ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XM95	Probable alpha/beta-glucosidase agdC	Low	5	1	119-144	AGKNNKIELRHDRKIRKERYNEAEQW	extr(11),E.R.(6),golg(5),vacu(2),mito(1),plas(1),pero(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDR5	Protein-tyrosine-phosphatase	Low	6.1	1	681-703	LKWEEFQCQKRGRPLRRELEWAT	mito(15.5),cyto_mito(11.5),cyto(6.5),nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKG6	Uncharacterized protein	Low	9.3	1	143-163	DLLKIRDAKRRKPSLNKEDPI	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKP5	Uncharacterized protein	Low	6	1	128-150	EGPKAQHPGKKQQKERQRPLMGE	extr(6),cyto(5),pero(5),cyto_nucl(4.833),cyto_mito(4.333),nucl(3.5),mito(2.5),cysk(2),vacu(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS58	Phospholipid-transporting ATPase	Low	5.4	1	1306-1332	MEQFQKAIRKVRQVQRMRKQRGYAFSQ	plas(20),cyto(2),golg(2),nucl(1),pero(1),E.R.(1),cyto_mito(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSZ8	Uncharacterized protein	Low	8	1	184-208	KAVERVTAKPKQRRKSISKKLMTTT	plas(14),E.R.(7),mito(4)	KPKQRRKS (192-199, prob:0.701)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUJ3	Uncharacterized protein	Low	9.3	1	143-162	YEKYRPPAKKRQQQATLAQS	nucl(16),cyto_nucl(11.5),mito(5),cyto(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWC0	GTP 3',8-cyclase	Low	8	1	11-37	STSRALPRALRRTRWPQSQVSKKRIAT	mito(22.5),mito_nucl(12.5),cyto(2)	KRKKAKHA (418-425, prob:0.771)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX70	Carboxypeptidase	Low	5	1	78-99	SKASFFSSPKKHTKKAHSEWDF	extr(17),golg(5),vacu(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY33	AB hydrolase-1 domain-containing protein	Low	9.2	1	340-367	SKRDQPKSRDASPKPKRRKGQEREADAA	cyto(10),cyto_mito(8.5),mito(5),extr(5),nucl(4)	KRDQPKSRDASPKPKRRKG (341-359, prob:0.948)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q032	Uncharacterized protein	Low	9.7	1	63-82	MSSIKDHRPRKPIARQRTLT	nucl(16),mito(9),cyto_nucl(9)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0V9	Amidase	Low	7	1	399-421	EPLSPWLRSRVRRKPQKPTTEVV	cyto(11),cyto_nucl(10),nucl(7),pero(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4N6	Tim44 domain-containing protein	Low	8	1	327-348	GWTEKEERRRKREERDRKMGFS	mito(25.5),cyto_mito(14)	ERRRKREERDRK (333-344, prob:0.841)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLH7	Protein kinase domain-containing protein	Low	9	1	35-57	SVSSKPRPDKVSRQPSKHDKMGT	nucl(14.5),cyto_nucl(12.5),cyto(9.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE05	Glycosyltransferase family 90 protein	Low	6.2	1	134-153	AAAYRKRRGRHPPPMFDMWF	mito(8),plas(5),cyto(4.5),cyto_nucl(4.5),nucl(3.5),pero(2),golg(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRD9	Uncharacterized protein	Low	7.3	1	49-69	RKMSNNFKENRRRRRSSSLMY	mito(10),plas(7),nucl(6),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU18	Urea amidohydrolase	Low	6	1	735-756	CRGIGKRDMKFNDKRPRMRVDP	mito(11),cyto(10.5),cyto_pero(6.5),nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZI9	Uncharacterized protein	Low	6.4	1	421-441	VEFKRKRIEPLPYKRLKEERY	mito(19),nucl(4.5),cyto_nucl(4.5),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2D2	Uncharacterized protein	Low	9.8	1	242-263	LSRERGTLRKRRTRLRHGDFQI	nucl(12),cyto(10),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2P2	Uncharacterized protein	Low	8.8	1	1-20	MSRRRPHRRRMTLDTGHDTI	plas(14),mito(9),nucl(2)	RSHSRKR (457-463, prob:0.656)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3D9	Uncharacterized protein	Low	7	2	15-34, 467-490	SNTFICKRCLQRQSNIPPTY, WIPKRTMKLVRQATKQIRHKQVSG	plas(12),mito(9),E.R.(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGD2	Chitinase	Low	8	1	629-657	VATPSAPMKKRRGVRRGLRGEWRPRCREV	extr(27)	MKKRRGVRRGLRGE (636-649, prob:0.87)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJF1	Uncharacterized protein	Low	7.6	1	219-245	RLMESERELKRQRRCRQRQTSLPTPTI	mito(13),nucl(9),cyto_nucl(8),cyto(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJF8	Uncharacterized protein	Low	8.8	1	358-381	LQDGPVARLKKRNKKVDDFYNLFA	nucl(14.5),cyto_nucl(12),cyto(8.5),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKG1	C6 zinc finger domain-containing protein	Low	6.1	1	6-31	AVLSCQQCTRRKTKCDKQLPTCTACL	mito(19),nucl(3),cyto(3),cyto_nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMM6	Uncharacterized protein	Low	5.9	1	146-169	RSVLRKSARSPRRHDKQTACCVCT	mito(23),nucl(2.5),cyto_nucl(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXZ0	Phospholipase	Low	8.5	1	327-346	VLRWNFCKRDKYKRDDRYDW	nucl(13.5),cyto_nucl(12),cyto(9.5),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0N6	Uncharacterized protein	Low	8	1	578-597	AKQSLKSKRTFKPTFGRKMK	extr(23),mito(2),vacu(2)	KKREATKRGMFAKQSLKSKRTFKPTFGRKMK (567-597, prob:0.864)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1V4	Nudix hydrolase domain-containing protein	Low	8.2	1	122-142	VETRENWPERHKRERKWMSYC	nucl(11.5),cyto_nucl(10),cyto(7.5),mito(4),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKA8	Non-specific serine/threonine protein kinase	Low	9.1	1	629-654	GAEPKKKKATRGKRAGKKHKEKENAL	extr(11),plas(5),nucl(3),cyto(2),golg(2),vacu(2),mito_nucl(2)	EPKKKKATRGKRAGKKHKEK (631-650, prob:0.997)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBR6	Uncharacterized protein	Low	6.5	1	34-53	RCTSRSMKVKTTQDRFRRFF	cysk(15),cyto(7),nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE08	ABC transporter-like protein	Low	8	1	1529-1560	YYFFRVRTSSKKSKTSKSKKNDKSNEGPNADQ	plas(25)	KSKTSKSKK (1540-1548, prob:0.651)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJQ0	Uncharacterized protein	Low	9.8	1	258-280	EPSVKRRSTFLRKKSSRSRLSKV	nucl(13),plas(5),mito(3),cyto(3),cyto_mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMC3	Uncharacterized protein	Low	9.8	1	244-279	RPPTYHRRSREKDQSPWRVCIDRRKAQRKHPQHDFS	nucl(12),mito(10),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ31	Uncharacterized protein	Low	8.9	1	446-465	IKYRQPEPSHQNKPNHNHDT	nucl(15),cyto_nucl(13.5),cyto(10)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0M6	Uncharacterized protein	Low	6.3	1	22-76	STTGEAKEKEKRYKCQFCARAFSRSEHRSRHERSHTKERPFKCMKCRSTFVRRDL	plas(11),mito(7.5),cyto_mito(5.5),nucl(4),cyto(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2R2	RING-type domain-containing protein	Low	9	1	79-98	LVKQYRRKTHEYRKKWDDRV	nucl(17),cyto_nucl(15.5),cyto(10)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5C0	Uncharacterized protein	Low	9.6	1	316-342	RTCLLFPRPKTKFFRQRCLHLHLCRKT	nucl(15.5),cyto_nucl(10),mito(8)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLN0	Uncharacterized protein	Low	9.9	1	1927-1953	KDGYQTCKEVRKWERKNKYPHLPIIAL	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQB7	EngB-type G domain-containing protein	Low	5	1	337-358	LENKPLSQSKIQKERNKGRVEG	mito(23.5),cyto_mito(13)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU66	IFRD domain-containing protein	Low	8.1	1	334-358	ERLTRESSKRIAKRDRKQMHTAFRD	nucl(11),cyto_nucl(10),mito(8),cyto(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q262	A_deaminase domain-containing protein	Low	7.3	1	3-22	VVDKLKDKFGRRKAGQQVTV	cyto(9),nucl(6),pero(6),mito(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI60	MFS domain-containing protein	Low	5	1	546-566	SVKRPSTTLCTRKPRLFQLFR	plas(26)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKW3	Uncharacterized protein	Low	6.9	1	14-39	TSSQHAQSYRRRHQSRNKKSDPFLDL	plas(15),nucl(5),cyto(3),E.R.(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1W6	Uncharacterized protein	Low	8	1	87-110	AKHLAPRKRTILRRRRTSQRSTSE	mito(21),cyto(4)	RKRTILRRR (93-101, prob:0.656)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q362	Peptidase A1 domain-containing protein	Low	5	1	25-47	GDYTVSRIPRQRQKAQPSELKIT	extr(25)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WHS7	Uncharacterized protein	Low	8.7	1	233-259	QAMWFEKFTKKKERQRNRDQRHAHEIQ	nucl(13),cyto_nucl(10),cyto(5),pero(5),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCZ2	Uncharacterized protein	Low	5	1	142-164	DEVARKEYMRKNRRRPIEQTVNE	extr(8),mito(7),plas(6),pero(2),vacu(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE01	Dynein heavy chain, cytoplasmic	Low	8.4	1	470-492	ADKFIAIKIKKRHDRTQDRISYI	cyto_nucl(13.5),nucl(13),cyto(12)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGQ8	Uncharacterized protein	Low	9.8	1	275-295	RMPSLVSPCRRRKTCEQREIS	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQT4	Uncharacterized protein	Low	9.2	1	235-257	YLVERARERRRQARQLERPGLRF	nucl(11),mito(10),cyto(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW88	Thioredoxin domain-containing protein	Low	7.1	1	41-61	TVPPSAQRRQPPPPPARPQLP	cyto(7.5),cyto_nucl(7.5),mito(7),nucl(6.5),plas(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIE8	Zn(2)-C6 fungal-type domain-containing protein	Low	9.7	1	34-65	MLLPSCQNCKRRKTSCRYGTLKRKPGPAKGQS	nucl(16.5),cyto_nucl(10),mito(3),plas(3),cyto(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBJ5	Uncharacterized protein	Low	6.5	1	263-282	AFLLWDKRRKQKKYASSAMG	extr(12),mito(7),nucl(4),cyto_mito(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCK5	Uncharacterized protein	Low	9.9	1	215-234	ESSEPKQKDILKPGRRPRKS	mito(19),nucl(5),cyto(2)	LKPGRRPRKSL (225-235, prob:0.817)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFU0	Uncharacterized protein	Low	6.5	1	466-486	QLGFRETRWWKLRRRMARSDA	extr(11),cyto(6),nucl(4),mito(3),pero(1),E.R.