto(5.5),pero(5.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDD1	Uncharacterized protein	Low	8.4	1	379-400	GPSGTLSSKRHKKDHRLDEAST	nucl(11.5),cyto_nucl(10),cyto(7.5),mito(3),golg(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIS3	Cell morphogenesis protein (PAG1), putative	Low	5.8	1	335-355	EQSHARTHSKHHHHHPPESKT	mito(14),cyto(5),plas(3),nucl(2),extr(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HS33	Palmitoyltransferase	Low	7	1	576-600	YQEGDQRFATRKRKERVRDLEAQTG	plas(20),nucl(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXB4	U6 snRNA-associated Sm-like protein LSm1	Low	9	1	141-165	VFELKKKEDSERKQHDKTRNKQLQT	nucl(14.5),cyto_nucl(11),cyto(6.5),pero(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HY69	C4-dicarboxylate/malic acid transporter	Low	5	1	90-109	VSSERSNKLSWRRRIRHFTW	plas(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1Q5	Uncharacterized protein	Low	6.8	1	223-243	PEYPKSFRPDRSRPHRSGLKC	mito(10),nucl(5.5),cyto_nucl(5),cysk(4),cyto(3.5),plas(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2I7	TFIID and and SAGA complex TAF10 subunit, putative	Low	8.8	1	10-38	GNNTHFSRTQHRPTQRKLQPRGKEQQTTE	nucl(15.5),cyto_nucl(12.833),cyto(7),cyto_mito(5.999)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I453	Uncharacterized protein	Low	9.5	1	20-44	QQDSRAGRYLPWRKKQNKEDEGQSA	nucl(16.5),cyto_nucl(10.5),mito(6),cyto(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAI9	Uncharacterized protein	Low	9.8	1	1-25	MEKVMRGRRKPLPSKEQHRRPATSD	mito(13.5),mito_nucl(11.333),nucl(8),cyto_nucl(7.333),cyto(5.5)	RGRRKPLPSKEQHRRPAT (6-23, prob:0.824)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC91	Integral membrane protein	Low	5	1	506-531	DEPLYAPYNRRREQRMREQRRGIGVA	plas(18),mito(4),E.R.(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEE2	rRNA processing protein Bystin, putative	Low	5	1	25-46	ATGHLRTKSSGKRKSHQSSDDE	mito(23),cyto(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMS3	Xanthine dehydrogenase	Low	6.2	1	1046-1065	NFNSKNKWKKRGICLVPTKF	cysk(16),cyto(7),nucl(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0R1	Proteasome activator subunit 4, putative	Low	9.9	1	1653-1672	KTVRDVFKRLEKWRHEREPG	nucl(18),cyto_nucl(13),cyto(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3S9	Aminoacyl-tRNA hydrolase	Low	5	1	43-64	SSSSSKRSSKSTQKKSWPNSYD	extr(13),mito(6),cyto(5),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUJ1	AMPK1_CBM domain-containing protein	Low	8	1	610-640	QNPPMKETLREEPKKKKRSSGFFKKLKEKFK	mito(15),cyto(11)	EEPKKKKRSSGFFKKLKEKFK (620-640, prob:0.976)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I478	Aminopeptidase	Low	5	1	61-80	QTSKRYCSYRRMCHARHADV	mito(23),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4Q5	V-type proton ATPase subunit H	Low	7.1	1	34-57	DDHLKKIKAVDKVRKEQRKQTVEG	cyto(8.5),cyto_nucl(8.5),nucl(7.5),mito(7),pero(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9B0	Dolichyl-diphosphooligosaccharide--protein glycotransferase	Low	8	1	715-742	HNSAVAFDKGHKKKRASKRKGPRVLRVE	plas(25)	KGHKKKRASKRKGPRVL (723-739, prob:0.987)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC47	Uncharacterized protein	Low	9.4	1	425-447	EDMWEKRWKDRDRHLIERMRRME	nucl(15.5),mito(11),cyto_nucl(8.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPR2	Nitrate reductase [NADPH]	Low	5.4	1	32-53	SSGHPYSTPRIRTRNNKFHTIE	mito(8),extr(7),plas(6),E.R.(2),nucl(1),cyto(1),cyto_nucl(1),golg(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQY5	Membrane-spanning ATPase, putative	Low	8.8	1	66-90	SDDESPRRGGRRRRQRKEDLELTQY	mito(14.5),cyto_mito(11.5),cyto(7.5),nucl(3)	PRRGGRRRRQRK (71-82, prob:0.897)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYK7	Uncharacterized protein	Low	8.2	1	3-30	PENKLDYYFTRKRKRSCSIPKAFNVKEC	nucl(13),cyto_nucl(10.833),cyto(6.5),cyto_mito(6.166),mito(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G120	Midasin	Low	9	2	790-810, 5328-5349	EQPAKKRKLDSPKYQGLRRKW, LENEKQVIKRWKWKTPGSNVPG	plas(16),nucl(5),cyto(2),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2K9	C6 transcription factor	Low	7.8	2	15-46, 757-777	SLKVRLCCEMCKRRKAKCDKRNPCSNCRRIGA, NTAVKQWKRVYQKGKAQNPPI	plas(18),nucl(3),mito(3),cyto(3),cyto_nucl(3),cyto_mito(3),mito_nucl(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8J8	GST N-terminal domain-containing protein	Low	5.7	1	13-32	TSKLPGPKKSWSPNTLKTRM	cyto(17),pero(4),nucl(2),mito(2),mito_nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAC9	DUF803 domain protein	Low	5	1	42-67	DEKAPYDLRRPPYKRRRWQLGMLLFV	plas(24),mito(1),E.R.(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBC6	Rab-GAP TBC domain-containing protein	Low	8.6	1	715-735	SWLPPKDQKEEKKHLKEYKRM	plas(18),nucl(2),mito(2),cyto(2),cyto_nucl(2),E.R.(2),cyto_mito(2),mito_nucl(2)	PPKDQKEEKKHLKEYKRMMAQSREADKRRA (718-747, prob:0.767)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HV97	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	56-79	ITSCLECRRRKLKCDRGHPCTNCS	nucl(12),plas(7),cyto_nucl(7)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I090	NTP binding protein, putative	Low	6.9	1	223-246	DDSQRRSQRRTIRSGNAKNRHDTE	cyto(14.5),cyto_nucl(13.833),cyto_mito(9.332),nucl(9)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I186	RING finger domain protein	Low	9.8	1	400-426	DDDAPVRPTRRNRNRTATRRNQQLDLY	nucl(19),cyto_nucl(14),cyto(7)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I223	Protein-serine/threonine kinase	Low	6.9	1	4-23	NHPARCWRNIRLRCAQQARF	mito(19),nucl(5),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBD4	DUF221 domain protein, putative	Low	5	1	68-90	ILRPRWSKLYAARRKQRNAASRL	plas(22),vacu(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FI28	Decapping enzyme Dcp1	Low	7.7	1	1-23	MTPRKARERRPNHHNNHNHPLQQ	mito(10),nucl(8.5),cyto_nucl(6.5),cyto(3.5),plas(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTR6	Hydroxyisocaproate dehydrogenase	Low	5.8	1	453-476	QVNQAPKGRRRTYRAHGRINPYMT	mito(11.5),cyto_mito(11.5),cyto(10.5),nucl(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVJ3	ERF-3	Low	6.3	1	660-683	KLEPGTGRKSKRPPPFANKGQTII	cyto(13.5),cyto_nucl(11.5),pero(6),nucl(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWF1	Uncharacterized protein	Low	5.6	1	92-111	RSRVEHYKERKENERLKRVY	mito(17.5),cyto_mito(11.333),cyto(4),cyto_nucl(3.833),nucl(2.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G140	Mannosyltransferase	Low	5	1	574-595	PFIPARYRRHWGRYCLLKRRDV	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGB6	Cullin binding protein CanA, putative	Low	6.2	1	485-504	SVGGSKNSRKRRRQDSDASM	plas(15),cyto(4.5),cyto_nucl(4.5),nucl(3.5),golg(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWW9	Zn(2)-C6 fungal-type domain-containing protein	Low	7.1	1	25-46	VDRIRRVKCDEGKPECNRCKST	plas(14),nucl(6),mito(2),cyto(1),pero(1),E.R.(1),golg(1),vacu(1),cyto_pero(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1X2	Phosphatidate cytidylyltransferase, putative	Low	8	1	137-160	SAVSSSPRKRPPRLNSSKKTPVVK	mito(11),plas(8),cyto(4),extr(2),cyto_pero(2)	KR (145-146, prob:0.608)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5C0	F-box protein (Pof7), putative	Low	9.2	1	8-37	ESFRRQWREEVTRRSRPQTKQQPQTQTISS	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAY3	Nucleotide-sugar transporter, putative	Low	8	1	85-115	EMGLTAKERSHRRQKRKKQRRHLDARIAGVK	plas(25)	KERSHRRQKRKKQRRHLDARIAGVKASKK (91-119, prob:0.99)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNV0	Mitochondrial intermediate peptidase	Low	5	1	31-52	LKTLKRRSWTCQQCLRRLQQVQ	mito(23),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXV4	F1F0 ATP synthase assembly protein Atp11	Low	6.5	1	11-32	GLLKARCPLRHQQQRRWAQVHD	mito(22),nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYA2	Alternative oxidase	Low	5	1	45-66	IQNSNYHNRPQRQTDNKRVFST	mito(19.5),cyto_mito(13),cyto(5.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I412	Integral membrane protein, Mpv17/PMP22 family, putative	Low	5.7	1	15-45	IRRPTVSTRYRAQRKTKTQQRRYKSSSAPED	mito(22),nucl(2),cyto(2),cyto_nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJI6	Uncharacterized protein	Low	8.1	2	2-23, 98-117	DDAYCERIPRRRFRWNLLPSKA, TNTFRKLKSTLKRIHPPEHY	golg(6),mito(5),cyto(5),cyto_mito(5),nucl(3),E.R.(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXM2	60S ribosomal protein L34	Low	9.8	1	1-22	MATNRLQYRRRNPYNTRSNKVR	nucl(13),mito(8),cyto(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYV8	Oxidoreductase-like domain-containing protein	Low	7	2	11-34, 249-270	LLRRRSLCRSCFRRHLSQPRSLVR, IREFMKTEKKLRQKHKAEQQAA	mito(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ50	Uncharacterized protein	Low	8.8	1	51-75	DSEASKEEKKKKKGGCMFHMRRFWF	plas(17),nucl(2),cyto(2),cyto_nucl(2),vacu(2)	KKKKK (59-63, prob:0.711)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6J8	Fatty acid hydroxylase domain-containing protein	Low	5.4	1	300-319	DLHHRQGWKKSHNYGKQTRV	plas(14),mito(8),pero(2),nucl(1),E.R.(1),golg(1),cyto_pero(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7D4	C6 transcription factor, putative	Low	6.5	1	7-31	RDTQLERKLNHHRRHDRSHARDSWL	mito(10),cyto(5),plas(5),nucl(4),pero(1),E.R.(1),golg(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8L0	Zn(2)-C6 fungal-type domain-containing protein	Low	7.6	1	19-38	CLPCRSRHAKCDAKRPSCGR	nucl(8.5),mito(7),cyto_nucl(7),cyto(4.5),plas(3),extr(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCC6	Uncharacterized protein	Low	7.7	1	300-324	FLDKVRVPFRRRNHRPPPERAHSNL	mito(12.5),mito_nucl(12),nucl(10.5),cyto(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCK8	Terpene synthase metal binding domain protein	Low	5	1	15-36	PLKRAFSFRRGGKKNTQKNAVL	mito(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEF4	Uncharacterized protein	Low	9.1	1	72-92	GLDRKAKREIRKLMRSRRVNF	extr(17),cyto(4),nucl(3),mito(1),plas(1),golg(1)	RKAKREIRKLMRSR (75-88, prob:0.783)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7M0	Uncharacterized protein	Low	5	1	324-349	RADKLSKLMTKQKKNAPEKVKERPTE	mito(25.5),cyto_mito(13.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG32	MSF drug transporter, putative	Low	5	1	399-418	NQRFYVKRFKANRNRPVPEA	plas(26)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FI80	NmrA domain-containing protein	Low	9.4	1	316-336	FLPRAQGKAGPARKKRKVDGK	cyto(14),cyto_nucl(10.5),nucl(5),mito(3),E.R.(3)	GKAGPARKKRKVDGK (322-336, prob:0.955)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJJ3	Glycosyl hydrolase, family 92 protein	Low	5	1	581-600	SEKYLNRSRNWRNHWNPNSQ	extr(24),cyto(1.5),cyto_nucl(1.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKV8	Peroxisomal matrix protein importer Pex3-Penicillium chrysogenum	Low	6.3	1	1-20	MIGATKRWFRRNRKGLAIGF	mito(17.5),cyto_mito(11.5),nucl(5),cyto(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMX9	Phospholipid:diacylglycerol acyltransferase, putative	Low	5.3	1	44-66	GSNVKNYVAKPRSKRRNGFIFFL	plas(9),mito(8.5),cyto_mito(6),golg(3),cyto(2.5),nucl(1),extr(1),pero(1),E.R.(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3Q8	tRNA wybutosine-synthesizing protein 4	Low	5	1	11-31	VQVPRSRRWSAWKPNSRGYAT	plas(21),mito(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G575	Protein FYV4, mitochondrial	Low	8	1	228-250	GGERRRAEVRAKKRSEERRKGIA	mito(26)	GERRRAEVRAKKRSEERRKGIA (229-250, prob:0.972)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCA3	Signal transduction protein Syg1	Low	8	1	21-41	DYKAGKKKLKALNRALQRINR	plas(25)	KKKL (26-29, prob:0.643)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTQ9	Ubiquitin-conjugating enzyme E2 15	Low	9.5	1	143-168	ARLWREDPKEFKKRVRKCVRESLGEE	nucl(16.5),mito_nucl(12.5),mito(7.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYB5	Uncharacterized protein	Low	6	1	47-67	CESPKRWKKIYALSRRPPNGE	cyto(15),cyto_nucl(10.333),cyto_mito(9.833),nucl(4.5),mito(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3J4	C6 transcription factor, putative	Low	9.4	1	52-79	CQYTPSRRGYKGPSKKRRANPSSPDQMP	cyto(8.5),cyto_nucl(7),mito(6),nucl(4.5),plas(4),extr(2)	GYKGPSKKRR (60-69, prob:0.768)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3V7	Elongator complex protein 3	Low	8.6	1	44-64	YESQKDFSKPKRDINLNKLRS	nucl(14),cyto_nucl(12.5),cyto(9),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCH0	Uncharacterized protein	Low	6.6	1	14-39	LPAPVRQAYLRRPRTRRSKVLFLVTA	extr(7),plas(5),nucl(4.5),mito(4),cyto_nucl(3.5),vacu(2),cyto(1.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FL18	TauD domain-containing protein	Low	5	1	334-362	RFLHSRTDIKDRRRWLRRVRFHENPSIKA	mito(19.5),cyto_mito(12.333),cyto(4),cyto_nucl(3.833)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FL32	Uncharacterized protein	Low	9.2	1	417-438	LPPQPPRQYKHTRDNRLNNTST	nucl(11),mito(10),cyto(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQQ4	2-isopropylmalate synthase	Low	6.4	1	1-27	MPMLKDPSKKYKKFQPLHLPDRQWPNK	cyto(7.5),plas(7),cyto_nucl(6.5),nucl(4.5),pero(4),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSC4	Dolichol phosphate-mannose biosynthesis regulatory protein	Low	8.7	1	153-173	MMIRSSKKKAAKAKAAAKKKA	plas(19),nucl(2),E.R.(2),mito(1),cyto(1),pero(1),golg(1),cyto_mito(1),cyto_pero(1)	SSKKKAAKAKAAAKKKA (157-173, prob:0.986)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3L7	Ribonuclease T(2)	Low	8	1	271-294	KSNCPKTGIHYKPKRSKPPSTTTS	nucl(12.5),cyto_nucl(10.833),cyto(6),cyto_mito(5.499),mito(3.5),extr(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRJ1	Uncharacterized protein	Low	7.8	1	78-98	VVTITRKKKRIGHQVRVRPLY	nucl(13),cyto_nucl(10.333),mito_nucl(10.333),mito(6.5),cyto(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I629	Uncharacterized protein	Low	5	1	242-263	DPKLYARPWKANPKRNRRVGAF	plas(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCH6	Uncharacterized protein	Low	5.6	1	131-154	YLTFKKESLRKKWHGQNKIPLQTF	cyto(10),mito(7),cyto_nucl(7),plas(5),nucl(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTS2	Uncharacterized protein	Low	8.4	1	16-40	RLGGRVQSSKEPKRKPGFVKWTFGL	nucl(15.5),cyto_nucl(12.833),mito_nucl(9.166),cyto(8)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYS7	Mitochondrial import inner membrane translocase TIM40	Low	7.2	1	86-108	LPTLDSIKPKRRQEQQKQQQDAV	mito(17.5),mito_nucl(13.5),nucl(8.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1R4	Calcium-transporting ATPase	Low	5	1	293-312	QKERQFAKLNKRKNDREVKV	plas(20),E.R.(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8J0	Anaphase-promoting complex subunit 1	Low	9.6	2	245-266, 833-852	ISTPRASTWKQKPKENTSLPRV, SSETKAEKTRRRRALPRTSS	cyto(8),nucl(7),mito(3),plas(3),extr(3),pero(1),E.R.(1),golg(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC70	Xanthine dehydrogenase	Low	5	1	259-279	LAFGNKRKKWYRPATLQQLLE	cyto(21),cyto_nucl(12.5),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIB9	Uncharacterized protein	Low	9.8	1	51-74	YLIAKRRQWRVREKIRRSARRVGE	extr(6),cyto_nucl(6),nucl(5.5),cyto(5.5),plas(5),mito(3)	KRRQWRVREKIRRSARRVGEAIRTPLTPRFAKSA (55-88, prob:0.92)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FML9	Uncharacterized protein	Low	5	1	1052-1072	KEIEAEKQRRKHNRGSSIAKT	plas(20),E.R.(4),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNG6	ABC transporter	Low	8	1	675-702	RTPQDFGRPRNKRRQSLKQKQDRQLYSR	plas(12),E.R.(5),vacu(4),mito(2),extr(2)	KR (686-687, prob:0.609)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUX5	ABC1 domain protein	Low	5	1	53-72	KAAPAKTYDRTRKWLRRLFY	mito(22.5),cyto_mito(13),cyto(2.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0L6	Uncharacterized protein	Low	8.8	1	108-131	AEDDTPKKRRNQGGRRKSAKEKAP	mito(14),cyto(7.5),cyto_nucl(5.5),nucl(2.5)	KKRRNQGGRRKSAKEKA (114-130, prob:0.942)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9C8	Protein OS-9 homolog	Low	8.9	1	930-957	APETAQKKPLKEKMKRPPYQPPPPEPTS	extr(13),cyto(6),cyto_mito(6),mito(4),nucl(3)	EDKPAPETAQKKPLKEKMKRP (926-946, prob:0.819)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM63	Calcium uniporter protein	Low	6.4	1	456-484	GDERVTKALKQERKQKNGKSRDSKSDEDE	mito(19),cyto_mito(12),nucl(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FV46	Uncharacterized protein	Low	5	1	136-158	LHVRREQQSKQRRNPSRTRNALI	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWT7	Exocyst complex component SEC5	Low	9.9	1	32-54	DEALLSKKQKRHSRYSALERSAS	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYC3	FK506-binding protein	Low	8.8	1	300-321	GETLSKKQQKKLKKNNGEAAPV	cyto(19),cyto_nucl(12),nucl(3),mito(2)	QKKLKK (308-313, prob:0.679)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2J6	COP9 signalosome complex subunit 3	Low	7.7	1	458-483	ELSKEYTDNLRRNQRRKEDSMKEGPS	nucl(12),cyto_nucl(11.333),cyto(8.5),cyto_mito(7.666),mito(5.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G752	Fungal_trans domain-containing protein	Low	5	1	717-737	EGNEKRAKRRWLSFHRLDRTP	plas(24),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G914	SH3 domain containing protein	Low	8.8	1	150-169	QNRVDNSRKKTRRSDRDNAA	nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYL6	Mitochondrial dynamin GTPase (Msp1), putative	Low	5	1	788-812	KMRLLATRSKQCNNKKNKYYCPEIF	mito(22),cyto(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4L1	Uncharacterized protein	Low	8	1	11-35	IQPDRTSKKLMRRHVMKGKNAGRKL	cyto(10.5),cyto_pero(8.5),mito(6),pero(5.5),mito_nucl(5.5)	KKLMRRHVMKGKNAGRKLQRAS (18-39, prob:0.841)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FD74	Serine/threonine-protein phosphatase 2A activator	Low	5	1	14-33	ELSKKLSGLRTERKNRRVGG	cysk(11),cyto(7.5),cyto_pero(5.5),mito(4),pero(2.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDN4	Probable endonuclease LCL3	Low	6.6	1	715-735	DNEWYRARIRRNDREKKQAEV	cyto(17),cyto_nucl(12.833),nucl(6.5),mito_nucl(5.166)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ76	Uncharacterized protein	Low	9.6	1	294-317	FESTTHNNKRRKQSHSKTRTAQSS	nucl(15.5),cyto_nucl(10),mito(5),cyto(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQA8	Fungal_trans domain-containing protein	Low	5	1	6-25	GERPACSNCQRRGRHCIYRD	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRZ3	DNA mismatch repair protein (Pms1), putative	Low	6.9	1	1412-1431	IYTPRPSKVRKMFAMRACRS	plas(10),nucl(5.5),cyto_nucl(5),cyto(3.5),E.R.(3),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZI3	Uncharacterized protein	Low	5	1	162-181	LIYHRDKTYQKNRRAENHLE	extr(10),cyto(6.5),cyto_nucl(4),mito(3),pero(2),E.R.(2),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAV8	Glyco_trans_2-like domain-containing protein	Low	5	1	12-34	LFSMIKRTRRTITKHRSKIPVTA	mito(12),plas(10),extr(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I499	Palmitoyltransferase	Low	5	1	450-479	VFCMSRKPLRSKHCRRCARCVSKHDHHCPW	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I669	Sodium/calcium transporter, putative	Low	8	1	19-44	EPTNHNPFKKFRARPRQSRSSRLESG	plas(26)	KPRRRR (129-134, prob:0.688)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAE2	Uncharacterized protein	Low	5	1	195-214	YTAGTRRPFWRRNKAAPAAD	plas(14),vacu(5),E.R.(4),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJT3	Uncharacterized protein	Low	5.8	1	484-505	LLKSIGVRLRSKRKQGEELYCA	plas(20),E.R.(3),nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ18	Integral membrane protein	Low	5	1	261-280	SSCCCSGKSPHANRRNRAVS	extr(19),plas(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1I9	Na/K ATPase alpha 1 subunit, putative	Low	5	1	56-79	ADDPRSETRRSRNNASKRLRSISR	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G446	Fungal specific transcription factor, putative	Low	8.9	1	7-26	TASHQRRSPEQAQQQTRRAQ	nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8C1	Uncharacterized protein	Low	9.2	1	25-44	ADRRREQNRLAQQRFRRQSN	nucl(18),cyto_nucl(11.833),cyto_mito(4.666),mito(4.5),cyto(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8I0	NOL1/NOP2/sun domain protein, putative	Low	9.2	1	346-371	KGGSTNPQGKKRKRGKQEPEPRPDSD	cyto(12.5),cyto_mito(10.833),cyto_nucl(9.666),mito(7),nucl(5.5)	GKKRKRGKQ (354-362, prob:0.899)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUC5	Ribosome assembly factor mrt4	Low	9.1	1	10-31	VHETKTAKKSHKEQTRRLYANV	nucl(16),cyto_nucl(12),cyto(6),mito(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1A7	Cation chloride cotransporter, putative	Low	5	1	81-102	LGNLFRSRGRKQRSTRQDISDT	plas(24),mito(1),cyto(1),E.R.(1),cyto_mito(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FD13	DNA repair protein (Rad57), putative	Low	5	1	502-521	PLSSSQKPDRITRRRMKLAF	cyto(10.5),cyto_mito(9.666),cyto_nucl(8.333),mito(7.5),extr(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIX9	Glutamyl-tRNA synthetase	Low	5	1	27-52	ARSANLSASKKNKKNNGKLPDTPART	mito(19.5),cyto_mito(12.5),cyto(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPZ8	Uncharacterized protein	Low	7.8	1	183-202	DLNPAKKKKQIEKEHQAVQQ	nucl(9.5),cyto_nucl(8.5),cyto(6.5),mito(6),extr(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ32	ABC multidrug transporter	Low	8	1	501-520	VFLYWLIRVPKKRNRKVKQA	plas(16),E.R.(5),mito(3),vacu(2)	PKKRNRKVKQ (510-519, prob:0.795)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUK8	Uncharacterized protein	Low	8	1	37-64	DASSRRFIRRHVMRGKNRKRIAPRALAH	plas(18),mito(4),E.R.(3)	RRFIRRHVMRGKNRKRIAPR (41-60, prob:0.9)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWI7	Pyruvate carboxylase	Low	7.9	1	973-995	FPEPLRSRALRDRRKLDKRPGLF	nucl(10.5),cyto_nucl(10.5),cyto(9.5),pero(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0K8	Amino acid transporter	Low	5	1	61-81	QPLPDGQRRTPRTPNRVRFDL	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2U7	Transcription factor TFIIA complex subunit Toa1, putative	Low	7	2	1-23, 520-543	MSYKSPKHRPSRCTCPLNRCFEV, MLCTYDKVQRVKNKWKCTLKDGIL	mito(17),plas(5),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3P0	RNA helicase	Low	6.7	1	365-386	ESAPKKPPVRFSKKKQEPEAIF	cyto(13),cyto_nucl(10.5),nucl(6),mito(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5P7	Protein kinase domain-containing protein	Low	9.9	1	722-743	FSVRSVRSQQPRKYRKLRVLGQ	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9E6	Imidazole glycerol phosphate synthase hisHF	Low	6.3	1	139-162	PVSLRWKRFTERCQKRKIDPPGLE	cyto(13),cyto_nucl(9.833),cyto_mito(7.833),nucl(5.5),cysk(4),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCV5	Uncharacterized protein	Low	6.6	1	353-373	ERQRQKAAERKEKNEEWKPRF	cyto(16.5),cyto_nucl(14.333),cyto_mito(9.832),nucl(8)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GFA0	Uncharacterized protein	Low	8.7	1	892-915	DSDRESHRRRHGHGHGHHHRRRSS	extr(14),E.R.(3),nucl(2),cyto(2),cyto_nucl(2),pero(2),cyto_pero(2)	RRRHGHGHGHHHRR (899-912, prob:0.68)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXK7	Cation transporting ATPase, putative	Low	5	1	334-353	TVNPGRKHYRQSSKNSSQED	plas(17),E.R.(5),vacu(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1I5	Integral membrane protein	Low	5	1	406-426	VDYQDDSKKRPQRHSFVQLVE	plas(15),E.R.(7),golg(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9R1	C6 finger domain protein, putative	Low	8.1	1	3-23	AAPSREKASSPKQDSRPRASD	mito(9),nucl(8),cyto(5),pero(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBF5	Uncharacterized protein	Low	8	1	281-305	ILEDRIRHRLKRERQRELAKRPFDI	cysk(26)	RLKRER (289-294, prob:0.637)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCA2	Probable E3 ubiquitin ligase complex SCF subunit sconB	Low	8	1	568-587	ITPSRKRRAKPSSYRAHFKQ	plas(21),extr(4)	KRRA (573-576, prob:0.641)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FD83	MFS domain-containing protein	Low	5	1	450-472	SLGMWFRYDNRRRNKFQGVNLTA	plas(20),E.R.(3),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM58	Potassium/sodium efflux P-type ATPase, fungal-type, putative	Low	8	1	240-261	AQSMQGKQRKPNRSLSRKKGGN	plas(18),mito(4),cyto(1),extr(1),E.R.(1),golg(1),vacu(1)	RKPNRSLSRKK (248-258, prob:0.685)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FS11	GTPase activating protein (BUD2/CLA2), putative	Low	8.5	1	197-221	AASPRSTIRVRPRDRDRRREFAPYY	mito(14),nucl(9),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSP1	Acetylglutamate kinase	Low	5	1	1299-1318	ESDNESRRVRRRRDDDEIGR	mito(20),cyto(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0F4	C6 transcription factor	Low	6.4	1	1-27	MDNRGGKRRQTIRPQPQRPNAPGQRGT	plas(15),mito(5),nucl(4),cyto(1),pero(1),vacu(1),cyto_pero(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5S8	Alpha-1,3-glucan synthase	Low	8	1	1706-1727	AGPGQGRKRLSKKPPRESQIFT	plas(21),extr(5)	RKLSLGRRAGPGQGRKRLSKKPPR (1698-1721, prob:0.957)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5Y5	DnaJ and TPR domain protein	Low	8	1	415-434	RTIKRAYRKLTKEHHPDKAK	extr(16),golg(3),mito(2),pero(2),E.R.(2)	KLTKEHHPDKAKSK (423-436, prob:0.644)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAG4	Zinc finger protein ZPR1	Low	8.4	1	217-236	NDKGHKYRRRDYPRTHEQNE	nucl(16.5),cyto_nucl(13.833),mito_nucl(9.166),cyto(9)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEA4	Protein transport protein Sec39	Low	9.7	2	224-243, 830-852	MYGAGRSKRRKLNQPAQDAS, ENEQQRARRAHARRDRSNRSMYE	nucl(9),extr(7),cyto(6.5),cyto_mito(6),mito(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC99	Lysophospholipase	Low	9.3	1	807-836	EQTKRVVRAVYERKKRDRLRREMKVIEERL	mito(14),cyto_mito(11.5),cyto(7),nucl(5)	RKKRDRLRREMK (819-830, prob:0.802)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FES6	Uncharacterized protein	Low	8.7	1	243-266	GFNEQDTRRRRNIRGNNRGGKRQG	nucl(13),cyto_nucl(10),mito(5),cyto(5),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEY3	AB hydrolase-1 domain-containing protein	Low	8	1	374-400	PVSGSSKGTGKKKVKKVRWERVGYGGH	extr(12),E.R.(4),mito(3),plas(3),golg(3)	KGTGKKKVKKVR (380-391, prob:0.853)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU81	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	1	26-52	GRVRSGCLTCKTRKKKCDERYTPDGSC	nucl(12),cyto_nucl(11.5),cyto(9),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUE4	CBS/PB1 domain-containing protein	Low	9.9	1	78-103	MEADLNKKRHHPTKARHTRKAPPGTV	mito(11),nucl(5),cyto(5),cyto_nucl(5)	IRKKMEADLNKKRHHPTKARHTRKAP (74-99, prob:0.921)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWX7	MFS domain-containing protein	Low	5	1	260-280	TILERKVKRLRKETGNPHLRS	plas(20),E.R.(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0D9	PAP2 domain protein	Low	5	1	1-24	MDRLPTKLPFSKKRLRTRVVISYI	plas(14),mito(5),E.R.(3),cyto(2),extr(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0I1	Fungal specific transcription factor, putative	Low	9.1	1	48-72	YISIACNECKRRKIKCNGQVPCQRC	nucl(11),plas(7),cyto(4),mito(2),pero(1),golg(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9S5	SRR1 domain-containing protein	Low	8.5	1	1-20	MPHTSRKKKASAQKRMEVAD	nucl(11.5),cyto_nucl(8.5),mito(8),cyto(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAX5	Potassium transport protein	Low	5	1	199-220	VTIGGTRRPRRHSHRRVFPMAG	plas(24),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBY6	AlphaN-acetylglucosamine transferase	Low	7.1	1	904-926	RELYEDFRKRRKRSDPVVFPGIT	cyto(8),nucl(7),cyto_pero(7),pero(6),cyto_mito(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HST9	Uncharacterized protein	Low	8.7	1	21-50	NWKRNGARLRPPLKTKKKERYDQLARPPYI	mito(23),nucl(2),cyto(2),cyto_nucl(2)	WKRNGARLRPPLKTKKKE (22-39, prob:0.889)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HV66	ANK_REP_REGION domain-containing protein	Low	8.5	1	539-558	KWYQEEQKRLSRTQHRRNKL	nucl(9),cyto(8),pero(7),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYI7	Acyl CoA binding protein, putative	Low	8.2	1	338-357	EVKKRLLRLRFLTRLRRMPS	nucl(11.5),cyto_nucl(9.5),cyto(6.5),mito(3),plas(2),pero(1),E.R.