(1),golg(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGP4	Uncharacterized protein	Low	9.2	1	365-393	RTLHPEKSIEPSPKKRKAKSLHRAPTIHE	plas(14),nucl(3),E.R.(3),cyto(2),golg(2),mito_nucl(2)	PSPKKRKAKS (375-384, prob:0.861)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRS1	FAD-binding PCMH-type domain-containing protein	Low	5	1	487-506	LKTLKDIKKKYDPDDRWRTV	extr(27)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVL4	NADPH:adrenodoxin oxidoreductase, mitochondrial	Low	8.7	1	430-450	AEEVKRGKEKGKEREKFRTVG	cyto(15.5),cyto_pero(10.666),cyto_nucl(10.333),pero(4.5),nucl(3)	KRGKEKGKERE (434-444, prob:0.757)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXY3	Uncharacterized protein	Low	7.4	1	10-34	DNVKKLFKGLFKRGKNKKQDTSAAQ	mito(11),cyto_nucl(10),nucl(8.5),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYH4	Uncharacterized protein	Low	6.6	1	316-338	PYNGRFAQKSWQRRPSNNNFNHS	mito(8),extr(8),cyto(5),nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q466	A to I editase domain-containing protein	Low	6.4	1	18-41	FDTLQPRYKPRTLPHRQREWVPLA	cyto(9),cysk(7),nucl(4),mito(4),mito_nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMM0	Uncharacterized protein	Low	5	1	250-273	WSYVRSWWIKRQWEQEKQREKAKL	mito(14),pero(5),cyto(4),extr(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGG3	Uncharacterized protein	Low	7.3	1	297-320	HEDMLDRRTKRKHLPVEQRPSQIV	mito(14.5),cyto_mito(9.5),nucl(8),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGV0	Uncharacterized protein	Low	8	1	301-322	LSSIRSKNRKTAKSRRGGAVRQ	plas(19),E.R.(5),mito(3)	KNRKTAKSRR (307-316, prob:0.683)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIM7	ATPase_2 domain-containing protein	Low	6.2	1	66-85	TQEAKKIPRKHTFSKLPGFH	mito(18),mito_nucl(12.333),cyto_mito(10.833),nucl(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNU1	Uncharacterized protein	Low	8.5	1	68-93	GGSCTNSSRRHNRQRRVQQNPRVTSQ	nucl(9),mito(7),extr(7),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT64	Uncharacterized protein	Low	8.8	1	1320-1342	RNLGTMRKAKEEKRKEAQADPND	nucl(12.5),cyto_nucl(8.5),mito(8),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVJ3	MFS domain-containing protein	Low	5	1	507-528	IDIMFKRKIPARQWKKTVIDIN	plas(26)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX34	Uncharacterized protein (Fragment)	Low	5	1	4-23	SGHSRWSKIKHEKAKVDAGK	cyto(13),cyto_nucl(8.5),mito(6),pero(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXL4	Uncharacterized protein	Low	9.6	1	50-72	QEQTPGRERSKRRKTEPAVAPLI	cyto(14),nucl(12)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYA2	Ribosomal_L18e/L15P domain-containing protein	Low	9.2	1	270-289	GKKDSKKASAGKQKTQAQKS	mito(22),nucl(3)	NKKIRRGRGPASGKGKTSGRGHKGQKQHGK (38-67, prob:0.978)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCH1	Uncharacterized protein	Low	6.1	1	348-367	TPPMRIKYRKFVNKNHQDIT	cyto(10),cyto_nucl(8),pero(7),mito(6),nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMX3	Uncharacterized protein	Low	7.6	1	60-80	PAPKTPTKLTRRPGQTPQKSG	nucl(9.5),cyto_nucl(9),cyto(7.5),mito(5),plas(1),extr(1),pero(1),cysk(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSH4	Uncharacterized protein	Low	9.3	1	1506-1529	ALAADIRQKHRRRLERQHDIESTR	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTX7	FMN hydroxy acid dehydrogenase domain-containing protein	Low	5	1	52-71	NNTAYRKYRVRPRVLRDVAK	cyto(12),cysk(12),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q268	Mitochondrial Rho GTPase	Low	8.5	1	403-429	GTTPALKVTKARKRRNKPGRVERNVFL	cyto(12.5),cyto_nucl(7.5),mito(6),E.R.(4),nucl(1.5)	TKARKRRNKPGR (411-422, prob:0.907)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2L1	Isoleucyl-tRNA synthetase	Low	8	1	720-740	LTAPRGKNKNRSKKQAPTGST	mito(17.5),cyto_mito(12.5),cyto(6.5)	KNKNRSKK (726-733, prob:0.66)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKJ6	Uncharacterized protein	Low	5	1	13-32	STTASPTKRQTQVRTKNYSG	extr(25)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE70	Mannose-1-phosphate guanylyltransferase	Low	5	1	1396-1417	EGAPVVPRGRRRRSPISTLQSA	plas(23),E.R.(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG91	Glycoside hydrolase family 13 protein	Low	6.5	1	485-507	SIWLFWKRHIHLRKKYKELFTFG	mito(7),extr(7),nucl(4.5),cyto_nucl(4.5),cyto(3.5),vacu(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK32	Uncharacterized protein	Low	8.2	1	65-84	INPPRPQPSRKERSARISNE	mito(16),nucl(10.5),cyto_nucl(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPP1	Uncharacterized protein	Low	5.4	1	346-365	CVCCVPRDRNHKGARCHVGK	plas(11),mito(6),extr(5),pero(2),nucl(1),cyto(1),cyto_nucl(1),E.R.(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQP4	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	10-43	VRKPTVRAPKVGHKKSRKGCQTCKIRRVKCDEIA	plas(16),mito(5),nucl(4)	KPTVRAPKVGHKKSRK (12-27, prob:0.776)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS01	CDT1_C domain-containing protein (Fragment)	Low	5	1	26-50	ALAPSLSKHWKKRSVRPEDIQRILA	mito(15.5),cyto_mito(12.166),cyto(7.5),cyto_nucl(6.833)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUG3	Potassium transport protein	Low	5	1	123-146	VLAEREKRRQVQRGRSQSRGHRCG	plas(20),E.R.(3),vacu(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW25	Uncharacterized protein	Low	5	1	26-56	GYDVDTQQHKRRQAQPSRKNHIRNYRHATTR	plas(22),E.R.(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1I5	Uncharacterized protein	Low	5	1	502-524	FPATKVYYSWRNQRRQRVWEGMS	plas(22),mito(2),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Q9	Uncharacterized protein	Low	5	1	26-45	RPPSHPSRLRSKTPRYQYGP	mito(10),plas(7),cyto_mito(7),cyto(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4N7	Uncharacterized protein	Low	6.1	1	263-282	LKTPTKAPRRQRASPPRATF	mito(17),cyto(5),nucl(3),cyto_pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIR1	Uncharacterized protein	Low	6.9	1	178-198	IKAVISPRPPQKKKSSKCAIL	cyto_nucl(12.666),cyto(12),nucl(10),cyto_mito(9.332),mito_nucl(8.332)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM41	Uncharacterized protein	Low	6.6	1	4-23	LERPRKSTPYHLRKSWHSHV	mito(21),nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDQ9	GTP binding protein of the Rho subfamily of ras like protein	Low	5.7	1	173-192	HATRAALLTRKKEKKKCSIL	cyto(13.5),mito(9),cyto_nucl(8.5),nucl(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIN9	Uncharacterized protein	Low	6.2	1	156-176	LPDVKQAWRGKKPTKEPVVEK	mito(19),cyto_nucl(4),nucl(3.5),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIT5	Zn(2)-C6 fungal-type domain-containing protein	Low	9.3	1	4-38	VVKNGRVRKRAPNACVRCRKQKIKCSGNVRCEQCV	nucl(14.5),cyto_nucl(9.5),cyto(3.5),mito(3),plas(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIU5	AZUL domain-containing protein	Low	7	1	658-677	DPENKALRRRIERRYLQQLL	mito(12.5),cyto_mito(9.5),nucl(7),cyto(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ50	Uncharacterized protein	Low	5.4	1	198-222	RGCHCYSKAVPKKREVRRSVALRRI	plas(22),mito(2),nucl(1),extr(1),vacu(1),cyto_mito(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRL9	UBC core domain-containing protein	Low	7.5	1	705-724	NTTHMKRTQKEHKILRNPST	cyto(8),nucl(7),cyto_mito(7),mito(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVR4	SprT-like domain-containing protein	Low	8.9	1	345-364	KSGPKKRSYLWIPNKSLCRS	nucl(12),cyto(7.5),cyto_mito(6),mito(3.5),plas(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWP0	Amidase domain-containing protein	Low	5	1	6-27	DFFEHRAACKRKQDERASRIAT	cyto(11),cyto_pero(8.333),mito(8),cyto_nucl(7.833),pero(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Y1	Uncharacterized protein	Low	8.5	1	16-41	ETALMPPPPAPKRQRRPAKVLDEDVY	nucl(14),cyto_nucl(14),cyto(12)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2G5	Uncharacterized protein (Fragment)	Low	5	1	150-169	VRPSWFWTRRRWDEHRRGLG	mito(20.5),cyto_mito(12.5),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5F6	Rif1_N domain-containing protein (Fragment)	Low	8.2	1	273-294	ILLFRHKKRPIEKWPKFKQWLQ	mito(14),nucl(8),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL40	Uncharacterized protein	Low	6.7	1	1567-1586	TLKPFIKSPKPEKKAKIEEE	mito(13),cyto(6.5),cyto_nucl(6.5),nucl(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG12	Arrestin_N domain-containing protein	Low	8.4	1	67-86	KTTAHSKRRVQQGKNHHVTH	nucl(12),cyto_nucl(11.5),cyto(9),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG82	Uncharacterized protein	Low	8.1	1	160-186	LPLPHDHHKHRCVPRKNHQENHPRYTL	nucl(10.5),cyto_nucl(10),cyto(8.5),mito(3),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGP2	MFS domain-containing protein	Low	5	1	459-485	CALFLKWLLKRANKKLRERNAEAHVFY	plas(27)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ02	Mediator of RNA polymerase II transcription subunit 17	Low	7.6	1	580-599	ITIYCKTTRGNEKKVWRLDE	mito(11),nucl(7),cyto(6),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKS7	Uncharacterized protein	Low	9.8	1	184-204	ALVLLRRRRKRQEAAARRAEA	plas(7),cyto(6.5),cyto_nucl(6.5),nucl(5.5),mito(5)	RRRRKRQEAAARR (189-201, prob:0.808)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKU8	Uncharacterized protein	Low	7.4	2	47-68, 474-493	FLISRAPKRVQKQTPSPPRYEK, SLYKVGKKRGWWRGIRNGDV	mito(15),plas(6),cyto(3),nucl(1),pero(1),E.R.(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM86	DNA-directed RNA polymerase subunit beta	Low	7.4	1	1134-1163	QYGGRRREGGRTRCRRCSRKALSTDPKSEC	cyto(11.5),cyto_nucl(10.5),nucl(8.5),pero(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN06	Aurora kinase	Low	9.6	1	371-393	PWIVKHCAGKKEKKQSNEGVQFV	nucl(12),cyto(8),mito(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ96	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase	Low	5	1	316-336	SQLWTKARTKNKKQYPIRVVY	extr(11),cyto(7),plas(3),mito(2),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYM7	TRP_N domain-containing protein	Low	8	1	767-792	VNDLPRPPKPVKEKKKKLEPEPEPEP	plas(24),E.R.(2)	RPPKPVKEKKKKL (772-784, prob:0.913)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLM6	H(+)-transporting two-sector ATPase	Low	5	1	121-143	AVPALDRKRKWKFTPSDKFKKGD	cysk(26)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC61	Uncharacterized protein	Low	8	1	167-189	EEVERRRKEKLVKKLRKHTVIHH	plas(24),mito(2)	RRRKEKLVKKLRK (171-183, prob:0.857)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEY3	Uncharacterized protein	Low	8	1	566-586	SPYARERKSKPARKPDGDRPA	plas(24),E.R.(2)	RKSKPARK (572-579, prob:0.704)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGB5	F-box domain-containing protein	Low	9.2	1	173-192	KSHGRKHYEQHRRKNSRASE	nucl(14.5),cyto_nucl(10.5),cyto(5.5),cysk(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL86	Glutamate-5-semialdehyde dehydrogenase	Low	5.8	1	434-453	GTGAGKRAYKHKKLELPNGI	mito(12),cyto(10.5),cyto_nucl(7),nucl(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW56	Uncharacterized protein	Low	9.9	1	250-273	RWYNEGMRKRRHVEKGRIPKQTWQ	nucl(17.5),cyto_nucl(11),mito(4),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWM3	Uncharacterized protein	Low	9.4	1	121-143	ALDSPRRPEFKRLRRRSTIEWAN	nucl(17),cyto_nucl(12),mito(5),cyto(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXV9	Cyclin N-terminal domain-containing protein	Low	8.1	1	123-142	SEVQHPKKVVPKKSRVLRDP	nucl(10.5),cyto_nucl(9.5),cyto(7.5),mito(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1S3	Glycoside hydrolase family 64 protein	Low	5	1	5-31	VEGIRSFVKRHLRKHHHQPARESKYYS	extr(14),cyto(6.5),mito(5),cyto_nucl(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGQ7	Septin-type G domain-containing protein	Low	9.1	1	64-87	SVNAVNSPRRLRRRKDPTPFNLLV	nucl(14.5),cyto_nucl(10),mito(6),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG31	Uncharacterized protein	Low	9.4	1	122-149	RPENSSRYRSWQRCRRRAWNRIAERMPS	nucl(11),cyto(7),extr(3),mito(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRA2	Uncharacterized protein	Low	5	1	27-51	FVSTTSWTRRRAFKRQRGVLEAPKL	mito(8),extr(5),cyto(4),plas(3),E.R.(3),golg(2),cyto_pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRN3	60S ribosomal protein L20	Low	9	1	119-140	TKDLKFPLPHRAPPKRGKKVFA	mito(17.5),mito_nucl(11.666),cyto_nucl(5.333),nucl(4.5),cyto(4)	HRAPPKRGKK (128-137, prob:0.76)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUF4	Uncharacterized protein	Low	8.8	1	281-307	AEKKKAKAAGRKAKTKDEKKQDKANED	plas(15),E.R.(4),vacu(3),nucl(2),pero(2)	EAEKKKAKAAGRKAKTKDEKK (280-300, prob:0.982)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM84	NADPH--cytochrome P450 reductase	Low	6.6	1	672-694	EDGLRSFMDKQKRIRRWQQDVWG	cyto(10.5),cyto_nucl(8.5),mito(6),nucl(5.5),plas(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNW5	Uncharacterized protein	Low	7.3	1	26-55	STSDKRFTTPSKRSRWSRKVKNEERLPYAG	mito(13.5),mito_nucl(12.333),nucl(10),cyto_nucl(6.833)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRD5	Zn(2)-C6 fungal-type domain-containing protein	Low	8.8	1	1-28	MSSKRSHTKSRLGCQQCKNRRIRCDEVA	mito(14),nucl(10),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT37	Uncharacterized protein	Low	6.3	1	17-43	QIPRSSRQLHHAPKRPIDRRLTCPCRH	mito(15),cyto(6),cyto_nucl(6),nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV07	AMP-binding domain-containing protein	Low	5	1	666-688	LLTPTLKLKRPQTAKKYRQVIDE	cyto(15.5),cyto_nucl(9),pero(6),cysk(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX82	Proline dehydrogenase	Low	5	1	24-49	RAQSNLPTKRRQHTQHVPRRRLHSTF	mito(24.5),cyto_mito(13.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Y5	Uncharacterized protein	Low	8.2	1	31-53	EPEQETPSRRRQQQQQRSLASRC	nucl(11.5),cyto_nucl(11.5),cyto(8.5),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2R9	Uncharacterized protein	Low	6.8	1	21-43	PQSYPLQCSKHHRRDRARTEAAS	mito(7),nucl(5.5),cyto_nucl(5.5),cyto(4.5),plas(4),extr(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q358	Uncharacterized protein	Low	8.8	1	45-71	SAKHQFRLERRYRRRSKLKWARPNWTK	mito(18.5),cyto_mito(10.5),nucl(3),plas(2),pero(2)	RRYRRRSKLKWAR (54-66, prob:0.83)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJS7	Clathrin heavy chain	Low	7.1	1	1515-1536	AASIYRKNKRWDKSIQLSKQDK	cyto_nucl(11.333),cyto(11),nucl(8.5),cyto_mito(6.499),cysk(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5N8	Uncharacterized protein	Low	9.6	1	65-90	QEAEDQEKRRAKKRKATNRGYGTQEQ	plas(14),cyto(5),nucl(4),E.R.(2)	KRRAKKRKA (72-80, prob:0.886)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5R1	Uncharacterized protein	Low	9	2	38-62, 355-377	FACKDCSKTFSRKDHRNRHEDETHC, NAEVRCPIQKRLRRKAELRALVP	mito(18),nucl(5),cyto(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF00	Flavodoxin-like domain-containing protein	Low	7.8	1	1246-1268	LVQRDNGDRKNRKQARLKYTIDR	cyto(11),nucl(7),cysk(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGL3	APH domain-containing protein	Low	9.2	1	44-67	QLTDSTKKKYVLRKKPPGKLLSKT	cyto(12),pero(10),nucl(3)	LRKKPPGK (55-62, prob:0.702)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIH5	Uncharacterized protein	Low	8	1	11-37	LLGSSGRCRRRSRSRRRSRSRSVWAAA	mito(10),cyto(10),cyto_mito(10)	GRCRRRSRSRRRSRSR (16-31, prob:0.92)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJV0	TPT domain-containing protein	Low	8	1	76-108	DAERGLTNTERKKRRRRRRQHTKPDERIARTPS	plas(24),mito(2)	RKKRRRRRRQHTKPD (86-100, prob:0.989)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUX9	Uncharacterized protein	Low	9.9	1	193-216	GTYYRTSLRRVRRNFRTDIKRQVE	cyto(12),cyto_nucl(10.5),nucl(7),mito(7)	RAGPRLHRK (60-68, prob:0.651)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV67	Uncharacterized protein	Low	6.7	1	50-70	ADLSKCRYKRARRRTDEEDGQ	mito(12),cyto_nucl(6),nucl(5.5),cyto(5.5),plas(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3F8	Uncharacterized protein	Low	5	1	10-29	GAKTWLPRFLRPNRAKRTST	plas(27)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIK3	Uncharacterized protein	Low	9.1	1	3-22	YDRTYRKTTTTTNRGRRPLY	mito(14),nucl(3),plas(3),golg(2),vacu(2),extr(1),pero(1),E.R.(1)	KRAKDAAKDKGKGSSK (247-262, prob:0.736)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIV6	AA_permease domain-containing protein	Low	5	1	551-571	ALVGIGRKKHQDRRRSSVTEQ	plas(27)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCK9	Uncharacterized protein	Low	6.8	1	1063-1091	LRYSRVHGRVRQMRRWAKKTGRAHSERDF	mito(13.5),cyto_mito(9.333),nucl(7.5),cyto_nucl(6.333),cyto(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEE8	HEME_HALOPEROXIDASE domain-containing protein	Low	5	1	29-49	NMVRAERQRVRRQQSNANGPG	extr(27)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGA6	Uncharacterized protein	Low	5	1	684-708	ISKIDSPGKQKERKDRYETRQRLVQ	plas(19),E.R.(4),vacu(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTM9	Protein kinase domain-containing protein	Low	6.5	1	1-20	MPPRRNGPCPTPKQRFEEYE	mito(13),nucl(4),plas(3),cyto_nucl(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q399	Uncharacterized protein	Low	8	2	171-190, 202-223	IGPVIKRKPRKLQVRSQAIA, QPDSTPRRPKKLQVRSQSQVDS	cyto(12.5),cyto_nucl(9.5),mito(8),nucl(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4S0	Uncharacterized protein	Low	9.9	1	578-601	ATTSSSEKTRKRGRTNGNRRSELQ	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLF6	Uncharacterized protein (Fragment)	Low	9.9	1	58-78	SITSSQAQRTKKKRNDPDAFA	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL61	60S ribosomal protein L36	Low	9.5	1	63-86	ELLRNSKDKRARKLAKKRLGTFGR	mito(23),nucl(4)	NSKDKRARKLAKKRLGTFGRAKRK (67-90, prob:0.983)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCD1	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	Low	6.5	1	3-37	IPVVRVRAKHSKTRTGCRTCRLRHVKCDEERPSCR	mito(14),plas(8),nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHF4	Uncharacterized protein	Low	6.9	1	44-90	EQQASKRSKLERPSKDRPTHSESDDDQPPTKKRNTKRRSASTAPPAL	mito(19),nucl(5),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXX1	Uncharacterized protein	Low	8.1	1	117-136	TAVARQKDPKRKDKHVFGLF	mito(11),nucl(8),cyto(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1F4	Amino_oxidase domain-containing protein	Low	5	1	12-32	SQPNSAKKRTMDRKKIAIVGS	plas(20),mito(3),E.R.(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2J9	Uncharacterized protein	Low	8	1	321-342	DGAYHPDSNAPKRRRRRWSRGS	extr(25)	PKRRRRRWSRGS (331-342, prob:0.912)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4W7	Uncharacterized protein	Low	9	1	207-242	ESEPLRIKEKTKRRNRHVRKVKSKHRYTILKIKQLR	mito(21),nucl(3),cyto(3),cyto_nucl(3)	RIKEKTKRRNRHVRKVKSKHR (212-232, prob:0.977)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIV4	Uncharacterized protein	Low	7.1	1	7-31	TTHLPPTHPATRQRPKSPNRVLAEA	mito(15),nucl(6.5),cyto_nucl(5.5),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKC7	Uncharacterized protein	Low	7.3	1	290-309	QERHHSKRSRQRELVRKECF	cyto(11),cyto_mito(8.5),nucl(8),mito(4),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV34	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	2	22-54, 64-89	SPDANVRGKLKQRRSRKACGHCHTRKIRCNVLE, DAGTTCIIRRRKNQRRESTPPDQNGH	nucl(8.5),cyto_nucl(8.5),cyto(7.5),mito(4),plas(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0P3	Uncharacterized protein	Low	8	1	149-171	CLCSTRPRSRCLRSHARRNAPSG	mito(14),nucl(8),cyto(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q453	U6 snRNA-associated Sm-like protein LSm1	Low	6.9	1	130-155	LKKQENQDRKKTDKSKQKKLAEFGFE	cyto(18.5),cyto_nucl(14.5),nucl(7.