(1),golg(1),cysk(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZJ0	Oxidored_q6 domain-containing protein	Low	5	1	209-228	IFQLQKKMRHTKITRMWYRR	mito(22),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1M6	VPS9 domain protein	Low	6	1	1480-1499	RSTLVREKERGKRLERCLRS	mito(15),nucl(3),extr(3),cyto(2),pero(2),golg(2),cyto_pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLW4	Serine hydroxymethyltransferase	Low	5	1	67-89	TVYSILQKEKKRQKHFINLIPSE	mito(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPG5	Uncharacterized protein	Low	6.2	1	42-61	NLRAVPKKKQHLSPKVQQLI	cyto(18.5),cyto_nucl(12),nucl(4.5),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FV06	Uncharacterized protein	Low	7.6	1	37-63	SSSLYRSISNSRKRQRRSYAETQVSRE	nucl(11.5),cyto_nucl(11.333),cyto(10),cyto_mito(7.333),mito(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0G0	C2HC5 finger protein	Low	8.8	1	90-113	QTNEDRNVQKKNKRTKAPLHSAGP	nucl(16.5),cyto_nucl(11.833),cyto(6),cyto_mito(5.333),mito(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC64	Uncharacterized protein	Low	9.9	1	12-34	AANAVSHRKYPKKPSPPPTGPSP	mito(19),nucl(5),cyto(3)	PKKP (22-25, prob:0.625)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEL4	TPR domain protein	Low	9.9	1	1-23	MGKTKPSNKKSPKSREKSVLSAG	mito(17),nucl(6),cyto_nucl(5.5),cyto(3)	K (10-10, prob:0.606)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGY2	Pre-rRNA-processing protein IPI1	Low	9.1	1	1-32	MGSSQKKKNEKKKDFQKTKLKVGKARPKADNF	mito(14),cyto(7),nucl(3),pero(3)	KKKNEKKKDFQKTKLKVGKARPK (6-28, prob:0.938)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I566	Uncharacterized protein	Low	7	1	118-137	YSVFRSRDVRNNRNRRRGDD	cyto_nucl(9.833),cyto(9.5),nucl(8),cyto_pero(6.666),mito(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAX5	DNA-directed RNA polymerase subunit beta	Low	9.4	2	14-34, 85-105	FDTLRRERLFRHPPKDKTAFP, AEGLKAPKRNRLNIRVREVFL	cyto(12.5),cyto_pero(9),nucl(8),pero(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC55	Arylamine N-acetyltransferase	Low	9.4	1	12-34	QLAQYLKRIRYRRSKDHEEDDAY	nucl(11),mito(10),pero(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJ10	Uncharacterized protein	Low	5.8	1	368-387	AATAKTSRNWHERFRNQRRQ	mito(18.5),cyto_mito(11.833),cyto_nucl(4.333),cyto(4),nucl(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FL64	Zinc finger protein, putative	Low	7.3	1	161-182	VCEKCGRKFKNKRGLEQHKKSL	mito(12.5),nucl(9.5),cyto_mito(8.833),cyto_nucl(7.333),cyto(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM35	MFS multidrug transporter	Low	8	1	345-365	ILVTREAKRRRKRGENVWSAD	plas(24),mito(1),E.R.(1),vacu(1)	KRRRKR (352-357, prob:0.783)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPQ3	Translation elongation factor eEF-3, putative	Low	8.7	1	1029-1064	IEEQKKQKKLSSAELRKKKKERMARRKKGEEVFSDE	cyto(21.5),cyto_nucl(12.5),nucl(2.5)	KKQKKLSSAELRKKKKERMARRKKG (1033-1057, prob:0.995)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQK3	GlcNAc-PI synthesis protein	Low	5.8	1	459-479	IDIARSWPKKVNRQDNTEING	cyto(11.5),cyto_nucl(7.5),mito(7),plas(3),nucl(2.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQL9	Serine carboxypeptidase	Low	8	1	588-610	PAASAEGKKKKLQKRRFKPVAGI	extr(24),vacu(2)	GKKKKLQKRRFKP (594-606, prob:0.937)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUU2	Protoheme IX farnesyltransferase, mitochondrial	Low	8	1	113-139	TSDNSQELPHRRRKRLKEEARNNEAEN	plas(19),mito(3),E.R.(3)	RRRKRL (123-128, prob:0.704)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUU7	Fungal specific transcription factor, putative	Low	7.7	1	969-990	VSVMLKRAKKGQPRNRTVNGTF	mito(12),nucl(7),cyto(3),plas(2),cyto_pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXZ8	26S proteasome regulatory subunit RPN2	Low	5	1	921-946	LSTTAQAKRRAQRREKQQRRESMDVD	cysk(15),cyto(10)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYS2	C2H2 finger domain protein, putative	Low	9.2	1	50-73	YTPTTHRISKAKKGKRVHACEFPG	mito(13),nucl(11),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYZ4	Uncharacterized protein	Low	5.8	1	207-229	LLILSMRRCRRKKPPSPADGFLM	extr(16),mito(4),nucl(2),plas(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDJ4	Zn(2)-C6 fungal-type domain-containing protein	Low	9	1	5-31	AGKSKGCNTCRKRKVACDLQRPQCSQC	nucl(10),mito(7),cyto(6),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0U4	Uncharacterized protein	Low	8.4	1	446-470	SSESVPERHHRRCHSEQPRAWREPS	nucl(13.5),cyto_nucl(11.333),cyto(6),cyto_mito(4.999),cysk(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC27	Mitochondrial 18 kDa protein	Low	7.2	1	325-355	AVSWEEYKENKHREREQRKRQRDEQGSREGT	cyto_nucl(9.5),cyto(9),nucl(8),pero(6),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEG0	SnoRNA binding protein	Low	7.4	1	6-31	GSRYDGPSAKRQKRIPDEGVQKKTRH	cyto_nucl(11),cyto(10.5),nucl(8.5),plas(3),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWG2	Cytoskeleton organization protein	Low	9.5	1	870-892	SVSAKKTSKATKIPKERADRLSA	nucl(15.5),cyto_nucl(10.5),cyto(4.5),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ09	GPR/FUN34 family protein	Low	5	1	283-303	AHFPWSPTGRERRQKSEREVA	plas(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0R0	Chitosanase	Low	7.3	1	105-129	NGTARQSRPNSKPNSKPPSRQTSTK	mito(10),cyto_nucl(8),nucl(7.5),cyto(7.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G627	Mitochondrial Rho GTPase	Low	8	1	400-428	STTAALKVTRPRKRRKRPGRVGRNVVLCH	cyto(12.5),cyto_nucl(7.5),mito(5),plas(5),E.R.(2)	TRPRKRRKRPGRV (408-420, prob:0.979)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAQ7	Uncharacterized protein	Low	9.1	1	63-87	GVPTNPRNPRPKKAPSKKPAKGGSK	mito(20.5),cyto_mito(12),nucl(4)	PRNPRPKKAPSKKPAKGGSK (68-87, prob:0.978)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GH72	Uncharacterized protein	Low	7.4	1	260-286	QSYVCVDKTSKRPKKDQKRDSYFLVKF	cyto_nucl(10.5),cyto(10),nucl(9),mito(3),pero(1),E.R.(1),golg(1),cysk(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HW18	WD repeat protein	Low	7.7	1	1-25	MATVFPPPSKRQKREIAERAQQQQE	nucl(9),mito(7.5),cyto_mito(6.5),pero(6),cyto(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I611	Stromal membrane-associated protein	Low	6.9	1	23-46	LEHNKVCADCKRNKHPRWASWNLG	mito(14),nucl(5.5),extr(5),cyto_nucl(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I664	Purine permease, putative	Low	5	1	9-33	PQIGPKRTWTDKLRRIKKTFTTKDG	plas(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHG0	Uncharacterized protein	Low	8.9	1	267-292	SELGGKKNKKGKKDKKKQRGPGGVSF	mito(13.5),cyto_mito(9.833),cyto(5),cyto_nucl(4.833),nucl(3.5),cysk(3)	GKKNKKGKKDKKKQRGP (271-287, prob:0.994)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FML5	IdgA domain protein	Low	5.7	1	8-29	ARVSRWPVRRPLVKLPRPSRNY	mito(23),nucl(2),cyto(2),cyto_nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPB1	Uncharacterized protein	Low	8.3	1	105-127	VERHYKRKGKSLQHTRTPHRRIL	nucl(12.5),cyto_nucl(11),cyto(8.5),mito(3),cysk(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FV36	Poly(A) polymerase	Low	7.5	1	461-483	TVSGREPKTQKEKRPPPRVTEVA	cysk(10),nucl(8.5),cyto_nucl(8.5),cyto(7.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYD4	F-box domain-containing protein	Low	6.7	1	220-239	RNPERFPRLRNRKRIWQIAG	nucl(8),mito(8),cyto(8),cyto_nucl(8),cyto_mito(8),mito_nucl(8)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5T2	Uncharacterized protein (Fragment)	Low	7.7	1	15-42	QDPHRTDGDKKQKSRRPANTAFRQQRLK	plas(11),nucl(7.5),cyto_nucl(4.5),pero(3),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G738	Uncharacterized protein	Low	6.2	1	287-306	NGREEQRRGQHREKKRQFDS	cyto(11),extr(11),nucl(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB68	MFS multidrug transporter	Low	7	2	5-32, 110-129	SRTATARSTRSSRSRRRRGDSVVSRVYS, LEKTATRKSQRSQRDPKLVT	plas(23),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HW10	MFS domain-containing protein	Low	5	1	68-92	EFIRDDPRNPKHFKKWQKWTFCMIM	plas(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWD3	Serine/threonine protein kinase, putative	Low	9.3	1	246-268	DDTAVKAGKPKRRQTHRMEATPE	nucl(15.5),cyto_nucl(10),mito(7),cyto(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I020	Uncharacterized protein	Low	5	1	340-359	HTRRSMQSRRSQDPHRRSSS	plas(20),mito(3),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0F4	Uncharacterized protein	Low	7.6	1	2-22	FGSRRHTTTRRTRPTFWTRLK	mito(16),nucl(7),cyto(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5K9	Phosphatidylinositol phospholipase C	Low	5.8	1	14-37	SSSGTATKSKKKSKMVAEHLTIRN	mito(18.5),cyto_mito(12),cyto(4.5),nucl(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP69	RNA polymerase II subunit B1 CTD phosphatase RPAP2 homolog	Low	8.9	1	26-66	QARPAQPRPAGPRRQQKQKQPPRRQQPPQQQQQQQQQQGKP	mito(17.5),cyto_mito(10.833),cyto_nucl(3.833),nucl(3.5),cyto(3)	PRPAGPRRQQKQKQPPR (32-48, prob:0.765)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSV7	Abhydrolase_3 domain-containing protein	Low	5	1	28-54	FRFLLHPQPKYKNKQRLRIPSRESGRF	mito(16),extr(8),mito_nucl(8)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVE3	Pyridoxal kinase	Low	5.9	1	960-979	SEEARQKREHLRRTKAAEVR	cyto(9),cyto_nucl(7),mito(6),extr(4),nucl(3),pero(2),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXQ5	Uncharacterized protein	Low	9.4	1	13-37	SLQESKGQTTRKKKNEPSAPFRFFD	nucl(11),cyto(9),mito(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G183	Fatty acid oxygenase, putative	Low	9.6	1	23-45	GAQVNGKSSKRSPRNSREEDHGV	nucl(12),plas(5),mito(3),cyto(3),cyto_mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2H0	C6 transcription factor	Low	6.9	1	16-48	TVGPMRQRSRRACFPCRQRKRKCDGRLPCLTCT	plas(15),mito(6),nucl(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GFD3	Uncharacterized protein	Low	9.4	1	257-277	FDKRARARYAKPKFKNRFLDP	nucl(17.5),cyto_nucl(13),cyto(5.5),pero(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQH4	Uncharacterized protein	Low	6.4	1	63-82	AKLPPPSRPKDKSQDQSSRE	mito(13),cyto(5),nucl(4),extr(3),cyto_pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQY9	FAD binding domain protein	Low	6.4	1	135-155	IQAQPKRMYRHSRPKFHKMLT	cyto(11),cyto_nucl(9),mito(6),nucl(5),plas(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRQ0	RNA polymerase III transcription factor subunit, putative	Low	8.1	1	84-108	VLKVTVPKWTGRKRKRESDEPFTLD	mito(18),nucl(8)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUZ8	IZH family channel protein	Low	5	1	27-49	ESSLLRERRTRRHSFHAARRLSR	plas(20),E.R.(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FD21	Mitochondrial hypoxia responsive domain protein	Low	8.8	1	224-260	DKEEKDRRTHSEQKSQEKNEKKDEKEDKEEKKEEKKE	cyto(10.5),cyto_nucl(7),mito(6),extr(3),nucl(2.5),E.R.(2)	KNEKKDEKEDKEEKKEEKKE (241-260, prob:0.796)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FFQ8	Amino acid transporter	Low	8	1	331-356	ALLRPETPGKKKRKHKERGGTGNNTV	plas(26)	PGKKKRKHKERG (338-349, prob:0.956)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJQ6	Uncharacterized protein	Low	6.1	1	241-260	ANFYTRCRTRNRRQMMNAAL	cyto(9),cyto_pero(8.833),pero(7.5),cyto_nucl(7.333),nucl(4.5),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT59	CAF1 family ribonuclease, putative	Low	9.8	1	738-759	ADEDWKRKYRERQTPSRDIGKY	nucl(14),cyto(7),mito(4),cyto_pero(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWS8	Phospholipid-transporting ATPase	Low	5	1	1300-1325	MEQFQKAIRKVRQVQRMRKQRGYAFS	plas(23),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYK8	67 kDa myosin-cross-reactive antigen family protein	Low	5	1	510-529	DYFMGVKKESRRSWRNHFVE	extr(12),plas(4),E.R.(4),golg(3),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ69	HNHc domain-containing protein	Low	9.2	1	1-33	MPPRKRKASDPSYNPRSQKRGSRRATSARQSVS	nucl(13.5),mito(10),cyto_nucl(9)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G172	DUF1212 domain membrane protein	Low	5.8	1	275-299	SGTSTPKKEKLKWYKKPPTQSRSSF	plas(23),nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3X7	Ferric-chelate reductase, putative	Low	5	1	571-591	SDDVRRVCRKKQTSSHIDYIE	plas(21),E.R.(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6C7	WD_REPEATS_REGION domain-containing protein	Low	6.1	1	170-192	EEETSKTKSKRGSRKNGDKAMED	cyto_mito(10),mito(9.5),cyto(9.5),nucl(4),extr(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G758	Uncharacterized protein	Low	7.7	1	155-177	QSLSTRHTHTRRHRYGRSHHGGS	nucl(10.5),cyto_nucl(9.333),cyto(7),extr(6),cyto_mito(5.833)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCU0	Fibronectin type III domain protein	Low	9.6	1	1038-1058	RSSLGFFSRKSKKPEKAVGEE	extr(6),golg(5),nucl(4.5),cyto_nucl(4),E.R.(3),vacu(3),cyto(2.5)	AERKKR (321-326, prob:0.696)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXX3	Peptidase A1 domain-containing protein	Low	5	1	352-378	SSSIMDKVQRRHKPRPTRAHQEILRKF	cyto(7),plas(7),extr(4),cyto_nucl(4),cyto_pero(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAN5	Methyltransferase-like protein	Low	6.7	1	334-354	DRRLLVNRKRRLKMYRCWMQG	cyto(11),cyto_nucl(9.5),nucl(6),mito(3),E.R.(3),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNL4	SNF2 family helicase/ATPase	Low	7.2	1	1873-1896	WWHQHRTCPTCKKHLKIRDFHQIT	plas(14),nucl(6),cyto(3),mito(1),E.R.(1),golg(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FV34	Nucleolar GTP-binding protein 1	Low	9.1	1	1071-1092	LIRNEAKQRKSLKNRAVIPRSA	plas(18),nucl(3),pero(3),E.R.(3)	EKRALIRNEAKQRKSLKNRAVIPRSAKAKK (1067-1096, prob:0.894)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVA4	Uncharacterized protein	Low	9.4	1	376-397	EEIEKLKKRHARRMEKFKRTSL	cyto(10.5),cyto_mito(9.5),mito(7.5),nucl(5),pero(4)	KLKKRHARRMEKFKR (380-394, prob:0.855)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZQ9	Homogentisate 1,2-dioxygenase	Low	8.9	1	434-454	KYNDESWRPLKRHFKNPKKSA	cyto(13),cyto_nucl(9),pero(7),nucl(3),extr(2)	RHFKNPKK (445-452, prob:0.656)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G486	Calcium/calmodulin dependent protein kinase, putative	Low	8	1	2-25	ASQTQTQPQPQRPQIQPCRYKTGK	nucl(10.5),cyto_nucl(7.5),mito(7),pero(6),cyto(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5G3	PAN2-PAN3 deadenylation complex catalytic subunit PAN2	Low	8.1	1	385-405	GHYAPNPKKTRRNQVENTRIL	nucl(11.5),cyto_nucl(11),cyto(9.5),pero(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB50	Chloride channel protein	Low	8	1	68-90	AVQELSRRRAKRKEGSRFWDKEG	plas(22),E.R.(2),mito(1),pero(1),vacu(1)	RRRAKRKEGSR (74-84, prob:0.82)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3K8	Exocyst complex component EXO84	Low	7.6	1	4-25	RGLTLRSKSRRPQISAPKPISG	mito(16),nucl(9),cyto_mito(9)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FB37	Actin-related protein 8	Low	9	1	185-204	SELKTHMRQNKRRTLPNSKE	nucl(14.5),cyto_nucl(11.5),cyto(7.5),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FI38	ABC metal ion transporter	Low	5	1	75-94	AIWFLLKKRHPQPVAKNWHF	plas(20),E.R.(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP51	PRK domain-containing protein	Low	7.3	1	9-29	ADTIRCQARKHHKSRYLVAIA	mito(15),nucl(6),cyto(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUK6	Vacuolar ABC heavy metal transporter (Hmt1), putative	Low	5	1	29-48	AATRRGGQGKQKRADKREIG	plas(19),E.R.(4),mito(2),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUL7	Cyclic nucleotide-binding domain protein	Low	6.6	1	179-201	QERLTILEKKKKQRFTPPPDTSD	mito(16),nucl(5),cyto(5),cyto_nucl(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUV0	SD08430p	Low	5	1	220-245	SSDPNRIPMKRKTRNLTKTRSSPRLT	plas(24),extr(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEU9	Uncharacterized protein	Low	8	1	197-225	AEPMRIKEKTKRRQRHTQHIRSKHKYTLM	mito(24),cyto(2)	KEKTKRRQRH (203-212, prob:0.732)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I050	MFS transporter	Low	5	1	455-477	FAEHEMKRRKSLQQQRETGRDEE	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1B9	Uncharacterized protein	Low	5	1	3-22	YYVRFLKPPKLDKANRSSLS	extr(14),mito(4),cyto(3),golg(2),cyto_pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBQ9	RING finger protein	Low	5	1	200-220	LYITHTQKKRKLEERRAELRA	plas(18),extr(3),mito(2),E.R.(2),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLQ6	C6 finger domain protein, putative	Low	8	1	50-77	AKEAKPPRVAPRLSKKKRTSCSFKNDTS	plas(15),extr(4),E.R.(4),mito(2)	RKAKEAKPPRVAPRLSKKKR (48-67, prob:0.921)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNL1	WD_REPEATS_REGION domain-containing protein	Low	9.7	1	39-61	SSMLQWMRTRRPRYKGAHRMEAE	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVN3	ATP-binding cassette transporter	Low	8	1	1414-1433	TLYYVFRVRTWKKKRALKGK	plas(26)	WKKKRALKGK (1424-1433, prob:0.9)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW84	pH response protein PalF	Low	6.5	1	481-500	LEPVSRRSKNKSKGRSQSLS	plas(15),nucl(4),E.R.(4),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0C8	Plasma membrane ATPase	Low	5.4	1	59-86	EVRTRRIWYAPWRQKRFRWRYVGSTPTF	plas(24),nucl(1),cyto(1),cyto_nucl(1),golg(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G491	37S ribosomal protein Rsm22	Low	9.7	1	814-849	VPTRKKGQTIPSWKKHADKKKVRQAFKQQSSKQLGT	mito(16),cyto_nucl(6),nucl(5.5),cyto(5.5)	WKKHADKKKV (826-835, prob:0.732)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4C1	OMPdecase domain-containing protein	Low	6.5	1	443-469	ATTKKEATTPRQSGRKRNRTNIFYIPI	mito(19),nucl(4),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTF9	Uncharacterized protein	Low	6.3	1	289-308	QTTIPPRSRSVRHSNRPSGT	mito(19),nucl(4),cyto(4),cyto_nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HY05	Uncharacterized protein	Low	8.2	1	342-364	PPPPYSRKASHKHATYRPKRVRM	nucl(10),plas(6),mito(5),cyto(5),cyto_mito(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYM4	Serine palmitoyltransferase 2, putative	Low	6.6	1	922-949	LTPAPEMEKEWNRKHRPEKAIAPPRWKV	mito(11),plas(8),nucl(4),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEZ4	LDB19 domain-containing protein	Low	9	1	79-98	KDSKDKRRSLGRSSRSKERS	mito(20),nucl(3),cyto(3),cyto_nucl(3)	SKDKRRSLGRSSRSKERSAHK (81-101, prob:0.846)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FII4	Peptidyl-tRNA hydrolase domain protein	Low	9	1	113-143	AIKAERERKKKASKMKKSRRKYRALDEKEHG	mito(20.5),cyto_mito(12.166),cyto_nucl(4.333),nucl(4)	AAIKAERERKKKASKMKKSRRKYR (112-135, prob:0.997)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJ15	Uncharacterized protein	Low	5	1	4-24	ALLPTARKKRRSGFWPFERDA	plas(26)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU17	Uncharacterized protein	Low	9.2	1	637-660	ASVDTSQQSRPKRRRPLLGRASSL	nucl(16.5),cyto_nucl(11.333),cyto(5),cyto_mito(4.333),mito(2.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2D4	RNA-binding La domain protein	Low	8	1	690-709	RDNRDWKERRAEDQKRGFRG	cyto(11),mito(9),pero(3),cysk(2)	RIKPNRQGGSRNHGRDNRDWKERRAEDQKRGFRGGRGGRGGRGGRGRGNGRDR (676-728, prob:0.995)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRY4	C6 transcription factor	Low	6.9	1	11-36	LRKSFACDECKRRKVRCTGGDNCNNC	plas(16),nucl(5),mito(2),cyto(2),cyto_mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0U7	FAD_binding_3 domain-containing protein	Low	5	1	687-707	NPPVALKKPFNYRRRDRTFSL	extr(10),plas(8),vacu(3),cyto(2),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2B5	Cytochrome b2	Low	5	1	142-162	QENRRIFRKIKLRPRVLRNVE	cyto(19),cyto_nucl(11),cysk(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3X8	DNA-directed RNA polymerase subunit beta	Low	6.1	1	74-95	QEQSREQSPPHKHRRTDPFDAL	mito(12),cyto(11),cyto_nucl(8.5),nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I427	Integral membrane protein, putative	Low	8	1	480-505	GVSRPRSRTRSTSRHSSKRGLRRSST	plas(23),E.R.(3)	GVSRPRSRTRSTSRHSSKRGLRR (480-502, prob:0.775)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5N3	AMP-binding enzyme, putative	Low	6.2	1	665-685	LTPTLKMKRPPTAKKYRAVLD	cyto(14.5),cyto_nucl(10),pero(7),nucl(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FB17	Serine/threonine-protein kinase TOR	Low	8.8	1	2884-2905	VEVAAKRKARRASLQKKPDARS	plas(22),nucl(2),E.R.(2)	KRKARRASLQKKPDAR (2889-2904, prob:0.86)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FB69	Asparagine-linked glycosylation protein 10	Low	8	1	454-481	KDEKPVEREKKDTKKKGKASRKGVSFKE	plas(21),E.R.(4)	KPVEREKKDTKKKGKASRKG (457-476, prob:0.97)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEV7	Uncharacterized protein	Low	8	1	50-74	LAAPPKGKKFQPRWSRRIRRLLFYI	plas(17),mito(6),cyto(2)	KGKKFQPRWSRRI (55-67, prob:0.713)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMU3	KOW motif domain protein	Low	9.9	1	305-328	ELYARTQEKKAERRKNKFDEDGNA	nucl(16.5),cyto_nucl(10),mito(7)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPI6	Kinesin-like protein	Low	9.9	1	630-649	IIKQHEVRRRRALREVRINH	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXM5	SPX domain protein	Low	9.8	1	136-162	FTGFLKAAKKHDRKRGTRYRVKPLLQV	nucl(6),cyto_mito(6),mito(5.5),cyto(5.5),plas(5),cysk(1),golg(1),E.R.(1),pero(1),vacu(1)	AKKHDRKRGTR (143-153, prob:0.775)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZB4	Alternative NADH-dehydrogenase	Low	7	2	36-57, 465-486	AAPEAPKPRRRFRFLRWAWRLT, DLIKERQKQLRRTKQIGPFQYS	mito(19.5),cyto_mito(12.5),cyto(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0U3	Protein kinase domain-containing protein	Low	7.3	1	415-435	YTVKWRFSRSTSPRHQQSKSE	mito(13),cyto(7),nucl(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAV0	MFS domain-containing protein	Low	7	2	366-386, 520-541	MDRNFRKVAKHYRRQNQIPED, AEWKWGEKWRAEREKRKDPSIA	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB94	Sterol delta 5,6-desaturase ERG3	Low	5	1	111-130	KTTVKHPKYLKNQIRKEIRQ	plas(11),mito(7),E.R.(5),golg(2),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGV4	RECA_2 domain-containing protein	Low	8.8	1	342-365	ISGTTSTCAKPRKRKVDEVADSEE	nucl(16),cyto_nucl(12.333),cyto(6.5),cyto_mito(5.166),mito(2.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGV1	Uncharacterized protein	Low	5	1	35-54	DAQALQRQGKRPQLKRQFGF	plas(26)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0D2	ATP-dependent bile acid permease	Low	8	1	395-433	SPDAPKKKENEPQKLKNKILSFGRKKKKKADVKTDSELV	plas(19),mito(3),vacu(3)	KALRRKAGASPDAPKKKENEPQKLKNKILSFGRKKKKKA (386-424, prob:0.988)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G274	KH domain containing protein	Low	6.2	1	1293-1313	QINSIRKKTGCRVNVPKDQAK	cyto(16),cyto_nucl(12.666),cyto_mito(10.832),nucl(6),mito_nucl(5.832)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCF2	Zn(2)-C6 fungal-type domain-containing protein	Low	7	1	333-354	IKLGTCTKRKVRCNKEDPCSNC	mito(12.5),cyto_mito(9.5),nucl(7),cyto(5.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0Q1	Cytochrome b5, putative	Low	8	1	161-182	WDKLELRKRRASRDRSTGREAE	cyto(18),cyto_nucl(10.5),mito(7)	KRRASR (168-173, prob:0.652)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I181	Uncharacterized protein	Low	8.6	1	866-885	KHTPHIRSYSGRKRRPHSSF	nucl(13.5),cyto_nucl(12),cyto(9.5),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7D2	Aspergillopepsin A-like aspartic endopeptidase	Low	5	1	19-42	LSVPTRPQRKGRSFKVERLRRTDY	extr(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDZ2	Integral membrane protein	Low	5	1	69-94	VYRRKRGTYVASPKHHRKLRNNLLLG	plas(24),mito(1),E.R.(1),golg(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEC8	C6 zinc finger domain protein	Low	8.1	1	25-54	QDPVSCQTCRSKKLKCDRKQPCANCTARKI	plas(18),nucl(8)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FY77	Uncharacterized protein	Low	8.6	1	73-94	ILFFCVRKIKQRRRESDGFEIG	mito(11),nucl(9),cyto(3),extr(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0M5	Uncharacterized protein	Low	9.3	1	89-109	APQLRHRRGSLHKHKKTEQSS	nucl(16.5),cyto_nucl(11),cyto(4.5),plas(2),mito(1),extr(1),pero(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3C3	Fungal specific transcription factor domain protein	Low	7.3	1	8-34	AVNACAGCKKYKRKCNKALPSCSTCSR	mito(20),nucl(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7S5	MFS domain-containing protein	Low	5	1	24-47	DGDNKYNARLRKRTFRKVDFWLVG	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1S3	F-box domain protein	Low	9.7	1	16-40	FFANALRPKKSRQTLRKKTPVDGAL	mito(12),cyto(8),nucl(5),cyto_pero(5)	RPKKSRQ (22-28, prob:0.677)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F883	Histone deacetylase	Low	7.7	1	717-738	WNNLGRKPSKRYGRLIRSQKAG	cyto_nucl(13),cyto(12.5),nucl(10.5),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAZ3	MFS transporter, putative	Low	8	1	93-115	IMVKARLPRKKWDRKVRWFDASL	plas(25)	K (102-102, prob:0.602)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FD93	C6 transcription factor (PrnA), putative	Low	9.2	1	2-26	DEPAPNSGRQKRPRVAEENRKRAVR	nucl(13.5),plas(9),cyto_nucl(8),cyto(1.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDL2	Uncharacterized protein	Low	5	1	272-300	SSSASKGNKSNTRNNRHNNNQNNNNNNQN	extr(19),cyto(5),cyto_nucl(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEH6	25S rRNA adenine-N(1) methyltransferase	Low	8	1	1-21	MTAKKTSKKLSQLSRGRPPTL	mito(16),nucl(8),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRQ3	Uncharacterized protein	Low	6.4	1	39-61	DAQLPPSKKVKRSHDRESQSPDA	mito(19.5),mito_nucl(13.333),nucl(6),cyto_nucl(4.333)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FV99	DNA-directed DNA polymerase theta, putative	Low	6.5	1	911-933	LMMANPRKAQKHQQYPKEAERYA	mito(12),cyto(10),nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWH9	H+/nucleoside cotransporter	Low	5	1	94-116	GEGSAKRPWHRRMVKHWRHVFHA	plas(26)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYF5	Glycerophosphocholine phosphodiesterase Gde1 (Fragment)	Low	7.6	1	941-965	MNEKMKHTRDFKKKGFKGNSRGSHI	nucl(7),mito(7),mito_nucl(7),cyto(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1H2	Cyclin, putative	Low	9.2	1	4-25	MTSSPSSSRRREPRPVPAPSNP	nucl(14.5),cyto_nucl(9.5),mito(7),cyto(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5U5	Glycosyl transferase, putative	Low	7	2	219-238, 618-637	WTMWAMKKRQRPKLRLTGND, LEERDPQRRKHLPRRLFTIL	plas(26)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBI5	Uncharacterized protein	Low	5	1	59-80	RYPSSQPPSHRRPEERRSQLLR	mito(24.5),cyto_mito(13.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVA1	TAM domain methyltransferase, putative	Low	7.8	1	314-336	VTGRKPFPEERQQQQQQHQQQRS	cyto_nucl(11),nucl(10),cyto(10),pero(3),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUB4	DUF1264 domain-containing protein	Low	8.1	1	171-191	FDVHHKNKSERRKLIPSPDIH	nucl(13.5),cyto_nucl(11.833),cyto(9),cyto_mito(5.833),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2F3	Probable E3 ubiquitin ligase complex SCF subunit sconB	Low	9.4	1	104-125	GANSRYCYRHRPDLKCRRQADE	nucl(16.5),cyto_nucl(11.5),cyto(5.5),pero(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4A4	Arrestin (Or S-antigen), N-terminal domain protein	Low	7.6	1	507-530	SDPMSLSRSRRHSNRQYSSRLNGE	mito(13),nucl(9),cyto_nucl(8),cyto(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6I2	Na+/H+ antiporter	Low	5	1	543-564	VGMLVRRLKRLQKQQGTPDGGG	plas(22),E.R.(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6L4	Caffeine resistance protein, putative	Low	5	1	530-549	LFRYGHRLRCRSKNAVHDMK	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G931	SMK-1 domain-containing protein	Low	8.8	1	280-299	KDPGIRRKIRHTWRLQYLKD	nucl(14),cyto_nucl(12),cyto(8),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBN7	TFIIH basal transcription factor complex p47 subunit	Low	8.9	1	440-465	LTGQEGPSTREKRRKPWEKPSMEESA	nucl(14),cyto_nucl(11),cyto(6),plas(3),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQE7	Uncharacterized protein	Low	8.6	1	36-63	RIHSHAQSGYRRRKPVQRRQRTVELDPT	nucl(9),cyto(6),mito_nucl(6),plas(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I604	Sterol desaturase family	Low	8	1	306-343	ERVRKAIQASRKKIKERNGSSSSKVTPNKGRSRRRRDS	plas(23),E.R.(2)	RKAIQASRKKIKERNGSSSSKVTPNKGRSRRRRDS (309-343, prob:0.956)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8Y3	Histidine kinase	Low	9.3	1	63-94	LLCRVNTLQSRSRKPRRSRRLSKILAKKEEQD	cyto(13.5),cyto_nucl(10.5),nucl(4.5),E.R.(4),mito(3)	RSRKPRRSRRLSKILAK (73-89, prob:0.913)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FB61	Uncharacterized protein	Low	7.6	1	21-41	KKAGRKTSLFRRKSNGPQEKP	nucl(11.5),mito(9.5),cyto_nucl(9.333),cyto_mito(8.333),cyto(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPR9	Cytochrome c1	Low	6.8	1	772-795	LSVWVKRYKWAPIKTRKIIYNPPV	cyto(10.5),cyto_nucl(9),nucl(6.5),mito(5),pero(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU94	Translation machinery-associated protein 22	Low	6.8	1	234-254	GLPKKFDQKKILKVIKKKFAC	mito(17.5),mito_nucl(12.5),nucl(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUD0	Ubiquinone biosynthesis protein COQ4, mitochondrial	Low	6.2	1	318-348	EKPPDLRQIRKMMRQQQKREREIQEKRKAAG	cysk(13),cyto(5.5),cyto_nucl(5),nucl(3.5),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXQ9	Uncharacterized protein	Low	9.7	1	595-621	DQLRTVYEKHRRRAEKRNSKSKQGLNS	pero(9.5),cyto_pero(7.833),nucl(6.5),cyto_nucl(6.333),cyto(5),mito(4)	KHRRRAEKRNSKSK (603-616, prob:0.85)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZH2	ADK_lid domain-containing protein	Low	7	1	145-168	EAYLPWNERERRRKDNRTAQRALN	plas(20),nucl(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G048	3-oxoacyl-(Acyl-carrier-protein) reductase	Low	5.7	1	362-386	VKINVPPQYRKEKRGRLDRGFRIGM	mito(15),cyto(8),cyto_nucl(5.833),cyto_pero(5.333),nucl(2.