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCR2	Uncharacterized protein	Low	9.2	2	23-45, 450-471	NAIEYKHLKKCIKRVHRELESLG, GVFFPMEVKKRQKDNERAQMLR	cyto(14.5),cyto_nucl(12),nucl(8.5),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEZ0	Uncharacterized protein	Low	9.9	1	479-498	RTSSPLRRKTKRSPNLKVSD	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK7	Uncharacterized protein	Low	9.2	1	73-94	TENARRSYIRRRPQGEKPLQSL	nucl(16.5),cyto_nucl(14),cyto(8.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQC4	Uncharacterized protein	Low	9.9	1	118-142	IESDRKTDKLKWKPLPMRPKSRLIQ	nucl(18),cyto_nucl(13),cyto(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSD2	Cytoplasmic tRNA 2-thiolation protein 1	Low	8	1	369-399	TTRGIPIRMRQEKKANRKPNRDAPPPKQKLG	mito(25)	RQEKKANRKPNRDAPPPK (378-395, prob:0.825)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTE8	WD_REPEATS_REGION domain-containing protein	Low	7.2	1	561-581	TTRHSWRPPARIDKRAIRNGY	cyto_nucl(9),nucl(7.5),cyto(7.5),pero(7),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYK2	Carn_acyltransf domain-containing protein	Low	5	1	147-170	VSYFYSHRDDRKRRDPAKRAAAIS	mito(21.5),cyto_mito(12.5),cyto(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q099	Exonuclease domain-containing protein	Low	9.3	1	650-672	LVENRLQGTKRKKRASMSSNEDD	nucl(16.5),cyto_nucl(13),cyto(8.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHJ7	Endo/exonuclease/phosphatase domain-containing protein	Low	8.2	1	579-600	HSEPCKSMQTKKKGSNQGRSFW	nucl(11.5),cyto_nucl(8.5),mito(6),pero(5),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJS9	RING-type domain-containing protein	Low	7.2	1	84-104	SPDPYQTAKRHHRRVEKNMSE	mito(11),cyto(7),nucl(6),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE14	MBOAT_2 domain-containing protein	Low	5	1	484-509	AEEGVRRCVRRWRKSHKHAESQWYDA	plas(23),E.R.(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF74	Uncharacterized protein	Low	8.4	1	3-22	QKSTEKVEYKNLKRKREAIS	nucl(16),mito_nucl(12.833),cyto_nucl(9.333),mito(8.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIM2	Glycosyltransferase family 24 protein	Low	8.6	2	1463-1482, 1530-1549	CNNPQTKEPKLDRARRQVPE, QREDAERERKREKQKGHDEL	cyto(10),cyto_nucl(8.833),cyto_mito(7.833),nucl(6.5),mito(4.5),extr(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIY2	CMP/dCMP-type deaminase domain-containing protein	Low	9.9	1	223-265	PAPPPRMNSKQQRPQVNQNPPAKSRPAEKEKPKEKLRPAGPRV	cyto(11),cyto_nucl(11),nucl(7),cysk(4),mito(3)	PAKSRPAEKEKPKEKLRPAGPRVEKP (243-268, prob:0.968)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJF9	Uncharacterized protein	Low	9.8	1	807-831	TNIFKERSKTSSKKKDKEDAKENIV	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL68	Palmitoyltransferase	Low	7	2	442-466, 649-668	TICMIRKPLRSKHCRRCGRCVARED, SKDGNKTKSPARKTNPFSRG	plas(25)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT29	Aldehyde dehydrogenase	Low	5	1	462-483	YPPYTDKKLKQFRSMNEKKPGF	cyto(12.5),pero(8),cyto_nucl(7),cysk(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZF2	Glycoside hydrolase family 2 protein	Low	5	1	44-66	GIHPWPQHPRPKLVRPQWQSLNG	extr(22),cyto(2.5),cyto_nucl(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y5	Uncharacterized protein	Low	5	1	284-303	TAYADKAKRHEHHRHGHAHR	extr(26)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q588	MFS domain-containing protein	Low	5	1	531-553	KHGFGVKYARQLRKDRKEEIEER	plas(27)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCH4	Uncharacterized protein (Fragment)	Low	7.4	1	3-24	GPWNQGTSRKLRKTRSACPLSI	mito(19),nucl(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFF5	PlsC domain-containing protein	Low	6.1	1	107-128	EGEGNRTRREQRRKEIEAQLLE	plas(14),cyto(4),nucl(3),cyto_mito(3),mito(2),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGG9	Uncharacterized protein	Low	5	1	10-30	RCLARPVTHKHSKICRNPITT	mito(23),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI33	Uncharacterized protein	Low	9	1	3-24	PSSPNSPKSRLGRLFRRRGPSD	nucl(15),cyto_nucl(10.5),mito(8),cyto(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRA9	Uncharacterized protein	Low	5	1	127-147	LGPGGKPLPKKHNNNGSPKEP	plas(20),mito(3),E.R.(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTF1	HEME_HALOPEROXIDASE domain-containing protein	Low	5	1	419-438	GYEKAPFLRRRSVRRNGEIE	extr(25)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZH4	Uncharacterized protein	Low	9.5	1	240-260	AYDAAKRKTKANKQRKHQETL	cysk(10),cyto(8),cyto_nucl(7.5),nucl(5),pero(3)	KRKTKANKQR (245-254, prob:0.68)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0L1	Phospholipase	Low	6.3	1	93-115	SPELYLRRPPAKNKQYRLDKLLF	cyto(11.5),cyto_pero(10.166),cyto_nucl(9.833),pero(7.5),nucl(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2K2	Uncharacterized protein	Low	6.5	1	49-68	EMHLRCRNSHQQHVWRRPIH	mito(7.5),cyto_mito(6.833),extr(6),cyto_nucl(5.833),nucl(5.5),cyto(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIP1	Uncharacterized protein	Low	5.8	1	142-163	IQGWHWQKTKKKDKTETERIYD	mito(16),cyto(7),nucl(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNK4	Uncharacterized protein	Low	6.3	1	465-489	ETEKVFLSRQRRRRHKAVIYTRALE	extr(8),E.R.(5),nucl(4),mito(3),cyto_nucl(3),cyto(2),pero(2),golg(2),cyto_pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XI10	HET domain-containing protein	Low	8.6	1	134-154	WWEPRKWKVWKSRYTKHDHNE	cyto(11),nucl(9),mito(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y227	Uncharacterized protein	Low	7	2	839-863, 902-923	TAQQAIQHKIKHKRRMPPDSAIRFV, RAPEYDRPPEHERRRNRGPGAA	plas(22),E.R.(2),vacu(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMF2	AD domain-containing protein	Low	9.7	1	208-227	IVEGEKRKLREKEDKERKAA	cyto_nucl(11.5),mito(10),cyto(9.5),nucl(6.5)	KKIVEGEKRKLREKEDKERKAATPTGTRKGG (206-236, prob:0.941)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ29	Uncharacterized protein	Low	5	1	22-42	QDDQRNRSRNPLDRRRPPISS	plas(24),mito(1),E.R.(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2B3	Uncharacterized protein	Low	6.6	1	381-403	SQKASNWKPTNNKNKQVKETCFF	mito(21),nucl(4.5),cyto_nucl(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2D4	Uncharacterized protein	Low	8.7	1	296-321	SLPIRRPTRAYRSQRRRPLRRFVGDS	cyto(15),cysk(7),nucl(2),mito(2),mito_nucl(2)	RPTRAYRSQRRRP (301-313, prob:0.69)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3T1	Leucyl-tRNA synthetase	Low	6.3	1	991-1014	AQLKKMQKGKQTSYDPKKDKKLTV	cyto(16),cyto_nucl(11.666),cyto_mito(9.166),nucl(6),mito_nucl(4.166)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFY2	Uncharacterized protein	Low	8.5	1	179-198	ERSTCPKQCLREQSKRRGTA	nucl(13),cyto_nucl(10.5),cyto(6),mito(4),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHR2	Uncharacterized protein	Low	5.7	1	328-348	YNFWRSKQSQRVKNPEKNKIL	cyto(13.5),cyto_nucl(8.5),pero(7),nucl(2.5),vacu(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMA5	Uncharacterized protein	Low	6.9	1	197-222	AKNDHDHKSGQRRQRRRVQGPRETGL	mito(15.5),cyto_mito(10.333),nucl(7.5),cyto_nucl(6.333)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ41	Probable endonuclease LCL3	Low	6.4	1	715-734	DGVWYRARVRRNDREKKTSE	cyto_nucl(11.166),cyto(11),cyto_mito(9.832),mito_nucl(8.332),nucl(8),mito(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT58	Uncharacterized protein	Low	9.1	1	232-258	VMTVAKRRTHIPQKVRRIRSEQRRIDD	nucl(15.5),cyto_nucl(11.5),cyto(6.5),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV06	Uncharacterized protein	Low	7.6	1	4-24	GINHIKKWYRKISRNAPPAQP	mito(16),nucl(9),cyto_mito(9)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0U4	Uncharacterized protein	Low	6.3	1	378-399	AWYCRNPRTRRRCIALIRRINM	cyto(9.5),cyto_nucl(7.5),mito(6),nucl(4.5),plas(3),pero(2),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBF4	Non-specific serine/threonine protein kinase	Low	5	1	52-71	NTTFPCPKVHRIHRYRGKLA	mito(12),cyto(6.5),extr(6),cyto_nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI16	RRM domain-containing protein	Low	7.5	1	321-360	NVAPIVKKDHHNKHKGKNNNHYKNKDIKQHQKDPLKANTG	mito(15.5),cyto_mito(8.5),nucl(8)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKE7	Glycoside hydrolase family 16 protein	Low	8	1	436-457	AETRDRHARHLKAHTRHGKGRL	extr(26)	RHGK (451-454, prob:0.611)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3C4	Uncharacterized protein	Low	9.5	1	472-499	DPRSRSSSIESRRKLQKKRRPSEESQAG	extr(14),nucl(4),mito(3),plas(2),pero(2),cyto_mito(2)	RRKLQKKRRP (483-492, prob:0.815)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y098	Uncharacterized protein	Low	5.9	1	42-63	PDSTLPRSRVRRPRSVAQRILA	mito(11),cyto_mito(7.833),mito_nucl(7.833),nucl(3.5),cyto(3.5),vacu(3),extr(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIX4	Uncharacterized protein	Low	6.1	1	50-74	ALGAKSPKSSRWPRTRRQEYLDYQF	plas(17),E.R.