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0J4	Elongator complex protein 1	Low	9.8	1	1175-1204	GGTVNSRKTSRTRRKEERKRASGKKGTVYE	cyto_mito(8.833),cyto(8.5),mito_nucl(8.333),mito(8),nucl(7.5)	RKTSRTRRKEERKRASGKK (1181-1199, prob:0.954)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6E1	5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase	Low	5	1	472-495	DRAINLKWKKGTKRPDKSNAIDML	cyto(23.5),cyto_nucl(13.333),cyto_mito(13.166)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GF13	NAD dependent epimerase/dehydratase, putative	Low	9.7	1	47-67	HAMRAFWRRRHSEQENQLRRN	cyto(8.5),cyto_nucl(7.5),plas(7),nucl(5.5),mito(3)	ARVAHARKRL (451-460, prob:0.695)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWS2	Phosphatidylserine decarboxylase	Low	9.1	1	32-53	TLDRKSREFKREQQPLWKKFKM	cyto(12),nucl(11),mito(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1K4	ATP-binding cassette sub-family E member 1	Low	6.7	1	7-37	RVAIVNSDKCKPKKCRQECKKSCPVVRTGKL	cyto(10),cyto_nucl(9),mito(7),nucl(6),plas(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F840	Glycogen [starch] synthase	Low	7.3	1	564-587	MYDFAMKSRRQRINQRNRTERLSD	cyto_nucl(9.5),cyto(9),nucl(8),mito(5),plas(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIK1	Dolichyldiphosphatase	Low	5	1	208-233	EVGWRQWEAKRKLKRRDDSDSLHKTE	plas(22),E.R.(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJJ1	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	1	14-51	ATIDRRKAANRQARSCRVCRLRKVKCDRVKPCHACCAH	nucl(9),mito(4),plas(4),pero(4),cyto(3),golg(1),cysk(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSN5	Dolichyl-phosphate-mannose--protein mannosyltransferase	Low	7	2	1-23, 213-233	MSSSPPPSLRRRGGKKDVNTGAS, LCYIKFYKQRHQPFGRKWWKW	plas(23),mito(2),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTY7	Uncharacterized protein	Low	5	1	26-45	SAASAKSPKKWPYQTFRSVD	extr(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5S9	MFS domain-containing protein	Low	8	1	305-328	HARARSRGTSRKKKRVHYPEDVNH	plas(23),E.R.(3)	RARSRGTSRKKKR (307-319, prob:0.858)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6Q0	Uncharacterized protein	Low	9.2	1	172-191	APKPSPDRYRRGNRRADNST	mito(13),nucl(11),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7X8	Manganese ion homeostasis	Low	7.7	1	627-649	DVRWKSKLSTSTRQPQRPRTMVG	plas(8),nucl(7),mito(4),cyto(3),extr(2),cyto_pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G875	60S ribosomal protein L42	Low	8.8	1	1-32	MVNVPKTRRTYCKSKQCRKHTQHKVTQYKAGK	nucl(13),mito(7),cyto(7),cyto_mito(7)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G933	Uncharacterized protein	Low	6.2	1	447-469	GLNQRRMKTGKPRYPQGQRGMPS	plas(18),nucl(3),E.R.(3),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9I6	2-ketogluconate transporter, putative	Low	5	1	1252-1271	NAFGRDKKGRVKKDDPGDLH	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDK9	AMP dependent ligase, putative	Low	5	1	1176-1197	LGTRVPRTPSKKTDRRMIRLLS	plas(22),E.R.(2),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRZ8	Uncharacterized protein	Low	8.5	1	2-25	QVLFEFPKKTHTRREPERAHLPQD	mito(14),nucl(9),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1E0	AP-1 complex subunit gamma	Low	6.5	1	605-631	GQPTNKRQSRILKDKTKKAPKQTEQDM	mito(17),cyto(6),nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1Y9	Histone acetyltransferase	Low	9.7	1	234-255	QSTGKGAKKRPARQRMTVREIG	mito_nucl(10.832),cyto_nucl(10.166),nucl(10),mito(10),cyto_mito(9.332),cyto(7)	GAKKRPA (239-245, prob:0.699)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMQ4	Uncharacterized protein	Low	7.6	1	594-615	AVPHGINNKKRQRDNTDKDVEN	mito(17),nucl(8),cyto_nucl(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNH8	Uncharacterized protein	Low	5.6	1	52-71	YANMRPYTKRNVRAWHRRFS	cysk(11),cyto(6.5),cyto_pero(6.5),pero(5.5),nucl(2),mito(2),mito_nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTK2	Serine/threonine-protein phosphatase	Low	6.7	1	736-756	FDILREARKTKKNQERRVDIV	cyto(7.5),cyto_nucl(7),mito(6),nucl(5.5),pero(4),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUA8	MAP kinase kinase Ste7	Low	5	1	1-22	MTDPFKARTLKRKNVKGLALNA	mito(20),cyto(4.5),cyto_nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVN7	Aromatic aminotransferase Aro8, putative	Low	5	1	50-74	SSDMFKSPSCYKKPKAKNWDHLLSE	cysk(18),pero(4),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWA9	ANK_REP_REGION domain-containing protein	Low	7	1	174-195	IDVSRPRLRKYRYPGRKEDRLY	cyto(15.5),cyto_nucl(12),nucl(7.5),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5V2	Nuclear envelope pore membrane protein	Low	7	1	307-329	VIPSKQLKQLKRQADKRHPASDS	cyto(13),cyto_nucl(11),nucl(7),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDH4	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	10-48	HLGTGSNRRRRQTRVKSGCRTCKIRKVKCDEARPACHRC	nucl(13),plas(9),mito(2),cyto(1),pero(1),golg(1),cyto_pero(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2S2	Uncharacterized protein	Low	6.6	1	557-578	LERTQRALKKTQMKWKRRLHLG	plas(18),nucl(4),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F6Z8	Mannosyl-oligosaccharide glucosidase, putative	Low	8.7	1	170-190	VYGVRKEKKTEYRQYMNRSGG	nucl(10),plas(6),cyto_nucl(6),mito(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8K6	FAD binding domain-containing protein	Low	5	1	473-495	YEPWRLERLRRLKAKYDPNDRFS	extr(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDA7	Mitochondrial 54S ribosomal protein YmL35	Low	8.3	1	398-420	DIELRRKRVEPLPYKRRNPSTFR	nucl(11.5),mito(10),cyto_nucl(8.5),cyto(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG57	Integral membrane protein	Low	5	1	384-405	MQHIGKKTYKKNEDSQPRDKFE	plas(15),mito(5),E.R.(3),cyto_mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLU0	Dihydroxy-acid dehydratase	Low	9.5	1	552-579	NLDIPPEELKKRRKEWKAPELRVKKGTL	mito(16),cyto_nucl(5),nucl(4.5),cyto(4.5)	KKRRKEWKAPELRVKKGTL (561-579, prob:0.926)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMP0	RNA polymerase II transcription factor B 38 kDa subunit	Low	9	1	58-82	PCPVAGCHKTLRKNRFRKQTFEDIG	nucl(15.5),cyto_nucl(12),cyto(7.5),pero(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPK3	GTPase activating protein	Low	8.2	2	217-236, 1483-1503	STRAKARKGKTPRSNGLEQD, HVSSWKNRLREIKRLRERISG	plas(12),nucl(4),cyto(4),cyto_nucl(4),E.R.(3),cyto_mito(3),mito_nucl(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU08	Dephospho-CoA kinase, putative	Low	5	1	249-269	AINFTTKKSWDQKAQREKAKL	extr(10),cyto(6),mito(4),pero(3),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWH7	DUF1681 domain-containing protein	Low	8	1	258-282	APPPSARDTRSERRKPRPQSALLAG	cyto_nucl(13),nucl(11.5),cyto(11.5),plas(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZY1	Uncharacterized protein	Low	9.3	2	547-566, 712-732	NYWRWGRKKISNKNDNKTMI, DVFKKRMTEKKQKAEQAEKRD	mito(13),nucl(7.5),cyto_nucl(7),cyto(5.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC21	ER membrane protein complex subunit 6	Low	8	1	105-129	QVSEREKKSGRRVIRRKGAWRDVWF	plas(10),extr(8),mito(4),E.R.(3),cyto_mito(3)	EKKSGRRVIRRKG (110-122, prob:0.83)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRR7	Uncharacterized protein	Low	8	1	939-970	MADISPSKAHKQKNKRISRKRLSKSEPLSFGQ	plas(18),E.R.(4),mito(2),extr(2)	KAHKQKNKRISRKRLS (946-961, prob:0.892)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXY0	DUF2235 domain-containing protein	Low	8.6	1	603-623	VRETYVRKSHSKKARRQTVAL	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G374	Uncharacterized protein	Low	7.7	1	48-76	AIVTRVRLTRHRTRRVKCDEQKPLCWRCI	nucl(8.5),cyto_nucl(8),cyto(6.5),plas(6),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQS0	WD40 domain protein	Low	8.8	1	577-605	APAASTGGKKQKKKWSKGKVKDKANHAVV	cyto(18.5),cyto_nucl(12.333),cyto_mito(10.166),nucl(4),extr(4)	GKKQKKKWSKGKVKDK (584-599, prob:0.955)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F6W4	Glucose-methanol-choline (Gmc) oxidoreductase	Low	9.9	1	505-529	EKPSDTVRKRSSKKRKLSRTAQLEE	cysk(12),cyto(6),nucl(5),mito(2),pero(2)	RKRSSKKRKL (512-521, prob:0.831)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8R0	Carboxylic acid transporter	Low	5	1	19-41	YILTRFTSLKPPRNKIRNPIAVL	plas(21),vacu(3),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTB2	Uncharacterized protein	Low	6.9	1	1-20	MGKNAGKKLVRPSRKKAFEL	mito(18),nucl(5),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8M4	Uncharacterized protein	Low	8.2	1	50-71	AEDKPWKPSFNRKQSWNEQDMK	cyto(13.5),cyto_nucl(13.5),nucl(12.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8R8	Uncharacterized protein	Low	7.9	1	348-373	ASQTSRRNSAYRRRLSRRTGGPRDSL	nucl(9.5),cyto_nucl(8),cysk(7),cyto(5.5),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB21	Methyltransferase (Ncl1), putative	Low	6.8	1	672-692	ASKPVKLQPPQKRKPGQPYEE	cyto(11),cysk(6),cyto_mito(6),nucl(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCJ9	Ccr4-Not transcription complex subunit (NOT1), putative	Low	8.3	1	2999-3023	GSVDDKPKKKSKIQHKHFKWAPNFA	plas(19),E.R.(3),cyto(2),nucl(1),golg(1),vacu(1),cyto_mito(1),cyto_pero(1)	PKKKSK (3005-3010, prob:0.687)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEQ9	Fungal_trans domain-containing protein	Low	6.6	1	27-49	ANNAIRSKPKPRELQDRLRKVEA	plas(19),nucl(4),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ86	Uncharacterized protein	Low	8	1	378-402	VETFDKKSEKRLKKGKKAYSPQAEA	plas(19),E.R.(4),vacu(3)	KKSEKRLKKGKKA (383-395, prob:0.922)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRR3	C6 transcription factor, putative	Low	8.9	1	82-101	SCRQRKTKCSGDTPVCRQCR	nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(2),plas(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTI8	Carboxypeptidase	Low	5	1	17-40	LQNPHKRVVKRTPKAPVHRQEARS	extr(24),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU71	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase	Low	8	1	36-57	LGWHVKRRTADRKKAILDRVRA	plas(17),E.R.(4),extr(2),vacu(2)	RARR (550-553, prob:0.616)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVX9	Integral membrane protein, putative	Low	9.6	1	210-231	DALVRQEKAKKEQQKPNLSGKP	nucl(13),mito(5),cyto(5),cyto_mito(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0U8	Mediator of RNA polymerase II transcription subunit 20	Low	9.1	1	282-308	KEIKEQHRRRRAGENSKRKNTRNHDDE	cyto(8.5),mito(8),cyto_nucl(6.5),pero(4),nucl(3.5)	QHRRRRAGENSKRK (287-300, prob:0.82)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G827	RNA helicase	Low	5	1	52-72	ALRSLKAKSKSPQKNAPSHLT	mito(20.5),cyto_mito(13),cyto(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G926	Uncharacterized protein	Low	6	1	93-117	LESMREDDRRRKRERSLQDERGKIE	mito(18.5),cyto_mito(12),cyto(4.5),nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9K0	C6 finger domain protein, putative	Low	9.1	1	1-29	MSRSFTGCKRCKARRQKCDEERPECGRCK	nucl(12),mito(11),cyto(2),pero(2),cyto_pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA42	Uncharacterized protein	Low	9	1	144-167	DDKYMNPRTPPKPKLPRLRTSPQL	nucl(14),cyto_nucl(11),cyto(6),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC19	Membrane associated DnaJ chaperone, putative	Low	5.4	1	33-53	GEPRPQPPSPRYERHRRRIFI	cyto(7),plas(7),mito(6),extr(2),pero(2),nucl(1),E.R.(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HU61	tRNA pseudouridine synthase, putative	Low	6.6	1	90-110	GGSDKRTRNEQQQEAKRRKLE	mito(16.5),mito_nucl(12.666),cyto_mito(10.833),nucl(7.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXZ2	Uncharacterized protein	Low	9.4	1	172-191	AERIHKREEKLKRREARSAD	mito(20),cyto_nucl(4.5),nucl(4)	RIHKREEKLKRREA (174-187, prob:0.813)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7H4	Uncharacterized protein	Low	5	1	378-397	VYIFRRWHSRLQKKQDLEST	plas(20),E.R.(3),mito(1),pero(1),golg(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9G0	Uncharacterized protein	Low	5	1	385-411	TPITPSRMVTRKERKRMEKENGLRVLN	plas(10),mito(7),E.R.(6),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBB2	Amino-acid acetyltransferase, mitochondrial	Low	7.3	1	654-673	FPNGVCWRSRRDNPVNKWYF	mito(11.5),nucl(9.5),cyto_mito(8.333),cyto_nucl(7.333),cyto(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSE7	DUF28 domain protein	Low	5	1	36-59	GHSRWSTIKHDKAKNDKAKSKERA	mito(21.5),cyto_mito(14.333),cyto(4),cyto_nucl(3.499)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVJ9	RNase H domain-containing protein	Low	7.1	1	38-65	SVSSSRRALRKRQTLPPRNMKLNRKTIR	mito(10),cyto(7.5),cyto_nucl(7.5),nucl(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWJ2	Mitochondrial pyruvate carrier	Low	9.1	1	41-62	ADTEEFRRVKRRSNKPAAGTSN	mito(13),nucl(11),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYJ6	MFS transporter, putative	Low	5	1	228-250	LTSGCTRSCRRRRSSHPVKRLDD	plas(19),E.R.(4),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZU7	Uncharacterized protein	Low	9.4	1	181-203	DEHVGKKAKKFKTKKANKFEGET	cyto(17.5),cyto_nucl(13),nucl(5.5),pero(2)	KKAKKFKTKKA (186-196, prob:0.869)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G461	Aconitate hydratase	Low	7.3	1	54-79	EVEKLNSVRKDKDRRRPHNRLDYVLD	cyto(15.5),cyto_nucl(13.5),nucl(8.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRR5	Uncharacterized protein	Low	5	1	440-460	ATPKRFPKPRWSLGRWSKPFQ	plas(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HX51	PlsC domain-containing protein	Low	8	1	704-730	SMKIRDAMRERGQRRRRRSEDASWELA	plas(17),E.R.(3),mito(2),extr(2),vacu(2)	RGQRRRR (714-720, prob:0.694)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYG4	Chalcone_isomerase domain-containing protein	Low	5.3	1	13-33	AWRQCCQCLRGQRARPTPLRY	mito(21),extr(2),nucl(1),cyto(1),cyto_nucl(1),pero(1),E.R.(1),cyto_pero(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3L4	tRNA 4-demethylwyosine synthase (AdoMet-dependent)	Low	5.5	1	766-785	PNDERVYRKGRNKTALPPST	cyto(8.5),cyto_nucl(5.5),E.R.(5),plas(3),golg(3),mito(2),extr(2),nucl(1.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I502	L-ornithine N(5)-monooxygenase	Low	8.8	1	167-192	GCVGQEMSKHKKKKRTKARNATGEVE	plas(8),cyto(5.5),cyto_nucl(4.5),extr(4),nucl(2.5),mito(2),pero(2),golg(2)	KHKKKKRTKAR (175-185, prob:0.937)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F719	GTPase activating protein (Gyp7), putative	Low	9.7	1	740-759	DKKHNFPQPSVRQRKPDSSV	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F858	Elongation of fatty acids protein	Low	8	1	280-304	YFATYKKTGKSGRPRRNTGKKALID	plas(24),E.R.(2)	TGKSGRPRRNTGK (287-299, prob:0.755)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FI59	UBC core domain-containing protein	Low	7	1	56-78	QVYNNHRRPKKEAKMIRALQKDP	plas(10),nucl(5),golg(4),cyto(3),mito_nucl(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJ87	Uncharacterized protein	Low	9.9	1	165-188	TGNLRSTRGKSKKKTVDKFFAQKI	nucl(17.5),cyto_nucl(11),pero(4),cyto(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FR69	UDP-glucose	Low	5	1	1431-1450	CNNPMTKEPKLDRARRQVPE	extr(14),E.R.(7),golg(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSB5	Mitotic check point protein (Bub2), putative	Low	8.9	1	67-90	DARAQSPTATRPRRRTRSNSDASV	nucl(13.5),mito(9),cyto_nucl(9),cyto(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU51	DUF221 domain protein	Low	5	1	280-303	DSLPPKRPTLRPPRKYRDERSDGK	plas(22),E.R.(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T6	Uncharacterized protein	Low	9.3	1	81-103	PQTLPRPKLRRPQLPRTPRPLQD	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7Y7	Uncharacterized protein	Low	5	1	779-798	KMAGKFRRTWHPSYREQRSD	plas(13),mito(4),cyto(3.5),cyto_nucl(2.5),E.R.(2),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G865	PHB domain-containing protein	Low	7.4	1	22-41	DDIRICKKAFAKPWQRVSRI	cyto_nucl(10),nucl(8),cyto(8),cysk(8)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GFM9	Uncharacterized protein	Low	8.4	1	343-374	DASAPASRRKRPSQQKRKRQARRALKDKQEEL	plas(11),extr(9),cyto(2),vacu(2),nucl(1),pero(1),E.R.(1),cyto_mito(1)	SRRKRPSQQKRKRQARRALK (349-368, prob:0.979)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYL8	Protein kinase, putative	Low	7.8	1	393-412	SSPQHFSPRRRERQRVFPTG	plas(11),nucl(8.5),cyto_nucl(6),cyto(2.5),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F823	FAD-binding PCMH-type domain-containing protein	Low	5	1	550-570	LSPGKQGIWPKHYRKERDPRL	cyto(10.5),mito(9),cyto_pero(8.166),cyto_nucl(7.833),pero(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8N4	Phosphatidylinositol:UDP-GlcNAc transferase PIG-C	Low	8	1	716-741	ELRSARASSRRRRRKGAWKKLLWVKQ	plas(23),E.R.(3)	ELRSARASSRRRRRKGAWKK (716-735, prob:0.982)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9C2	MFS multidrug transporter, putative	Low	8	1	520-543	TSFGMGWKRIPRKAAKKKDEKAVA	plas(27)	KRIPRKAAKKKDEK (527-540, prob:0.918)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBF0	Fungal specific transcription factor domain protein	Low	9.1	1	31-50	CASCRSRKVRCDALLRRPGP	nucl(14.5),cyto_nucl(10.5),cyto(5.5),mito(3),plas(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJ38	Sulfite reductase [NADPH] subunit beta	Low	7.1	1	1227-1250	MLVQRDHGDRKNRKHARLKYTIDD	cyto(13.5),cyto_mito(7.5),nucl(7),pero(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMI6	Uncharacterized protein	Low	9.7	1	352-374	RASHHTVKEKKHRWKPVIKNITG	cyto(8.5),cyto_nucl(7.5),nucl(5.5),mito(5),plas(3),pero(2)	KEKKHRWK (359-366, prob:0.69)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPZ6	COPII-coated vesicle protein	Low	9.6	1	168-189	GEVRKNPWRKFPKGPRLRRGDV	plas(17),nucl(4),E.R.(2),golg(2)	NPWRKFPKGPRLR (173-185, prob:0.744)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTN0	Sad1/UNC domain protein	Low	5.8	1	764-790	SPTSTRPPSSYDRKGRHRRNISEDSQD	extr(9),plas(6),E.R.(3),nucl(2),cyto(2),cyto_nucl(2),golg(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYE5	Protein-tyrosine-phosphatase	Low	8.5	2	127-147, 645-664	AFFANRKKSVRRAPRCLRGMT, LKWEELQRTQRNRPLRRELE	mito(12.5),cyto_mito(10),cyto(6.5),nucl(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0X3	Zn(2)-C6 fungal-type domain-containing protein	Low	6.9	1	72-91	HCERLERKIREVRRRQQALT	mito(13),nucl(5),cyto(4),extr(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3B1	Probable lysosomal cobalamin transporter	Low	8.4	1	983-1018	HQSHGGGGEKKKKNNKKKNKNKNKKKGDSSTNLAPP	plas(21),E.R.(2),nucl(1),mito(1),extr(1),vacu(1),mito_nucl(1)	GGEKKKKNNKKKNKNKNKKKG (989-1009, prob:0.998)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4F0	Plasma membrane ATPase	Low	7	2	8-30, 63-89	GGDVERRAPSREKRRISRASMAT, TELRRVWYAPWRKRRVRVRTQADAGKF	plas(24),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HX92	Alpha-1,6-mannosyltransferase subunit	Low	5.4	1	14-33	HPYPRSSRVSFQRRRQLKAA	plas(9),mito(8),golg(3),extr(2),E.R.(2),nucl(1),cyto(1),cyto_nucl(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4D8	14_3_3 domain-containing protein	Low	8.2	1	38-60	ILSKKLLRARKLRRLDPTRDTKS	nucl(11.5),cyto_nucl(11.5),cyto(10.5),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I540	Uncharacterized protein	Low	7.5	1	175-194	VAHCWTRKVRCQFSRRGCAR	nucl(7.5),mito(6),cyto_nucl(6),plas(4),cyto(3.5),extr(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAC6	Uncharacterized protein	Low	8.8	1	23-54	VAKSETKPDKASKKKAQKNKRGPKKGAAEQAV	cyto(23),nucl(2)	KPDKASKKKAQKNKRGPKKG (29-48, prob:0.986)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FER1	Galactose-1-phosphate uridylyltransferase	Low	7.2	1	23-43	LVSPHRTKRPWQGQQESPSKT	cyto(12.5),cyto_nucl(10.5),nucl(7.5),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FH24	Monooxygenase	Low	5	1	108-132	FPMTKGAAKLRQKRRQQVEKFMRAT	mito(7),plas(7),cyto(5),pero(3),E.R.(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHB0	Uncharacterized protein	Low	6.2	1	1-20	MACKTKKKSLLKKFRLSTSS	mito(22),nucl(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FI69	Uncharacterized protein	Low	7.6	1	16-40	RVNVVYKGWKEKRRKGPQVDLEKCE	cyto_nucl(13.333),nucl(12),cyto(11.5),mito_nucl(8.499)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKA3	EGF-like domain-containing protein	Low	8.6	1	103-128	AKLPGSSKGPPPQRPRRPSNVPSLLD	nucl(9),plas(7),cyto(3),mito(2),extr(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPT5	ANK_REP_REGION domain-containing protein	Low	8	1	1059-1083	WDMIEQCRKENKKISPKQQLCPFCG	cyto(10),nucl(8),E.R.(3),pero(2),mito(1),plas(1),extr(1),golg(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSH9	Uncharacterized protein	Low	8	1	283-306	ALKEKFEKGHRPRQSGKQAIRSRI	extr(13),plas(7),mito(3),E.R.(3)	LKEKFEKGHRPRQSGKQAIR (284-303, prob:0.784)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVF8	Elongation factor G, mitochondrial	Low	6.2	1	47-67	LSYQQPLSRRWEQRRNASATA	mito(13),cyto(9),cyto_nucl(7.5),nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYT0	Ran exchange factor Prp20/Pim1	Low	9	1	110-129	PPPAPKPKPKVVINKPPTTR	mito(22.5),cyto_mito(12),nucl(4)	KTTQRKTAPAAARKSAKAEPSAAAPATKKRKAEAEEEAPPREQKKARVAAPPPAPKPKPKV (60-120, prob:0.983)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G066	F-box domain-containing protein	Low	9.7	1	893-916	AADQYKSSKRRLRRSLRGNNGGPE	nucl(14),cyto(8),mito_nucl(8)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0Y1	ATP-dependent Clp protease	Low	8	1	584-609	ESAWEEKMRREKQEKEKKAKDADSQS	mito(21.5),cyto_mito(13),cyto(3.5)	KEK (598-600, prob:0.607)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G508	Poly(A) polymerase	Low	8.5	1	534-561	FEPGETRPTRPKKKIVKKAEPTAQKRTI	cyto(14.5),cyto_nucl(8.5),mito(8),nucl(1.5)	TRPKKKIVKKA (542-552, prob:0.842)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA59	Uncharacterized protein	Low	5	1	606-625	IQFFRQKKSKPSRRLLYLRQ	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUH9	Uncharacterized protein	Low	9.8	1	201-222	TSTTQRPLRRSPRIKQQWKLSV	nucl(20),cyto_nucl(13.333),cyto(4.5),cyto_mito(4.166)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUL7	C6 transcription factor, putative	Low	5	1	18-43	IERNRERTAEFRRQRRQRDSTSDSSS	plas(26)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1B3	Calcium/calmodulin dependent protein kinase, putative	Low	9.8	1	100-121	RLVQKRIPIRSRKKILKDSLRG	nucl(16.5),cyto_nucl(10),mito(5),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEB9	Dienelactone hydrolase	Low	8.6	1	405-431	EPEKDNEKPRLEKKPPKDKGKGKAIEN	cyto(20.5),cyto_nucl(12),nucl(2.5),mito(2),cysk(2)	KPRLEKKPPKDKGKGK (412-427, prob:0.941)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU84	C6 transcription factor (Fcr1), putative	Low	9.8	1	16-44	TDGNVRKRVCKACDRCRLKKSKCDGANPC	nucl(25.5),cyto_nucl(14.333),mito_nucl(13.666)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZF0	Patched sphingolipid transporter (Ncr1), putative	Low	5	1	287-310	SSYVTFRERRYRKPERVRLLQDPS	plas(19),mito(3),E.R.(2),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZH7	Short-chain dehydrogenase, putative	Low	8.8	1	866-888	MDPSALRSKKSDRKLRIGDDDRV	nucl(10),cyto(6),pero(4),plas(3),cyto_mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6E9	60S ribosomal protein L11	Low	6.9	1	131-161	YCCMTRPGERVAKRRRCKSKIGTNHKITQGE	mito(11),cyto(8.5),cyto_nucl(8),nucl(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9E1	60S ribosomal protein L18	Low	9.8	1	154-184	GPHSGKKPYVQSKGRKFERARGRRRSRGFKV	mito(11),cyto(9.5),cyto_nucl(8.5),nucl(6.5)	PHSGKKPYVQSKGRKFERARGRRRSRGFKV (155-184, prob:0.987)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVP4	Uncharacterized protein	Low	9.1	1	22-41	QSARVARYEPRKRRRGLDDW	nucl(14),mito(7.5),cyto_mito(7),cyto(5.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8K2	Monooxygenase	Low	8	1	453-477	FNSGHERRKAMWRRKNEQAAKKIAA	cyto(12),cyto_mito(9.333),cyto_nucl(6.833),pero(6),mito(5.5)	RRKAMWRRKNEQAAKKIA (459-476, prob:0.795)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCJ6	Uncharacterized protein	Low	8.3	1	1167-1198	IKEPLPEKRKAPSKTKKTKNIAKEAKVRRVLA	extr(15),plas(4),golg(3),E.R.(2),cyto_mito(1),cyto_nucl(1),cyto(1),mito(1),nucl(1),mito_nucl(1)	RKIKEPLPEKRKAPSKTKKTKNIAKEAKVRRV (1165-1196, prob:0.987)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM50	Uracil DNA glycosylase superfamily protein	Low	9	1	120-144	SSSISSKSTTKKKRSARSARTTPAT	nucl(16.5),cyto_nucl(14),cyto(10.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN46	HAD_SAK_1 domain-containing protein	Low	5.8	1	436-460	EWESQFMNKSHKRRHQQDYRDEDVR	plas(16),cyto(5),mito(3),nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSF1	Uncharacterized protein	Low	7	2	26-46, 808-832	NKSPLKPKYLIPREIKREVKN, AAMFAVARRYRKKQQLHRRSSSVSD	extr(17),mito(3),plas(3),vacu(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ03	Probable E3 ubiquitin ligase complex SCF subunit sconB	Low	6.9	1	118-137	RTTNWKRQYRLRHNWAKGSC	mito(9),nucl(5),cyto(3),plas(3),extr(2),E.R.(2),cyto_pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5K5	Respiratory chain complexes assembly protein rca1	Low	5	1	211-230	QDQKQRQQKGDKDQKPPNFR	mito(26)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5R5	MYB DNA-binding domain protein	Low	7.8	1	45-67	IANYYSEKKNNNKKDHNNGFDGR	mito(10),nucl(7),plas(6),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G846	Pantoate--beta-alanine ligase	Low	5.7	1	17-36	REVPPLRQFRRQKLLENRTV	mito(19),cyto(4),nucl(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDE5	S-adenosylmethionine-dependent methyltransferase superfamily domain-containing protein	Low	9.6	1	497-516	LINHGKKQPTPLKKGQVIKG	nucl(17),cyto_nucl(13),cyto(7)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEX1	Sodium/calcium exchanger protein	Low	5	1	1148-1167	ADFWARRWRRVYNKEWERCW	plas(24),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRH5	Uncharacterized protein	Low	7.3	1	64-87	EFRQITARDKRRRSYIRKIKLTVQ	cyto_nucl(8),nucl(7.5),cyto(7.5),E.R.(4),plas(3),golg(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVC5	Benzoate 4-monooxygenase cytochrome P450, putative	Low	5	1	878-901	LSDRWMWYHRQRRSQSHNPQPPAP	plas(22),E.R.(2),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYX0	U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase	Low	8.2	1	341-364	AMENAWSRKARRKARMQDSVVNKD	nucl(11.5),cyto_nucl(9),cyto(5.5),pero(4),mito(2),plas(2),cysk(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2K1	Ornithine decarboxylase antizyme	Low	6.9	1	429-449	VWSPGLATRRRSRKFDRRSTS	cyto(7.5),cyto_nucl(7.5),extr(7),nucl(6.5),mito(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G432	alpha-1,2-Mannosidase	Low	6.2	1	83-108	YDFPRESKADRKEREHRQDAVKKAFK	plas(6),golg(6),mito(4),extr(4),nucl(3),E.R.(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GE10	Leucyl-tRNA synthetase	Low	5	1	976-1001	EGKLWLREKNNWEKRRRVIVVKGGKV	mito(20.5),cyto_mito(12.5),cyto(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HX10	Fatty acid hydroxylase domain-containing protein	Low	5	1	298-318	HDLHHRKGYKKSYNYGKQTRV	plas(12),cyto(5),cyto_pero(4.833),cyto_nucl(4.333),pero(3.5),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1G5	Adenylyl cyclase-associated protein	Low	8	1	360-389	PAPPGKKPKPESMRAKKPPRKELESNKWFI	cyto(14),cyto_mito(12.499),mito(9.5),cyto_nucl(9.333)	RGKSPAPPGKKPKPESMRAKKPPRK (356-380, prob:0.987)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2K8	NACHT domain protein	Low	5.4	1	21-65	ATNGAREEKRRENNNEDKGGGNDRQNNQRKGNPRKQRFHLQATCA	extr(9),plas(7),cyto(6),nucl(1),mito(1),pero(1),E.R.(1),golg(1),mito_nucl(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5K0	tRNA (guanine-N(7)-)-methyltransferase	Low	8.6	2	39-62, 68-89	VYAMTFPPNKRQRREEYRQAQTQA, AEIQMPKKRFYRQRAHANPFSD	mito(16),nucl(5),cyto(5),cyto_nucl(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBM3	Uncharacterized protein	Low	8	1	8-31	EDVVKQQQEQQQPQKKKWYPTLTI	plas(25)	KKGPQGKNKKLDAKKAKKEAKEAKEAKKAKK (509-539, prob:0.998)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDD4	Uncharacterized protein	Low	7.8	1	177-205	VSPDKPHSATQKRKDRATKTAKNPPRVSF	mito(14),nucl(7),cyto(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FH88	G-patch domain protein (TFIP11), putative	Low	9.4	1	166-193	EDSSDEERAQRRKRKEQRKQQEGRSGAS	pero(9),cyto(8.5),cyto_nucl(7),nucl(4.5),mito(4)	AQRRKRKEQRKQQEGR (174-189, prob:0.902)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLA1	WD-repeat containing protein slp1	Low	9.2	1	118-159	PSRSTPSKERTRERVTKERAAKEKTSKEKVPKEKASREKVAT	mito(22),nucl(3)	SKERTRERVTKERAAKEKTSKEKVPKEKASREKVA (124-158, prob:0.964)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXI3	P4Hc domain-containing protein	Low	5	1	232-252	GTNFPRMKMPREKKWCRFLEC	extr(14),E.R.(5),mito(2),plas(2),golg(2),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZB7	Cytochrome P450 monooxygenase	Low	6.9	1	84-104	IIPEKSTSKRFQKWNQKYGPI	mito(10),nucl(5),plas(5),cyto(3),extr(1),pero(1),E.R.(1),golg(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0E9	Amino acid transporter, putative	Low	5	1	546-568	EERIRAKLKSERQRQIAQRPFNI	plas(26)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3W8	Probable acetate kinase	Low	9.1	1	446-469	NQKPTTCEEKRRKESKRNTASKSG	mito(19),nucl(3),cyto(3),cyto_nucl(3)	RRKESK (456-461, prob:0.639)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAU4	MFS domain-containing protein	Low	5	1	461-483	TMMSFVLRRENRKRDRGERDYLL	plas(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTT1	Uncharacterized protein	Low	9.3	1	15-37	DATRTQVRRKQIREAQRAYRSRQ	nucl(14.5),cyto_nucl(9),mito(8),cyto(2.