(4),nucl(3),mito(1),cyto(1),vacu(1),cyto_mito(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLM0	NMO domain-containing protein	Low	5	1	50-72	SPDDLRKEIRKCKKMTNKPFGVN	cyto(12.5),pero(9),cyto_nucl(7),mito(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCR0	Ubiquitin carboxyl-terminal hydrolase	Low	8.4	1	101-122	FEEIRDTKSKKRKQSDSLSESD	nucl(12),cyto(11),mito_nucl(8),mito(2),golg(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD10	Uncharacterized protein	Low	7.9	1	194-216	AMFYVARRYRRKRSSHQRTSSVP	nucl(8),extr(8),mito(4),cyto(4),cyto_mito(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP74	UDP-N-acetylglucosamine transferase subunit ALG14	Low	8.4	1	25-52	LSTILSPDRPHPRRRRRENVKVPRHLLI	plas(16),mito(4),cyto(2),extr(2),nucl(1),pero(1),E.R.(1)	PHPRRRRRE (34-42, prob:0.8)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPB1	Uncharacterized protein	Low	6.8	1	1-21	MKRRNQMKKGSRNQQRSDISK	mito(9),nucl(5),cyto(5),cyto_nucl(5),plas(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTK8	Uncharacterized protein	Low	5.4	1	8-34	RVLTRCLQRVPRRRVVPQLQCLHQRRR	mito(22),cyto(2),nucl(1),plas(1),E.R.(1),cyto_pero(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0X3	Peptidase A1 domain-containing protein	Low	5	1	42-64	ISNPLEHDRKRWLRKRDDTINVA	extr(24),mito(1),plas(1),E.R.(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XZI8	Uncharacterized protein	Low	8.7	1	188-213	GLTGNARKNKKKAIKAKESRATGRRE	cyto(15.5),cyto_nucl(9.5),mito(7),nucl(2.5)	ARKNKKKAIKAKESRATGRRE (193-213, prob:0.976)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJT7	Gamma-glutamylcyclotransferase	Low	7.4	1	349-370	QSNGRRGRTMTRQRYRDSRQDV	mito(7),nucl(6),cyto(6),cyto_nucl(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLF3	Uncharacterized protein	Low	7.3	1	555-580	AFVRDIGDHKQRNRRIRKVSLWATQV	plas(8),nucl(6),mito(4),cyto(4),cyto_mito(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMG0	ATP-dependent DNA helicase	Low	8.6	1	35-54	YNGNAAKRMRQKEPSNNART	nucl(14),cyto_nucl(13.5),cyto(11)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR45	Palmitoyltransferase	Low	8.1	2	96-124, 234-253	APTSTPSPPFHRRRKSWARKLERCCCQTF, QPRYCKKCSNVKPDRTHHCS	plas(18),nucl(3),cyto(2),vacu(2),mito_nucl(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVD4	APH domain-containing protein	Low	7.8	1	16-39	DDWGRRVRSNEIARKPKKHDWLYW	cyto(12.5),cyto_nucl(12),nucl(10.5),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVT8	Uncharacterized protein	Low	9.2	1	290-316	ESPSKDVVPKLKKAKKSRKIGVPEEVE	plas(18),nucl(3),cyto(2),E.R.(2)	KLKKAKKSRK (299-308, prob:0.873)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXP6	Peptidase S53 domain-containing protein	Low	5	1	165-185	RELSRTKPDKLKKRHLEHMVS	mito(9),extr(7),cyto_mito(7),cyto(5),mito_nucl(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBS0	Uncharacterized protein	Low	8	1	181-205	LGGIFFWRKRKQKKASEEQRRKEIE	extr(18),mito(6),cyto(2.5)	RKRKQKKAS (188-196, prob:0.784)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE22	Zn(2)-C6 fungal-type domain-containing protein	Low	8	1	51-92	VNKAAAQHAPRIRRRNRQITSCLECRRRKLKCDKQAPCTNCT	nucl(10.5),cyto_nucl(9.5),cyto(7.5),mito(5),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF39	Uncharacterized protein	Low	8.6	1	4-26	QYCCSVTKKKDLKWLKEKYGDRL	nucl(9),cyto(8),mito_nucl(8)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS49	MFS transporter-like protein	Low	5	1	82-103	SLAKHHKRQPIAREWNPNRKRL	plas(26)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT87	Uncharacterized protein	Low	9.1	1	135-157	SKVNTKFCYRHRPDLKCRRQANE	nucl(14.5),cyto_nucl(10),mito(6),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXS5	Uncharacterized protein	Low	9.1	1	653-673	GSSPPYKKRRIHKPDDSQAVS	nucl(16),cyto_nucl(12.5),cyto(7),mito(1),plas(1),pero(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0X0	Uncharacterized protein	Low	9.4	1	24-65	EYVSSTHSPKRRRSNDGQVIPVCKPPKPSQTQRVKQPPPTSS	mito(14),nucl(11)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2Y0	Phosphodiesterase	Low	9.8	1	890-923	DERQSNPPIRHSRSRSRLRLKFWKRRRGASVEAD	cyto(9.5),cyto_nucl(8.5),nucl(6.5),mito(4),extr(3),plas(1),pero(1),E.R.(1),golg(1)	RHSRSRSRLRLKFWKRRRG (899-917, prob:0.88)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJE6	Uncharacterized protein	Low	7.2	1	4-25	SSKPCWNTFRVQKKGRHRIDIA	mito(11),cyto(7),nucl(6),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNS6	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	31-62	QQGRQRSRAACTPCRQRKRKCDGRLPCATCIR	nucl(12),cyto(6),plas(6),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI06	Zn(2)-C6 fungal-type domain-containing protein	Low	8.8	1	10-34	NHTPSCAVCQRRKVKCDRVYPCAAC	nucl(13.5),cyto_nucl(10),mito(7),cyto(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIK4	Uncharacterized protein	Low	5.9	1	31-55	ASPNVVRIKRFHRKWKNIIYSPPKL	cyto(16.5),cyto_mito(9.5),pero(6),nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJZ9	Uncharacterized protein	Low	6.2	1	304-328	ASDLSERKKLRPKVCRKPRLYSLAV	mito(12),cyto(5),nucl(3),plas(3),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNY6	Uncharacterized protein	Low	8.3	1	17-39	ADTADIKRRKLQHHQHHCHQPSG	nucl(10),cyto(10),cyto_nucl(10)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX89	Glycoside hydrolase family 61 protein	Low	5	1	416-438	VTYLLKQSWTRKDQRNHARDFEE	extr(27)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXU8	Fatty acid hydroxylase domain-containing protein	Low	6.1	1	310-331	DHDLHHRKGWRKSQNYGKQTRL	mito(15.5),cyto_mito(11),cyto(5.5),nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3E9	Uncharacterized protein	Low	7.3	1	227-246	LLSNPKRKKKEVPNVDHSKI	cyto(16),cyto_nucl(13.5),nucl(9)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4A5	Dolichol phosphate-mannose biosynthesis regulatory protein	Low	8	1	75-96	MIRSNRKKALKAKQKAQAQKAQ	plas(19),E.R.(5),golg(2)	RKKALKAKQK (80-89, prob:0.742)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0W1	MFS domain-containing protein	Low	5	1	489-511	KKENPVFTEKRHRKQNTTPDVEQ	plas(21),E.R.(3),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIS8	RING-type domain-containing protein	Low	8.8	1	603-628	YALLLLRSRIRRRRWRAPKSVVERLP	extr(11),plas(10),mito(3),nucl(2)	RIRRRRWRAP (611-620, prob:0.793)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHR3	Uncharacterized protein	Low	7.7	1	617-637	LEPDRIHKHQRRPSAMKRHST	mito(12),nucl(8.5),cyto_nucl(7),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMF3	Zn(2)-C6 fungal-type domain-containing protein	Low	8.2	1	1-28	MSSPKVSKPSRPRTPRSCVPCGRRKVGC	nucl(9),mito(8),cyto(5),plas(3),cyto_pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV90	Zn(2)-C6 fungal-type domain-containing protein	Low	8.8	1	145-165	QCIITAPSRKRQKKADSRVAE	nucl(11),plas(9),mito(3),cyto(3),cyto_mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDB2	HET domain-containing protein	Low	6.7	1	503-532	VSVKRSASPRDPPRRCPSRRSSPDRTSIRS	cyto(8.5),cyto_nucl(7.5),nucl(5.5),mito(4),plas(3),extr(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGP0	Uncharacterized protein	Low	8	1	73-100	CSRLVHRHSVEKRSKDKQRELLRRANPD	cyto_nucl(12.833),nucl(12.5),cyto(10),cyto_mito(6.999)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN75	Uncharacterized protein	Low	7.1	1	610-634	TNFNSKWMYCCRRMRPNTKFVWCDN	cyto(8.5),cyto_nucl(8.5),nucl(7.5),extr(5),mito(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTC2	Uncharacterized protein (Fragment)	Low	9.1	1	192-215	PHFLPPKQNFHPKRNQARQKLSTL	nucl(15.5),cyto_nucl(11),mito(6),cyto(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXD3	tRNA-dihydrouridine synthase 3	Low	9.8	1	362-406	DPSAKKEKTENGRKSKKQKKAERLGQKQNGTKKTKPEKSNDPNFT	cyto_nucl(9.666),nucl(9),cyto(9),cyto_mito(8.166),mito_nucl(8.166),mito(6)	KKEKTENGRKSKKQKKAERLGQKQNGTKKTKP (366-397, prob:0.989)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXR8	Nitric-oxide synthase (NADPH)	Low	9.9	1	67-89	DALSTSPRRRSPRPKVSSSTVRE	nucl(18.5),cyto_nucl(11.5),pero(4),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q258	Uncharacterized protein	Low	5	1	120-141	VDGHHPHRPHKPPHHHEPNQTV	cyto(10.5),extr(10),cyto_nucl(6),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3X2	Zn(2)-C6 fungal-type domain-containing protein	Low	8.8	1	3-32	PKSNRSRSGCLTCRQRKLKCTEERPTCAQC	nucl(10),mito(7),pero(3),cyto(2),plas(2),golg(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y3	Uncharacterized protein	Low	8	1	11-39	PQSSNAKKTSKHRKPPATPAKGNKKNKTV	mito(21.5),cyto_mito(13.333),cyto(4),cyto_nucl(3.333)	KKTSKHRKPPATPAKGNKKN (17-36, prob:0.918)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5E4	Uncharacterized protein	Low	5	1	11-30	LPQLRGRYDPRRPTSRQLLL	mito(19),cyto(4),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIZ5	Cytochrome P450 monooxygenase cypX	Low	5	1	127-150	NIFNFRDQKKHSQRRKLYAKGFTL	cyto(8.5),E.R.(6),cyto_nucl(5.5),mito(5),plas(3),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCE9	DUF2236 domain-containing protein	Low	8.8	2	46-67, 99-120	SHRSTAHRTRTQERRWTRCCDL, PALKNTRQSTWKRPQRPEDSDF	cyto_nucl(7.5),cyto(7),nucl(6),plas(6),mito(4),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGW0	Glycosyltransferase family 15 protein	Low	5	1	19-48	LAPQMWKVNSRKPRKAPKCREPPQNPSQRC	mito(20.5),mito_nucl(12),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMR8	Zn(2)-C6 fungal-type domain-containing protein	Low	8.9	1	5-40	ARNPRQGSKRAKYVDRACRQCKRRKVRCSGAEEDAC	nucl(11),plas(7),mito(4),golg(2),cyto(1),pero(1),vacu(1),cyto_pero(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP84	Defect at low temperature protein 1	Low	5	1	306-330	VDEVRKQTMARERQNRRHRNPAMLH	mito(9),plas(8),E.R.