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I635	Cysteinyl-tRNA synthetase	Low	5	1	773-795	ITKSARKKLIKLHQKQAKLHEEW	cyto(15.5),cyto_mito(10.166),cyto_nucl(9.833),cysk(4),mito(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G726	Uncharacterized protein	Low	6.9	1	1-24	MLHSRLRPLPRRQHRPTEAIPRPD	mito(9),plas(6),nucl(5),cyto(2),pero(2),cyto_pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HR09	Ubiquitin-activating enzyme E1 1	Low	5	1	39-59	ASKLGKRKASSEQPARPEKKI	cyto(15),E.R.(6),extr(3),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HT18	Aspartate--tRNA ligase	Low	7.2	1	63-92	SSSGVSKNQQKRLARQQRRQAKSRLSEEHR	mito(17),nucl(6),cyto(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HW84	Fungal specific transcription factor	Low	9.8	1	748-770	RPEPSAKRHKWGKSPFPSQRPSQ	plas(13),nucl(12)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1T6	Copper resistance-associated P-type ATPase, putative	Low	5	1	124-143	WDTARPKTPRRPVSWIPPSP	plas(16),E.R.(7),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FB89	MFS domain-containing protein	Low	5	1	485-505	EWDVRRIARLRNKAQKEGRVF	plas(26)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBZ1	Ser/Thr protein phosphatase family protein	Low	5	1	656-675	MYLPEYVRRNWRKNLANCTS	extr(17),cyto(4),mito(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG08	Cytoskeletal adapter protein sagA	Low	9.2	1	313-332	ADERRDRSRPRNDGRPNWTL	nucl(15),cyto_nucl(11.5),cyto(6),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJZ2	Uncharacterized protein	Low	5	1	2-21	LFRKGAYKSRFRHRAKPIAL	golg(8),extr(7),E.R.(5),mito(4),plas(2),cyto_mito(2),mito_nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZD4	Translation factor GUF1, mitochondrial	Low	9.2	1	677-702	ASDITRRRKLLEKQKEGRKKLKAVGN	cyto(17),cyto_nucl(11.833),cyto_mito(10.333),nucl(5.5)	RRRKLLEKQKEGRKKLK (682-698, prob:0.91)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G228	Uncharacterized protein	Low	8.5	1	220-239	LLSSSPSRPRQKRRLSEPVG	nucl(12),mito(11),cyto_nucl(8.5),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3E2	Uncharacterized protein	Low	8.7	1	20-47	KDGARRVFRCPVKPKPYRSPPSPPPAYR	nucl(12.5),mito(9),cyto_nucl(8.5),cyto(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5S4	C6 transcription factor (War1), putative	Low	7.7	1	134-155	ACVVTAPTRKRQKKTDSRVAEL	plas(9),nucl(8.5),cyto_nucl(8),cyto(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA48	Protein-tyrosine-phosphatase	Low	9.9	1	50-71	PDRVAPSKRRSRSASRTRMPLQ	nucl(18),cyto_nucl(13),cyto(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC36	Helo_like_N domain-containing protein	Low	9	1	395-416	LFSSWSNLRRHQREKARQEPAC	nucl(14.5),cyto_nucl(10),cyto(4.5),mito(4),extr(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPI9	Uncharacterized protein	Low	6	1	2-31	FKGPGRRPSGVQKHPWHRSKSPNPPQSKQS	mito(21),nucl(3),cyto(3),cyto_nucl(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSJ5	Pentatricopeptide repeat protein	Low	6	1	755-780	AGVPTGTPRRRLRRLSDNPRNKENIA	mito(17.5),cyto_mito(12),cyto(5.5),nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVE4	Oxidoreductase, 2OG-Fe(II) oxygenase family	Low	8.4	1	8-31	NAHDRPPEPIRRRYKEYQRLQASE	nucl(11.5),cyto_nucl(7.5),plas(4),pero(4),cyto(2.5),mito(2),golg(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWZ2	Uncharacterized protein	Low	9.1	1	459-481	AMTAIPRRKRPDPRKHVARPSSA	cyto(13),cyto_nucl(9.5),nucl(4),mito(4),pero(3),E.R.(3)	TAIPRRKRPDPRKHVAR (461-477, prob:0.917)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX37	F-box domain-containing protein	Low	8.2	1	682-703	AKNPEAQKLIWRRRVRRVGWEV	nucl(9),mito(7),cyto_nucl(7),cyto(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3Z8	Trehalase	Low	8.8	1	508-529	ETSSVWDRRARRRKMTMDKYMW	nucl(15),cyto_nucl(12.5),cyto(8),mito(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G895	Diphthamide synthase	Low	5.4	1	1177-1197	RVPTWKFRRPARSSRLRRSIF	plas(21),extr(2),nucl(1),cyto(1),cyto_nucl(1),E.R.(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1W6	Uncharacterized protein	Low	5	1	457-476	EGKFRSWKNKHGICNRVREY	extr(18),golg(6),cyto(1),E.R.(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2E4	Zinc-containing alcohol dehydrogenase, putative	Low	7	1	330-355	LSEAKDAYRRLKEKKHFSKIVIRVDH	cyto_nucl(7),nucl(6.5),cyto(6.5),mito(6),pero(3),plas(2),extr(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I622	Integral membrane protein 25D9-6	Low	7.7	1	209-232	YVNTHTKKKRLEALRKHYDQRRGG	nucl(8),mito(8),mito_nucl(8),cyto(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC33	RING finger protein (Zin), putative	Low	7	1	585-612	RKALGPPLKNNGRQRRPRQNQENEPFFG	cyto(10),cyto_nucl(9.5),mito(8),nucl(7)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIM4	MYND-type zinc finger protein samB	Low	9.5	1	39-60	LGSSIRARKRRHGVLRAPEVLL	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPL7	Ceramide synthase membrane component (LAG1), putative	Low	8	1	44-72	SRSSADKTSKPHSKRRRSRSALGRFKSLC	plas(23),mito(3)	KPHSKRRRSRS (53-63, prob:0.841)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQI9	Uncharacterized protein	Low	9.5	1	37-58	MPRSGKVQRRRRESPRGRPHPA	cysk(17),cyto(5),nucl(4)	GKVQRRRRESPRGRP (41-55, prob:0.86)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW75	Zn(2)-C6 fungal-type domain-containing protein	Low	7.2	1	32-54	RSHGKSRYGCENCKKRHVKCDEL	cyto_nucl(8.833),nucl(8.5),cyto(8),cyto_mito(5.333),plas(4),pero(2),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXZ3	Protein kinase domain-containing protein	Low	5.7	1	94-113	ALIFIRKKRRWDAIERNHER	mito(9),plas(4),cyto(3),extr(3),E.R.(3),nucl(2),golg(2),cyto_pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5H8	BCS1-like ATPase, putative	Low	7.1	1	461-491	DETQKQQRAKCRSPKSSLKEKPKSHIRHGLS	cyto_nucl(9.333),nucl(8.5),cyto(7),extr(6),cyto_mito(4.999),pero(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDA9	Uncharacterized protein	Low	8.8	1	303-322	YHMNHKRKLRFSPWKQVKSN	nucl(10),cysk(9),cyto(4),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4N0	Uncharacterized protein	Low	8	1	124-146	GIFTTRDRGKHSRKRKFVAHMFS	cyto(9),E.R.(5),extr(4),mito(3),plas(2),pero(2)	HSRKR (134-138, prob:0.63)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F852	20S cyclosome subunit (Cut9/Cdc16), putative	Low	8	1	742-769	EDPPGSRNRGSRRSPTRRVETRGQHGDV	mito(12),nucl(10.5),cyto_nucl(8),cyto(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAX3	Retrograde regulation protein 2	Low	5	1	541-564	IERIEKTGKKKNWAQARSKKEEDY	cyto(12.5),mito(8),cyto_nucl(7.5),extr(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBF3	MFS transporter	Low	5	1	470-493	QEILLRIENRKRRRGDRDHWIEGL	plas(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP49	Phosphotransferase	Low	5	1	28-55	LFPALFRDMSRKRRKHFRGACWPPRTLE	cyto(9),mito(7),plas(5),mito_nucl(5),cyto_pero(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0W3	C2H2 type zinc finger domain protein	Low	7.2	1	60-84	KDTGSKPFVCKQCRRPFARQDALIR	mito(7),cyto(7),cyto_mito(7),nucl(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1F4	Uncharacterized protein	Low	6.1	1	24-44	AKDNTKQTKKQDTGKDTRKPD	cyto(11.5),pero(9),cyto_nucl(8),nucl(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4G4	Methyltransf_2 domain-containing protein	Low	6.7	1	263-282	LARKSLPKRYKSRIKFDHND	cysk(12),cyto(7),nucl(5),cyto_pero(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAX6	General transcription and DNA repair factor IIH helicase subunit XPD	Low	8.3	1	677-699	VLADRRFQKKRTQLPKWINQAML	nucl(12.5),cyto_nucl(11),cyto(8.5),cysk(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZS4	Autophagy-related protein	Low	5	1	31-50	DPTFIDSKQKRIRQNIEEFE	plas(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0V7	Chitin synthase	Low	5.4	1	236-255	EDTPKIRRRGRRTIVTQKHL	plas(22),mito(2),nucl(1),cyto(1),cyto_nucl(1),E.R.(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I586	Uncharacterized protein	Low	9.3	1	20-47	TEDLWNSPSKRRAKTPRQKTPKNEDGSP	plas(18),nucl(3.5),cyto_nucl(3),E.R.(3)	KRRAKTPR (29-36, prob:0.663)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7Z6	Uncharacterized protein	Low	9.5	1	485-507	AETWCERLGRKRPSRPATEEQEQ	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGK2	Cytochrome b561 domain-containing protein	Low	5	1	362-388	AAFFVYVSIRHRRRKQQDDKTSKVVDQ	plas(23),E.R.(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGX9	Alpha-amylase, putative	Low	5	1	2-23	RAFLRCGTSRKRSKWDEIEHEA	mito(18),pero(5),cyto(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLT4	Uncharacterized protein	Low	5	1	2-29	APGPLPQQAPRQRRRWLRFPSCKRITIC	plas(8),mito(7),extr(4),cyto_mito(4),mito_nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNE1	Aa_trans domain-containing protein	Low	7	2	170-192, 486-505	EEPERRPLLHHRRRSSRVPREGD, RSGKRDPLTKWKKNLFRICL	plas(25)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRE0	Dolichyl-phosphate-mannose--protein mannosyltransferase	Low	8	1	11-36	VKPLSRTGRSRSRSPNPKGKKGGVTA	plas(22),mito(2),E.R.(2)	RTGRSRSRSPNPKGKKG (16-32, prob:0.842)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYB0	Uncharacterized protein	Low	8.4	1	719-753	GSHVSGQTVSKKRRRRKKRNTKSKHSGDGERQPLL	extr(7),plas(5),E.R.(5),mito(4),cyto(2),nucl(1),pero(1),golg(1),vacu(1)	KKRRRRKKRNTKSKH (729-743, prob:0.995)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G056	Uncharacterized protein	Low	6.1	1	201-220	RDFRMRSRGLRRRMWWKNVK	mito(14),nucl(3),extr(3),cyto(2),plas(2),pero(1),E.R.(1),golg(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2J7	Integral membrane protein	Low	8.1	2	1411-1434, 1631-1653	GTHFSFWYRKHHCRKCGRVVCSSC, SSTGLRPRRSSRAYRPRVDERDI	plas(21),nucl(3),cyto(1),E.R.(1),golg(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9F5	MFS domain-containing protein	Low	5	1	904-927	AVGNIFSRVLRKKQRNGSQFSDNH	plas(23),E.R.(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3P2	Beta-galactosidase	Low	6.6	1	60-80	MDPQRIPHQYWRQRLNKARSM	extr(16),nucl(4.5),cyto_nucl(3),mito(2),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F787	Uncharacterized protein	Low	5	1	30-53	LTATLKRVNRVKRPLNNVNQHTRC	mito(11),extr(8),cyto(6.5),cyto_nucl(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC31	Uncharacterized protein	Low	7.6	1	18-41	DDSATDSKSRKRQRTGKIDQFTDI	cyto_nucl(10),nucl(9.5),pero(9),cyto(7.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRJ8	Uncharacterized protein	Low	6.1	1	368-391	PERARYFRVQHHHKEKKARICRMA	mito(13.5),cyto_mito(10),cyto(5.5),nucl(4),pero(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRM0	FAD dependent oxidoreductase, putative	Low	8	1	17-40	GLPNRACTECRRKKIRLSLMDTLD	nucl(10.5),cyto_nucl(9.5),cyto(7.5),pero(4),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUT6	Uncharacterized protein	Low	8.4	1	305-328	VDTASPTRRRHSRRRDSMSARPFM	nucl(16),cyto_nucl(11.333),mito_nucl(10.333),cyto(5.5),mito(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWT1	Oxidoreductin	Low	5.4	1	121-141	EGPKVRHPGRKQQEERPKDRP	mito(12),extr(8),cyto(3),nucl(1),pero(1),golg(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2A8	DUF1752 domain-containing protein	Low	9.6	1	683-703	MKRFPSRPPIARKRTPTPRSP	nucl(13),mito(3),cyto(3),cyto_mito(3),plas(2),pero(2),golg(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G674	Cell division control protein Cdc48	Low	9.9	1	28-49	LDTSTAILKKKKKPNSLIVTDA	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8G4	Ubiquitin carboxyl-terminal hydrolase	Low	8.4	1	74-96	ALNIKRIQKKLQRDEPPHKISKL	nucl(12.5),cyto_nucl(9.5),cyto(5.5),mito(5),pero(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9X3	Protein kinase (VPS15), putative	Low	8.4	1	913-933	TGPAARRKHLRSRSQRQREIG	nucl(12.5),cyto_nucl(11),cyto(8.5),pero(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEQ5	Tripeptidyl peptidase SED3	Low	5	1	74-93	STPGHKKYGKHLKQDEIRDF	extr(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTC4	Uncharacterized protein	Low	9.4	1	45-68	QQQQQQLQRRQRPQQQQQQQQQDD	nucl(17),cyto_nucl(12.333),cyto(5.5),cyto_pero(3.666)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBV2	Elongation of fatty acids protein	Low	8	1	530-554	EGFSKVPAKGRGKRSKKGPEASPVE	cyto(8.5),mito(8),cyto_nucl(5.5),plas(4),pero(2),E.R.(2)	VPAKGRGKRSKKG (535-547, prob:0.922)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDG4	Uncharacterized protein	Low	5	1	86-106	NKPWRPIPSKRITPSRARHFL	plas(20),mito(3),E.R.(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHC2	ATP-dependent helicase dcl1	Low	8.7	1	397-419	IMNNYSHKRRMRQENERKRVKEA	nucl(13.5),cyto_nucl(11.5),cyto(8.5),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLQ2	FAD-binding PCMH-type domain-containing protein	Low	5	1	429-448	GSNYEKLKEIKRRRDETGFF	cyto(13.5),cyto_nucl(8.833),cyto_pero(8.666),mito(4),cysk(3),pero(2.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FND8	Kinase domain containing protein	Low	9.8	1	121-143	ISRSNSSDRKWPKPIKREDSQIC	nucl(12),cyto(9),mito(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQP8	Uncharacterized protein	Low	8	1	2471-2494	ASLPNIMKAKKKPLEKKTLADFGV	plas(23),extr(2)	KKKP (2480-2483, prob:0.662)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUT9	mRNA splicing factor (Prp17), putative	Low	6.5	1	483-507	VYASTDKFRQNRKKSFRGHNNAGYA	cyto(14.5),cyto_nucl(11.5),pero(6),nucl(5.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYY6	Coproporphyrinogen oxidase	Low	6.1	1	8-28	APLARSLLRRPYKRSQFPSSF	mito(19),nucl(3),cyto(3),cyto_nucl(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZL6	C6 finger domain protein	Low	9.2	1	106-134	DQSARRKRSKVSRACDECRRKKVRCDATS	nucl(11),cyto(5),mito(4),plas(4),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0S5	Probable cytosolic iron-sulfur protein assembly protein 1	Low	7.3	1	416-439	YEVNHVCWAKRPRRRQGEEVLDTS	cyto_nucl(10.833),nucl(10.5),cyto(10),cyto_mito(8.333),mito(5.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2V9	Squalene synthase	Low	5	1	346-369	CEVFRRYARRIHKKNTPKDPNFLK	E.R.