(7),cyto(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPL6	Uncharacterized protein	Low	5	1	567-587	SYLFRMIRAQHWHRRSRYKCG	extr(16),mito(3),golg(3),plas(2),cyto_mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRL0	Uncharacterized protein	Low	8	1	180-199	MGWLKVKKGRGKGKKPEYVF	mito(23.5),cyto_mito(14)	KVKKGRGKGKK (184-194, prob:0.877)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUQ0	MRP-S28 domain-containing protein (Fragment)	Low	9.1	1	38-57	SKPFEKPSHKRLPLRWRYTT	nucl(16.5),cyto_nucl(15),cyto(8.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q400	Uncharacterized protein	Low	9.9	1	536-556	ATIPHCVKYWPKDCRERSRSS	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4R0	Zn(2)-C6 fungal-type domain-containing protein	Low	6.2	1	31-77	TEKQLVRTERRQGHQRRYAPKTRTGCVTCKIRRVKCDEEKPFCRRCT	extr(7),mito(5),cyto(4),mito_nucl(4),nucl(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5B0	Amidase domain-containing protein	Low	5	1	505-531	AYQIQRLGRVRRTPRWARQRVEPRAYE	extr(16),mito(6),cyto(2.5),cyto_nucl(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLJ6	Uncharacterized protein	Low	8	1	45-73	SANAAKYKRKDQPASQRKKKAKSTFDTPD	mito(25)	KRKDQPASQRKKKAK (52-66, prob:0.801)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMS9	J domain-containing protein	Low	5.9	1	20-39	EEIKKAYRKAALKNHPDKNP	cyto(13),mito(10),cyto_nucl(9),nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJJ6	HET domain-containing protein	Low	5.4	1	94-113	ADLTKPQRSQPKENKYPVKI	cyto(16.5),cyto_nucl(9.5),mito(6),nucl(1.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE67	Uncharacterized protein	Low	9.2	1	39-62	RSDPEFRKTLKKQHKKVQKISEES	cyto(11),cyto_nucl(8.5),mito(6),nucl(4),E.R.(4)	FRKTLKKQHKKV (44-55, prob:0.756)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF47	KOW domain-containing protein	Low	8.5	1	5-24	NTNLSSSRRKSRKAHFSAPS	mito(14),nucl(11.5),cyto_nucl(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJT8	Protein phosphatase	Low	5.5	1	45-64	SSTVISSKKRERSRDPQAGL	mito(19),cyto_mito(12.5),cyto(4),nucl(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLN9	Fanconi-associated nuclease	Low	8.9	1	18-38	GEEFHTPPSKRQKRDITDFAA	nucl(13.5),cyto_nucl(10),mito(6),cyto(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNF0	Zn(2)-C6 fungal-type domain-containing protein	Low	7.6	1	5-28	VPAACQFCRSKRTKCNGEQPCAAC	mito(16),nucl(9),cyto_mito(9)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP25	RING-type domain-containing protein	Low	8.5	1	911-936	ATRPRRAANCPVCRKQIRQKVKVIRA	nucl(12.5),cyto_nucl(10),mito(7),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRH8	L-type lectin-like domain-containing protein	Low	8	1	265-287	AAGSKDYSRKKGRPQKARTSGGW	extr(17),mito(6),E.R.(2)	KKGRP (274-278, prob:0.665)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY78	Uncharacterized protein	Low	5.7	1	19-44	NDEPEKAQKSRRPPNNAFRQQRLKAW	plas(22),nucl(2),cyto(2),cyto_nucl(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYK6	Uncharacterized protein	Low	8	1	86-106	ASTPASKGKKRGKKTGHDEEV	cyto(7.5),mito(7),extr(7),cyto_nucl(4.5),E.R.(3)	KKTKSAASTPASKGKKRGKKT (80-100, prob:0.959)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYL8	Uncharacterized protein	Low	9.5	1	31-57	YTALQRSNSSLKRRPRKAIQASIERVL	cyto(18.5),cyto_nucl(12.5),nucl(5.5)	AKKRKPNGESLPKRLKR (113-129, prob:0.87)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCF8	PDCD2_C domain-containing protein	Low	9.4	1	17-46	GHERRLYIWACKRKTCRRKDGSLRGFRATR	nucl(17.5),cyto_nucl(13.5),cyto(8.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCY0	F-box domain-containing protein	Low	7.6	1	52-74	LVWRRHCMHTWRHWHRRHDIAEK	nucl(9),cysk(9),cyto_nucl(8),cyto(5),mito(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLG2	Protein arginine methyltransferase NDUFAF7	Low	7.3	1	84-105	SDQLRLRRERPRRVKMLLRDFI	mito(14),nucl(7.5),cyto_nucl(6.5),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNI8	S5A_REDUCTASE domain-containing protein	Low	5	1	202-223	ADRQKSQWMKEKKEKKHSEDFL	plas(17),mito(5),extr(2),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNS1	NmrA domain-containing protein	Low	8.3	1	30-49	VTVLKRKSSKSTSKYPKQVL	nucl(14.5),cyto_nucl(13.333),cyto(9),cyto_mito(6.499)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPU2	Carboxypeptidase	Low	8	1	533-556	IAWGIFIWRGRRRRRGYRGLVGSD	plas(14),extr(7),mito(2),golg(2)	RRRRR (543-547, prob:0.683)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV44	Phospholipid-transporting ATPase	Low	8.4	1	694-718	LMHEKRQPSKGKRPAWRPRRSPSNF	plas(23),nucl(1),cyto(1),cyto_nucl(1),E.R.(1),golg(1)	KRQPSKGKRPAWRPRR (698-713, prob:0.898)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEJ3	MFS domain-containing protein	Low	5	1	14-37	ESYSDSKLKHTKHPRRPSIEELDA	plas(26)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRN7	Glycoside hydrolase family 17 protein	Low	9.8	1	213-234	SATADAAKRKKRKRWLIGAIVL	plas(10),nucl(5.5),cyto_nucl(3.5),mito(3),golg(2),extr(2),pero(1),E.R.(1),cysk(1),vacu(1)	KRKKRKR (220-226, prob:0.89)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PST5	Uncharacterized protein	Low	7.3	1	345-367	DGQSAPKPAKPQKKARIQPQSMY	cyto(8.5),cyto_nucl(8.5),nucl(7.5),mito(4),plas(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUX7	Uncharacterized protein	Low	5	1	298-318	LNFNKGLKPHIQRRKVPNAGE	plas(19),E.R.(5),mito(1),golg(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXE7	Glycoside hydrolase family 35 protein	Low	5	1	1-24	MDPRRIPHEYWRDRRKKARAVGLT	mito(18.5),cyto_mito(13),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZZ1	Uncharacterized protein	Low	9.9	1	128-157	VESRVDKKKLEKAERKLRAKQDKKEFKTVE	cyto(17.5),cyto_nucl(14),nucl(7.5)	RVDKKKLEKAERKLRAKQDKK (131-151, prob:0.926)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKR4	Rab-GAP TBC domain-containing protein	Low	7.6	1	79-98	QPPASRPTLRRPPPRSVTTN	nucl(8.5),cyto_nucl(8.5),cyto(7.5),mito(4),plas(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCG2	Uncharacterized protein	Low	8.1	1	352-371	LKACEEKRDREQKENKRLSR	nucl(14.5),mito_nucl(11.166),cyto_nucl(10.333),mito(6.5),cyto(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEW2	Uncharacterized protein	Low	7.7	1	232-252	SLRKGTRKLPRTMSHKIRRHY	nucl(9.5),cyto(8),mito_nucl(8),mito(5.5),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGR9	Uncharacterized protein	Low	8.9	1	200-220	KEEWQKEKKDYDKLNKGKKNS	nucl(14),cyto_nucl(10),mito(4),cyto(4),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHZ7	ATP-dependent DNA helicase CHL1	Low	9.5	1	116-138	RQANDKPVFKRQRRSADVKCNTG	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMD2	Uncharacterized protein	Low	8.4	1	119-143	GAMPRRSSRRPSQRVTPIRKQSTSR	nucl(15.5),cyto_nucl(14.333),cyto(10),cyto_mito(5.999)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVS1	DUF2235 domain-containing protein	Low	5	1	434-453	IDPKWAKAAKWVKKDTKTYI	extr(11),cyto(6),mito(5),cyto_nucl(5),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWF6	Protein kinase domain-containing protein	Low	6.9	1	3-22	ADQFKARTMKRKNVKGLALS	mito(16),cyto(6),nucl(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWH5	Uncharacterized protein	Low	8	1	349-369	STKFSVAKRRRPRQSERPSSS	extr(11),nucl(8),cyto(5),mito(1),plas(1),pero(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q534	Uncharacterized protein	Low	9.8	1	252-273	NSENHRAVWKKKPKELPKDDDA	nucl(19),cyto_nucl(14),cyto(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDF1	Uncharacterized protein	Low	8	1	202-226	AIQLALSHRRKERRKRSFFRRFASH	mito(18),cyto(5),pero(2)	RRKERRKRSFFRR (210-222, prob:0.899)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEJ2	Uncharacterized protein	Low	6.5	1	196-215	DDARRKAKYQAKKECKQNTE	cyto(11),cyto_nucl(10.333),cyto_mito(8.499),nucl(6.5),mito(4.5),extr(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG00	Uncharacterized protein	Low	7.4	1	144-166	MAPWTGKDRRRERTKVCTQDMRV	nucl(7.5),mito(7),cyto_nucl(6.5),cyto(4.5),extr(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG21	USP domain-containing protein	Low	8.6	1	962-988	IMERRRLCWQWRRRLQTLKKERRAILE	nucl(15),cyto_nucl(13.333),cyto(7.5),cyto_mito(5.832)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH49	Uncharacterized protein	Low	9.5	1	157-182	DGSNSSEQSHQRRRSRPRIHKDGLAP	nucl(15.5),cyto_nucl(10.5),cyto(4.5),mito(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI25	Actin-related protein 8	Low	9.2	1	181-201	ATEFKQYRRANKRRVLPNSRE	nucl(15.5),cyto_nucl(10.5),cyto(4.5),mito(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKB3	Uncharacterized protein	Low	7	1	125-144	VEPPQPKKKQEPKRATTWSH	cyto(13),nucl(5),mito(4),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNN7	O-acyltransferase	Low	5	1	32-59	LPVGSKVQRKEQQPKETRASKRYKHIFA	plas(26)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ45	Uncharacterized protein	Low	6.5	1	163-186	SLQRWQGKCRAKLDREKEHGRNGS	cyto(20.5),cyto_nucl(15),nucl(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQQ6	MYND-type zinc finger protein samB	Low	5.9	1	202-226	GEGRYCSKECQKREWKVHKSSCKKP	mito(12.5),cyto_mito(9.333),cyto(5),pero(5),cyto_nucl(4.833),nucl(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUM2	Uncharacterized protein	Low	7	1	120-142	WMGSSTRRKPTKQPQRRAHTLAA	mito(17.5),cyto_mito(10.5),nucl(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX80	40S ribosomal protein S25	Low	9.5	1	1-29	MAPAATGGKKQKKKWSKGKVKDKANHAVV	cyto(14),mito(8),nucl(4)	GKKQKKKWSKGKVKDK (8-23, prob:0.952)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXN3	Uncharacterized protein	Low	7.8	2	73-92, 100-121	DPRRWPPSSKIDRQAYRRRQ, SIPSRHYAKPRSRRQSHSRMDS	plas(20),extr(3),nucl(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYF9	Cytochrome c oxidase assembly-like protein	Low	6.4	1	20-44	MCSSCTQTNRSMRWRKQFSRSLQTS	mito(20),nucl(4),cyto(1),plas(1),pero(1),cyto_pero(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ15	Uncharacterized protein	Low	8	1	150-170	EVRGKHHKRIRRRQDLVVEDR	mito(27)	GKHHKRIRR (153-161, prob:0.721)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ35	tRNA dimethylallyltransferase	Low	5	1	417-438	QWQAHTRSKAHKKLNAKLHQAE	mito(21.5),cyto_mito(13.5),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Z6	Sterol regulatory element-binding protein cleavage-activating protein	Low	5	1	999-1025	RQQPSMPELRQRRHARRNTQAQRENVS	plas(19),E.R.