(6),mito(5),cyto(5),cyto_mito(5),golg(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G559	FMN binding oxidoreductase	Low	8.3	1	73-103	EKTTTTKQIPLRQIKNPKKRKVQQLVDDSDI	nucl(11),cyto(11),cyto_nucl(11)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8V2	Krueppel c2h2-type zinc finger protein, putative	Low	5	1	592-613	QCSSCPKKFVRRDLLRRHEKRH	plas(26)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5V5	Uncharacterized protein	Low	9.7	2	282-304, 1429-1448	LNTLKEQSFKKRMEKDRRVEDLV, RNLGTMKKAKEEKRREAQAE	mito(12),nucl(7),cyto(4),plas(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F931	Disulfide isomerase, putative	Low	9	1	272-294	AKAKGKKSSKASKKSTKPTKVND	cyto(13.5),cyto_mito(10.333),cyto_nucl(9.666),mito(5),nucl(4.5)	PAKAKGKKSSKASKKSTKP (271-289, prob:0.967)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9K9	DEAD/DEAH box helicase, putative	Low	7.6	1	1913-1935	ANNGRDKGRRQGHQKNGNTVAKS	cyto_nucl(10),nucl(9.5),cyto(9.5),mito(4),pero(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEX4	Uncharacterized protein	Low	8	1	7-30	SAPTAGIRKRKSSHRPRSSPFASH	mito(22),cyto(4)	IRKRKSSHRPRSSPFASHPRQKPG (13-36, prob:0.875)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJ58	Uncharacterized protein	Low	8.7	1	355-374	SSKNVKKTPKSPPMVRQARA	nucl(13),cyto_nucl(11),cyto(7),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKD8	Glyoxalase family protein	Low	6.1	1	551-574	GDSRRSTTRSHTSHRSKSRSHASH	extr(10),mito(9),cyto(4.5),cyto_nucl(4.5),nucl(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNF5	Uncharacterized protein	Low	5	1	416-435	LSDQKRKQRCLEIKERYAEY	cyto(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNH5	Uncharacterized protein	Low	7.9	1	1-23	MICFKRRNKQRAPPTSKIPHIRQ	mito(12),nucl(10.5),cyto_nucl(9),cyto(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQZ2	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit	Low	9.7	1	11-34	QLSRAKDSNKSSKKKDSSNSSSQS	nucl(18),cyto_nucl(12.5),cyto(5),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVB0	Uncharacterized protein	Low	6.6	1	48-67	ITCINARRRRRHGQNPLPGT	plas(12),extr(6),nucl(4),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3D6	Uncharacterized protein	Low	5	1	55-80	DSASTQTKGKKIKRHFRRFWFCYVLL	plas(11),cyto(7.5),cyto_nucl(5),extr(3),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3R9	CAAX farnesyltransferase subunit beta	Low	6.8	1	4-25	VSASGKYRRKVRFPSSSKPIPP	plas(17),nucl(5),mito(3),cyto_nucl(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GFM3	DUF1295 domain protein	Low	8	1	336-363	SVEPKGSSKRAAKSKSKRSEPDNESRKS	plas(17),mito(4),E.R.(4)	PKGSSKRAAKSKSKRSEPDNESRKSK (339-364, prob:0.947)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRN8	NADH-cytochrome B5 reductase	Low	6.6	1	549-568	VYSVNKTRPVTRKRLDKYDQ	cyto(13.5),cyto_pero(10.5),pero(6.5),nucl(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2I0	General transcription and DNA repair factor IIH subunit TFB4	Low	8.8	1	366-393	DYGAKPAVVARKKKKKKVRANGTPGAGT	cyto(10.5),cyto_nucl(7),extr(5),mito(4),nucl(2.5),plas(2),E.R.(2)	ARKKKKKKVRA (375-385, prob:0.98)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7W5	DNA-directed RNA polymerase III subunit	Low	9.2	1	96-119	MPSYSEKYQKKKRTLPRLQGRPYV	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRK0	PH domain protein	Low	9.8	1	917-937	SGPLYRKPRRHSTFARCNVVL	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTB5	Uncharacterized protein	Low	5.6	1	397-416	EENFFWARRKKKTREAQVAA	plas(21),nucl(2),mito(2),cyto(2),cyto_nucl(2),cyto_mito(2),mito_nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUQ7	Cation-transporting ATPase	Low	8	1	1514-1534	VDTLRRRSRSPASRDRGREAD	plas(22),E.R.(3)	SAGRPPAEGRGGRIPGA (1407-1423, prob:0.707)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWV6	DUF788 domain protein	Low	8	1	151-173	GAAPESKRQKKMEKRGGQRVQYR	mito(21.5),cyto_mito(11.5),extr(2)	KRQKKMEKRG (157-166, prob:0.707)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1D6	Uncharacterized protein	Low	8.9	1	3-24	HTDSQSPRVKRRRIDNSEGSAP	nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G375	tRNA (uracil-O(2)-)-methyltransferase	Low	9.8	1	469-490	GARFRYPPPKTGKKDRRTTPDE	nucl(12),mito(6),cyto(4),plas(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G953	Fatty acid hydroxylase domain-containing protein	Low	6.8	1	298-320	DHDLHHRKGWRKSHNYGKQTRIW	mito(8),cyto(7.5),cyto_pero(6.5),nucl(6),pero(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9L8	RING finger domain protein, putative	Low	5	1	501-528	TQNRRSWLTSRLRDRFRIRTRQHEGPST	extr(20),E.R.(3),golg(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB28	Alpha-1,3-glucosyltransferase	Low	5	1	1-26	MANSSTPSSHRPRKKRTVFTTSPASN	plas(20),E.R.(3),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDH9	Uncharacterized protein	Low	6.9	1	64-84	GLPRRLFLPGRHRNRRQSGES	mito(8),nucl(5),cyto(4),plas(3),pero(3),extr(2),golg(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2G2	SEC7 domain-containing protein	Low	6.9	1	1278-1299	DALARRSKVKQIKPSENKAVAR	cyto(13),cyto_nucl(11),nucl(7),cysk(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F985	Ribosome recycling factor domain-containing protein	Low	9.6	1	66-90	RSFHSSPILKKKKDKGKKGGEDAAT	mito(15.5),mito_nucl(11.833),nucl(7),cyto_nucl(5.833),cyto(3.5)	KKKKDKGKKG (75-84, prob:0.904)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FE39	Homeobox transcription factor, putative	Low	8.7	1	255-278	LGDPIDPRNKRRRGNLPKPVTDIL	nucl(13),cyto_nucl(11),cyto(7),mito(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FI10	Uncharacterized protein	Low	7	1	450-473	HEMLGKPVPSRQRRRQGQGIQGLY	mito(11),nucl(5),plas(5),cyto(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FL93	Uncharacterized protein	Low	6.2	1	41-62	FENRGTKSAQIRSKRRREEYLP	plas(8),nucl(4),mito(4),cyto(4),cyto_nucl(4),cyto_mito(4),mito_nucl(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVK5	Fe2OG dioxygenase domain-containing protein	Low	6.9	1	77-96	NENSKLRKRVESRWNQPSFC	cyto(9.5),cyto_nucl(9.5),nucl(6.5),pero(6),cysk(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVM8	Origin recognition complex subunit	Low	9.3	1	31-55	ADVANERSSKRRKVTKENHVQENAQ	nucl(16),cyto_nucl(12.5),cyto(7),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ00	C6 transcription factor, putative	Low	6.9	1	12-37	QADPTPRRSKKSTARRVRTPATNEAR	plas(14),mito(7),nucl(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3U5	Eukaryotic translation initiation factor 2c	Low	7.9	1	934-961	PQSGPHIKLNNPKPKKPQQLEKKLLPIH	nucl(11.5),mito_nucl(11),mito(9.5),cyto(4.5),cyto_pero(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZG8	Uncharacterized protein	Low	6.1	1	495-514	RTSLIMKKTRANNRLQRTDE	mito(11),extr(6),nucl(3),cyto(2),E.R.(2),plas(1),pero(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5D6	Uncharacterized protein	Low	5	1	219-239	RGPPRFTRRSRGPPVLTRPPM	plas(20),mito(2),E.R.(2),vacu(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9G2	Cytoplasmic tRNA 2-thiolation protein 1	Low	8	1	9-33	CKEARAVIIRPKNRHKLCRSCFLHV	mito(17),cyto_mito(11.999),mito_nucl(11.499),cyto_nucl(6.166),cyto(5.5)	KKKKVTGTKAKGVKPL (350-365, prob:0.782)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDQ1	Siderophore transporter, putative	Low	8	1	250-272	LQYNRHKAKKKGLLHKKERSGRT	plas(23),E.R.(3)	RHKAKKKGLLHKKERS (254-269, prob:0.897)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRR4	Phosphopantothenate-cysteine ligase, putative	Low	9.2	1	323-344	PDEPRERWIRVPKAKRSKSISG	nucl(15.5),cyto_nucl(12),cyto(7.5),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0J2	GPI-anchored wall transfer protein 1	Low	8	1	91-119	LLLLSPKKAQKTQKAKPPRSASRKDDTSK	plas(20),E.R.(6)	KKAQKTQKAKPPRSASR (97-113, prob:0.769)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5M0	Uncharacterized protein	Low	8	1	12-40	LLWKIPWRLSRPQKARQRKRLRAVDRVVD	mito(26)	RPQKARQRKRL (22-32, prob:0.756)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7Z8	Chitin synthase activator	Low	7	1	45-65	DSPEAKPNPHRISRKPLKPTP	mito(18),nucl(6),cyto_nucl(5.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD21	Abhydrolase_3 domain-containing protein	Low	7	1	716-735	QRRLWERRARRDSHEPQLKQ	cyto(9),pero(6),nucl(5),cysk(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDU2	Mitochondrial protein Fmp25, putative	Low	5.8	1	24-44	NPTRLQCRYYSSKNQQKPSSS	mito(24),nucl(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8W2	Uncharacterized protein	Low	6.7	1	713-732	FCPDRWYTWKPKPWQYIPFN	cysk(15),nucl(5),cyto(5),cyto_nucl(5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDE3	Ion channel	Low	8	1	399-418	KSGTGYRKKLRRKPIRSAIS	plas(22),mito(2),vacu(2)	ESIRSGRMKSGTGYRKKLRRKPIRSA (391-416, prob:0.963)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEX9	Uncharacterized protein	Low	5	1	577-600	VACFSCCLKRRTRRSYAQIPLEET	extr(16),cyto(3),golg(3),mito(2),E.R.(2),cyto_pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIV5	DUF3074 domain-containing protein	Low	8.2	1	558-577	ASTKKKLTSREKKLAKLDSR	nucl(13),cyto_nucl(9.833),cysk(5),cyto_mito(4.666),cyto(4.5),mito(3.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ01	Capsule-associated protein CAP1, putative	Low	5	1	89-108	VREYRRRYRMHPPPHFDKWF	extr(13),golg(8),E.R.(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW17	DUF2236 domain-containing protein	Low	8.1	1	274-297	IYPAFPKKLRSYPQRYYQRKLEEQ	nucl(11),cyto_nucl(10),pero(8),cyto(7)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYB9	Uncharacterized protein	Low	8	1	5-32	TDTVSKGSKQGRRHGQKKKTTSPSQLVP	plas(18),mito(4),E.R.(3)	GRRHGQKK (15-22, prob:0.649)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G545	DEAD/DEAH box RNA helicase (Ski2), putative	Low	6.9	1	36-55	EDSVRSRKRARQSADELKAE	plas(12),nucl(5.5),cyto_nucl(5.5),cyto(4.5),E.R.(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I327	Uncharacterized protein	Low	8	1	179-202	KTEVEKKVKEEKKEKEKEAKECIC	plas(11),mito(8),E.R.(5),cyto_mito(5)	KEEKKEK (187-193, prob:0.636)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I668	CCHC-type domain-containing protein	Low	9.7	1	493-513	GSSKRKSRSISPLKKQANPQL	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQK9	AMP dependent CoA ligase	Low	8	1	559-581	SGKILRRFLRDREKELRRKAGGK	cyto(10),plas(6),cyto_pero(6),mito(4)	SPSGKILRRFLRDREKELRRKAGGKL (557-582, prob:0.923)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVZ0	Fatty acid hydroxylase domain-containing protein	Low	5	1	298-323	EDHDLHHRKGWKKSHNYGKQTRLWDR	mito(13),cyto(6.5),cyto_pero(6),pero(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I063	3-oxoacyl-[acyl-carrier-protein] reductase (Fragment)	Low	6.3	1	1528-1547	ESYKTKVEARQKKAYRYFHN	cyto(15.5),cyto_nucl(10.833),nucl(5),mito_nucl(4.333),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4M9	Zn(2)-C6 fungal-type domain-containing protein	Low	8	1	18-42	SCDLRIPRCSRCVKRKVHCTYTNEP	mito(16),nucl(9.5),cyto_nucl(6)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5P6	tRNA wybutosine-synthesizing protein 4	Low	7.3	1	416-435	LEKAKEGKKRKWDEIVHGKA	cyto_nucl(9.5),cyto(9),nucl(8),extr(5),mito(2),pero(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9B4	MFS transporter, putative	Low	8	1	34-59	DETQELRHKKKLERRLRLKVDVRLCT	plas(26)	KKKLER (42-47, prob:0.646)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIQ5	Malate synthase	Low	5	1	38-57	RTFNPTRKALLQRRVQRQAE	pero(15.5),cyto_pero(11.833),cyto(7),cyto_mito(5.333),mito(2.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIW1	Uncharacterized protein	Low	5	1	714-742	DSVWSPRGTEKSRRTWRRRENDVGPQERD	mito(27)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQG0	Uncharacterized protein	Low	7.3	1	295-315	EDDEHHRHRHHHHHHHPPALQ	mito(8),nucl(7.5),cyto_nucl(7),cyto(5.5),extr(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FV32	Pisatin demethylase	Low	7.7	1	350-370	VWDPERWLCNPEKRKKMKNRC	cyto(11),nucl(7),pero(6),mito(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4W5	Alpha-glucosidase/alpha-amylase, putative	Low	7.9	1	123-153	FKESRKSKDNPKRSWYFWKKGKVDKNGEKAP	nucl(10),cyto(8.5),cyto_pero(8.5),pero(7.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5L1	Iron sulfur assembly protein 1	Low	9.1	1	119-141	PSTSQTTKPRRSRLRPRKAAMKL	mito(18),cyto(4.5),cyto_nucl(4.5),nucl(3.5)	KPRRSRLRPRKA (126-137, prob:0.812)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQJ8	Fungal specific transcription factor, putative	Low	8.9	1	14-35	CVLCQQRRVKCDRKFPCSKCVA	nucl(13.5),cyto_nucl(9.5),mito(7),cyto(4.5)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3N2	Transcription factor SipA3, putative	Low	6.9	1	1125-1144	SSKLGFRRSRKQRTLVQLVS	cyto(8),mito(7),nucl(5),plas(2),E.R.(2),golg(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3S3	Choline dehydrogenase, putative	Low	5	1	388-407	TEKARKFTRRHSKSSRDYLL	cyto(8),extr(8),cyto_nucl(5.5),cysk(5),pero(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I420	Uncharacterized protein	Low	8	1	88-107	VAEVQRKRFKKDPKNKGNIF	plas(18),mito(5),E.R.(3)	KK (97-98, prob:0.605)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5L1	Uncharacterized protein	Low	9.9	1	13-37	RDCKVPFCVKTRRHRPKGGPDAARD	cyto(12),pero(6),nucl(5),mito(4)	HRPK (26-29, prob:0.614)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F939	60S ribosomal protein L12	Low	9.9	1	82-105	IKALKEPPRDRKKEKNIKHTKSIP	cyto(15),cyto_nucl(13.833),nucl(8.5),mito_nucl(6.332)	KEPPRDRKKEKNIK (86-99, prob:0.815)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAP1	Uncharacterized protein	Low	8	1	244-270	TCAGCFCLIRHRRKKAKARGQSQHLHA	extr(16),mito(5),plas(3),cyto_mito(3)	HRRKKAKAR (254-262, prob:0.847)
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBT0	Uncharacterized protein	Low	9.7	2	654-673, 811-830	FVTPEKPKPKIRPSDTRHFA, PEQKVASKPKRMSRNVLQPS	cyto_nucl(12),nucl(10.5),cyto(10.5),mito(2),pero(1),E.R.(1),cysk(1),vacu(1)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNE9	Uncharacterized protein	Low	8.2	1	416-436	SSHYYKHSVKAQKSSRPHKLE	nucl(11.5),cyto_nucl(10.5),cyto(6.5),extr(4),mito(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVJ4	Zn(2)-C6 fungal-type domain-containing protein	Low	7.8	1	29-59	APRLRSCITCRSRKVRCDKQSPCSNCRRAKI	plas(9),nucl(7),cyto(3),E.R.(3),vacu(3)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW27	Fungal Zn binuclear cluster domain containing protein	Low	9.4	1	13-37	QDNTIMSARPRKRQRRTSGIGPTIT	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ64	DUF2439 domain-containing protein	Low	9.6	1	26-52	VLKFRCLYSHDLRRKAKRWHDGFLRFH	nucl(18.5),cyto_nucl(13),cyto(4.5),mito(4)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3W0	Probable E3 ubiquitin ligase complex SCF subunit sconB	Low	6.2	1	9-28	GPTPRRRRSSLMLRVRPRTA	mito(21),nucl(3),cyto(2)	
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD32	Uncharacterized protein	Low	7.6	1	79-102	RQCGMPIKDKKRSKGWKLEVTESK	cyto(12),nucl(7),mito(3),plas(2),extr(1),pero(1),golg(1)