(5),extr(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q502	Arf-GAP domain-containing protein	Low	8	1	23-49	KLEANKTCSDCKRNKHPRWASWNLGVF	mito(10),nucl(9.5),cyto_nucl(6.5),extr(3),cyto(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q556	Calcium-transporting ATPase	Low	5.7	1	1303-1325	SPAPPTPDSRRRGRSRSNSALAG	plas(22),nucl(2),E.R.(1),golg(1),vacu(1),mito_nucl(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0G5	WD_REPEATS_REGION domain-containing protein	Low	5	1	495-520	YLQREQKRLTGKTKQQPSRHAKDNAS	extr(12),cyto(9),cyto_mito(6.833),cyto_nucl(6.333),mito(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0U0	Zn(2)-C6 fungal-type domain-containing protein	Low	7	1	5-37	APRLSHKKTRTGCIRCKARKVKCDEARPKCGAC	mito(17.5),cyto_mito(10.5),nucl(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDD8	SF3b1 domain-containing protein	Low	9.9	1	195-218	EEMNGDEKPKRVRKRRWDTSTGDA	plas(15),nucl(5.5),cyto_nucl(5),cyto(3.5)	PKRVRKR (203-209, prob:0.726)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDS9	MFS domain-containing protein	Low	8	1	493-518	IYIGGKPKSRLLKRARRNTFLARKRA	plas(14),E.R.(5),mito(4),vacu(2),cyto_mito(2),mito_nucl(2)	KPKSRLLKRARRNTFLARKRA (498-518, prob:0.909)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHJ3	Lipocalin-like domain-containing protein	Low	7	1	13-36	QVPKTLPGRRSKSQSRSRTRESSP	mito(20),nucl(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ60	alpha-1,2-Mannosidase	Low	7	1	1-27	MSKGWTRSRGPKFRWRNVPQQHPLQEY	mito(11.5),cyto_mito(9.5),nucl(7),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1G4	Uncharacterized protein	Low	9.9	1	123-147	ARSILLRRTRRVNKYFKRDRNELCV	nucl(18.5),cyto_nucl(11.5),pero(4),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJW1	Uncharacterized protein	Low	5	1	136-155	KSDEDRRKYRGKNKIPMETF	plas(14),cyto(3.5),mito(3),cyto_nucl(3),golg(3),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKI8	Zn(2)-C6 fungal-type domain-containing protein	Low	9	1	17-49	SKMHRRSRSGCFTCRLRRKKCEEGKPACKACKH	nucl(10),plas(8),mito(5),cyto(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YPR1	Ras modification protein ERF4	Low	8.4	1	61-81	PDNRRASQKSIRSNKSKKSFA	nucl(12),cyto_nucl(10.5),cyto(7),mito(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHF9	Uncharacterized protein	Low	8	1	461-488	TEDLKRLQWTKKQRLRKGRAINAQREEY	plas(27)	RLRKG (474-478, prob:0.637)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHI5	DAO domain-containing protein	Low	5.8	1	408-430	GATLRGRWSWPKRRLHDHVWTND	cyto(6),extr(5),mito(3),plas(3),pero(3),E.R.(3),nucl(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLP2	Uncharacterized protein (Fragment)	Low	5	1	74-93	KDYTRFKSRKRANCDRISRR	cyto(9.5),cyto_mito(8.5),extr(8),mito(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPA4	Uncharacterized protein	Low	9.3	1	25-44	ESPSPPSPRKRLVRNFSYPS	nucl(16),cyto_nucl(13),cyto(8)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX52	Uncharacterized protein	Low	8	1	574-596	VPLYWWRVGGRRKHGRRAEEEEG	plas(26)	GRRKHGRRAEEEEGWWKFWKRWGRK (583-607, prob:0.849)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZQ1	Uncharacterized protein	Low	5	1	4-23	ADSKLPKGPKWPTHNAPRVW	mito(18.5),cyto_mito(13),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q386	Uncharacterized protein	Low	9.9	1	510-532	EVRAVEKRDLRKQQRAENRYQAG	nucl(17),cyto_nucl(10.5),mito(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGA9	Beta-ketoacyl-[acyl-carrier-protein] synthase I	Low	5	1	1654-1674	FQTYKQKVEARQKKAYRYFHD	cyto(11.5),cysk(9),cyto_nucl(6.5),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIG2	Zn(2)-C6 fungal-type domain-containing protein	Low	7.8	1	23-53	RTGCIPCRDRHVRCDERKPICKRCDRSSTDC	mito(16),nucl(7),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLN7	Ubiquitin carboxyl-terminal hydrolase	Low	9.5	1	64-92	SNHPLAVNIKRTRKRKQRDENEPPNKINK	cyto(16.5),cyto_nucl(11.5),nucl(5.5),pero(4)	RTRKRKQ (74-80, prob:0.722)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPG1	Fe-S cluster assembly protein DRE2	Low	5.8	1	270-292	VIPEACKPNTKRRRACKDCSCGL	cyto(12.5),cyto_nucl(8),mito(5),extr(3),nucl(2.5),vacu(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQC8	Abhydro_lipase domain-containing protein	Low	5	1	54-78	FNGLSSPYSRRARNRKKAVSSPIAQ	extr(8),plas(7),E.R.(5),mito(3),cyto(3),cyto_mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSS8	Uncharacterized protein	Low	7.7	1	77-96	FLYRTWKTFGRKRKPGSAEF	cyto(13),nucl(7),mito(4),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUV7	Uncharacterized protein	Low	8.4	1	2-22	ATSSSHIRKRQYQPSTQTRLS	mito(14),nucl(10.5),cyto_nucl(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ22	Uncharacterized protein	Low	5	1	45-67	ASLSRPSSAAKRKKTAKDQAEDE	plas(22),E.R.(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1X3	Uncharacterized protein	Low	7	1	254-281	APVSKITKPKSAKVPKDCRKDVLRRQLV	nucl(7),cyto(7),cyto_nucl(7),pero(7),cyto_pero(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKD3	Diacylglycerol O-acyltransferase	Low	7.8	2	2-26, 169-190	IANHRPAVPRKSSKRSLTPPHSPTP, DDTPRSPTRRAHKRGSSRNLQL	mito(9),plas(9),cyto(3),nucl(2),cyto_pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YK28	Uncharacterized protein	Low	5	1	43-62	ADRVKSTRYKPERPRTFDRS	extr(13),mito(5),cyto(5),cyto_mito(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG33	Uncharacterized protein	Low	5.7	1	17-38	YIIRRRTCSKLHQQFPRHNWHN	mito(18),nucl(2),cyto(2),plas(2),cyto_nucl(2),pero(2),cyto_pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG84	MYND-type zinc finger protein samB	Low	5.8	1	181-200	ECQTKDWKNHKVSKEHKGST	mito(16.5),cyto_mito(11.5),cyto(5.5),nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG86	Uncharacterized protein	Low	9.1	1	1-24	MDDIRRPKVTKRERKLQISYQLEH	nucl(14),cyto_nucl(10.5),mito(5),cyto(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQF0	Uncharacterized protein	Low	7.3	1	131-150	FPSAKRCKRSPNSSIKQILR	mito(8),cyto(8),cyto_mito(8),nucl(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q208	26S proteasome regulatory subunit RPN2	Low	6.9	1	942-963	STTAQAKRRRLAKDRQNRRESM	cyto(14),cyto_nucl(11.5),nucl(7),cysk(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XL53	Glycogen [starch] synthase	Low	6.5	1	558-582	FMFQYTQKSRRQRINQRNRTERLSD	mito(10),cyto(8),nucl(4),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN67	25S rRNA adenine-N(1) methyltransferase	Low	7	1	1-26	MGSRSRTWKKPSLKYGRPPTAQRLKA	mito(17),nucl(5),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJV4	Uncharacterized protein	Low	8.6	1	27-52	RASTTSQTRSSRKRPAPGVKFRNEDD	plas(16),nucl(9)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL05	HEME_HALOPEROXIDASE domain-containing protein	Low	7.7	1	194-217	TVQTLAKSYNRRRRERKADGGIAL	cyto(12),cyto_nucl(12),nucl(10),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVB5	Uncharacterized protein	Low	8	1	97-125	REEHGGSRRRSSRRNSRRGRRGDGAEQRV	plas(15),E.R.(4),mito(3),extr(2),vacu(2)	GGSRRRSSRRNSRRGRRG (101-118, prob:0.946)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVG8	Uncharacterized protein	Low	8	1	354-373	RKAAADRKAKEKKAYAKAFA	cyto(21),mito(4)	AADRKAKEKKA (357-367, prob:0.774)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX13	Uncharacterized protein	Low	9	1	915-945	VQKTTKAKAAKAKKPKTTKSKTAKPSKATAD	mito(12.5),cyto_mito(11.333),mito_nucl(9.166),cyto(8),nucl(4.5)	KAKAAKAKKPKTTKSKTAKPSK (920-941, prob:0.972)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXJ3	STAS domain-containing protein	Low	5	1	871-893	GFDPDHPLPNRRKSRTQSGHDFE	plas(26)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZD0	Uncharacterized protein	Low	7.6	1	81-105	EVSACRQRFRKSCPKKPQNECKLLL	mito(13.5),nucl(9),cyto_mito(9),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0A4	Sterol reductase-like protein	Low	5	1	474-497	REMRDDQKCRRKYGKDWEKYCEKV	plas(23),E.R.(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q163	TLC domain-containing protein	Low	8	1	72-93	RGGGKRRKAKTLFNRWKRMSLK	plas(25)	IRGGGKRRKAKTLFNR (71-86, prob:0.908)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q317	Zn(2)-C6 fungal-type domain-containing protein	Low	9.7	1	45-70	YVSIACNECKRRKIKCNGQTPCQRCG	nucl(17),cyto_nucl(11.5),cyto(4),plas(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMJ3	Transcription elongation factor 1 homolog	Low	9.6	1	12-36	SETTMGKRKKSSRGPVKKQREVLAT	cyto(13),mito(8.5),mito_nucl(7.5),nucl(5.5)	KRKKSSRGPVKK (18-29, prob:0.82)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJH8	Uncharacterized protein	Low	9	1	8-27	KQMATIRKRARTQLRQEHPD	mito(15),nucl(10)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLJ2	Uncharacterized protein	Low	6.3	1	12-34	QQHLVPQRIRRLPQQRRLEHTMY	mito(12.5),cyto_mito(11.5),cyto(9.5),nucl(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQK0	RNase H domain-containing protein	Low	6.6	1	1-22	MSNPKRHHKRQRGDDRHAHTST	mito(11),cyto_nucl(7),nucl(5.5),cyto(5.5),pero(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSE7	EST1_DNA_bind domain-containing protein	Low	9.7	1	169-191	AGLPPKHQRRHPLDRNHLHRTNS	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWJ0	PUM-HD domain-containing protein	Low	9.8	1	12-34	EEQYTSHPRSPPQRNPNRWSASM	nucl(17.5),cyto_nucl(12.5),cyto(4.5),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ25	Uncharacterized protein	Low	7.7	1	9-28	TDWAKQKVPKAYLPRPKWKA	mito(13),nucl(7),pero(4),cyto(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZK9	Protoheme IX farnesyltransferase, mitochondrial	Low	8.4	1	16-41	LESSAIQEPPHRRRKRLKAVAVADAE	plas(20),mito(3),nucl(1),cyto(1),cyto_nucl(1),E.R.(1),vacu(1)	RRRKR (27-31, prob:0.713)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2X0	Uncharacterized protein (Fragment)	Low	7.7	1	154-174	CAGNCGSRRRTREFRRRCCHG	mito(16),nucl(7),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4K9	Uncharacterized protein	Low	5	1	34-55	QSWIPLYKKPMRTPARKLRVAC	cyto(13),cyto_pero(10.833),cyto_nucl(7.833),pero(7.5),cysk(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5B6	Uncharacterized protein	Low	8.6	1	541-562	MLQTMRKRMRKWFGWDRKSFME	nucl(12.5),cyto_nucl(8.5),mito(6),pero(4),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBM1	Uncharacterized protein (Fragment)	Low	8	1	22-49	GTFVYVRSRSLNKKRRAKKSSSGARTEV	mito(9),extr(9),cyto(3),plas(2),cyto_nucl(2),pero(2)	NKKRRAKKS (33-41, prob:0.86)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGB1	Uncharacterized protein	Low	7.7	1	157-177	IENRTEDIKKRRSKETKSGDA	cyto(12.5),nucl(9),cyto_mito(8.5),mito(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRY5	Uncharacterized protein	Low	8	1	233-261	LPMPPPQMRGGRRRSRRKTGTAPFLYRRD	mito(9),extr(8),cyto(4.5),pero(4),cyto_nucl(3.5)	RGGRRRSRRK (241-250, prob:0.836)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYU2	Uncharacterized protein	Low	5	1	1446-1467	LRDVEWRRSGRERQTYRRSEAS	plas(26)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZY0	Uncharacterized protein (Fragment)	Low	9	1	1030-1051	LAKLSMERKRSRNEENKMRMDQ	nucl(14.5),cyto_nucl(11.5),cyto(7.5),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q318	Protein kinase domain-containing protein	Low	7.2	1	11-33	AGAGTTKSRKKRMHMVVNGKIFT	nucl(10),mito_nucl(9.833),cyto_nucl(9.333),mito(8.5),cyto(7.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q372	Uncharacterized protein	Low	9.2	1	50-71	NELPARAPKKRQKHVLHVFTTK	nucl(11),cyto(9),pero(3),cysk(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4V3	Uncharacterized protein	Low	8	1	729-754	GAGTGDGGKKKQRKKRGKKKKSDREF	mito(14),plas(10),E.R.(2)	GKKKQRKKRGKKKKSDR (736-752, prob:0.999)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIB0	HET domain-containing protein (Fragment)	Low	6.7	1	5-25	NREASCRPIRRDRGEKQNYKA	mito(15),cyto_nucl(5.5),nucl(5),cyto(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKN6	Uncharacterized protein	Low	9.3	1	148-177	YCCMTRPGERVAKRRRCKSRIGASHRIDQQ	nucl(16.5),cyto_nucl(13),cyto(8.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDF3	Uncharacterized protein	Low	8.3	1	48-68	ASISTILPWRWRKRRLFAGIA	nucl(10.5),cyto_nucl(8),mito(5),cyto(4.5),plas(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP75	Peptidase A1 domain-containing protein	Low	5.9	1	8-27	VRGALKRNPAHKRNGLRSYV	extr(8),cyto(7),mito(6),cyto_nucl(6),nucl(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV93	Uncharacterized protein	Low	7	1	86-105	IKNWRRPSSRDRDKDKEQSC	mito(17),nucl(5),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIT1	Uncharacterized protein	Low	9.5	1	2-21	SSCRVERKRAHDREAQRASR	nucl(17),cyto_nucl(12),cyto(5),mito(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKY6	Pyruvate carboxylase	Low	6.9	1	970-992	PEPLRSKALRDRRKMDKRPGLYF	pero(11),cyto(8.5),cyto_nucl(8),nucl(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH11	Chloride channel protein	Low	5	1	80-103	QDAARENQRRKVRRQERADFFDAE	plas(21),mito(3),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIG1	Uncharacterized protein	Low	9.6	1	143-167	FEADEKTKEKMRRKDGNGRKFKCGV	mito(10),cyto_nucl(7.833),cyto(7.5),nucl(6),cyto_pero(5.666)	KMRRKD (152-157, prob:0.674)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRP5	MFS domain-containing protein	Low	5	1	572-592	RSVKGKQGPTKKDSNDRRSTE	plas(23),E.R.(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS85	40S ribosomal protein S24	Low	9.5	1	96-127	GQASKIEKPSRQQRKQRKNRSKESRGTAKTKG	mito(20),nucl(4),cyto(2)	IEKPSRQQRKQRKNRSKESRGTAKTKGAAKKDKK (101-134, prob:0.993)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMQ5	Uncharacterized protein	Low	5	1	36-61	LALPSQRRWVQKPPPRDRPWASRPGD	mito(25.5),cyto_mito(13.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGC9	Proteasome endopeptidase complex	Low	5	1	214-237	LMRNYKTPNTRGKKERNYRFTPGT	cyto(18),mito(8)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJL3	Protein kinase domain-containing protein	Low	5.8	1	263-282	RTIYASRKFRHPRRHAFGPP	mito(19),cyto(4),nucl(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV89	Pyr_redox_2 domain-containing protein	Low	5	1	494-513	EIKDLQKRLRRVKQMGPFEY	mito(23.5),cyto_mito(14)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVD9	Uncharacterized protein	Low	5	1	236-265	NKVIKRAIVRCTRRWRRPQQPSTPPPRANM	extr(13),E.R.(4),golg(4),plas(3),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3I9	SP-RING-type domain-containing protein	Low	9.2	1	90-112	DRLKEKDDRLKKIRDKHQPGDEE	nucl(11),mito(9),cyto(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Y9	Glycosyltransferase family 34 protein	Low	8.7	1	619-642	WISDTWNQRKKKAKAKHDQEALEA	extr(8),mito(6),cyto(3),plas(3),golg(3),nucl(2),cyto_pero(2)	KKKAKA (628-633, prob:0.694)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4R4	Uncharacterized protein	Low	7.1	1	1-28	MHTFTSNRRKSSQRNKRSRPFGKLTIDT	plas(10),nucl(6),mito(6),mito_nucl(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4V2	AP-1 complex subunit gamma	Low	9.7	1	605-626	GEATKKRHSKLPAKKKPSQIAE	mito(16),cyto_nucl(6),nucl(5.5),cyto(5.5)	KKRHSKLPAKKK (609-620, prob:0.854)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Z7	Aspartate--tRNA ligase	Low	9.3	1	112-137	GEPMSRNQQRKHERQAEKEKHRQEVE	mito(17.5),cyto_mito(11.5),nucl(5),cyto(4.5)	RKRK (144-147, prob:0.632)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y332	Uncharacterized protein	Low	6.9	1	55-80	LLPGPVTKENRPRPSCRRQTAMRVLL	mito(9),nucl(5),plas(4),golg(3),cyto(2),pero(2),cyto_pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNC1	Uncharacterized protein	Low	5	1	319-338	GEVRRQRERRREHRESNIAR	plas(24),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCI0	DUF1767 domain-containing protein	Low	5	1	210-235	KIDAWDKQWKEDRKRVLKEKAGWTEN	cysk(19),cyto(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCL2	Uncharacterized protein	Low	5	1	536-558	IYACTKVYYIQRNRKRDRVWSSM	plas(21),mito(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKW3	PlsC domain-containing protein	Low	5	1	653-676	GGDLRKIKNQPAKQKVLQRRPSEA	mito(23),cyto_mito(13)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV19	Translation factor GUF1, mitochondrial	Low	8.8	1	623-647	AADVSRRRKLLEKQKEGRRKLRAVG	mito(20),cyto(4),nucl(2)	SRRRKLLEKQKEGRRKLR (627-644, prob:0.887)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZN7	Uncharacterized protein	Low	7.8	1	220-246	HNNHKLPFPPARRPNPRPPHNTMQSVR	nucl(10),cyto_nucl(10),mito(8),cyto(8)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3K4	Uncharacterized protein	Low	6.9	1	1505-1524	IGKVRRGRVKKVPYSYREDM	cyto(9.5),cyto_nucl(8.5),mito(7),nucl(6.5),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4A3	G protein alpha-like subunit	Low	7.5	1	13-32	DPEAKKSKEIEKQLREDQKR	cyto(10.5),cyto_nucl(10.5),nucl(9.5),mito(3),pero(1),E.R.(1),golg(1),cysk(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT28	Ferrochelatase	Low	6.1	1	61-80	YLGPLISRRRTPKIKKQYAD	mito(13.5),cyto_mito(10),cyto(5.5),nucl(4),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1A0	MAP kinase kinase kinase	Low	8.7	1	181-205	LNTSTRPRNTSTHRRRNPNAEYRAQ	mito(13),nucl(10),cyto(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q221	RING-CH-type domain-containing protein	Low	6.2	1	44-68	PAPEGPQPKRRRTHYPPRKCRICLE	plas(12),mito(5),cyto(4.5),cyto_nucl(4.5),nucl(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q539	SIS domain-containing protein	Low	5.7	1	1-21	MTSPRPTKRRRCSGYISPPLT	mito(13),cyto(7),nucl(2),plas(2),pero(1),E.R.(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2H4	Uncharacterized protein	Low	9.8	1	397-418	GMSFRPKSAVKRVRRRTGEVAA	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIZ3	Uncharacterized protein	Low	6.2	1	18-44	KVFVEKRTGKTPPKSSKKQRLLDTLDG	cyto(9),cyto_nucl(7.5),mito(7),pero(5),nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKV3	Uncharacterized protein	Low	6.3	1	222-241	DGNLCTKPSRRKSRTSSLSE	cyto(8.5),mito(7),cyto_nucl(7),nucl(4.5),extr(2),golg(1),E.R.(1),pero(1),plas(1),cysk(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNI5	Uncharacterized protein	Low	6.1	1	125-146	EIQTQLKQRKPRRHLSKSNIED	mito(11),cyto(9.5),cyto_nucl(7),nucl(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYP7	Xanthine dehydrogenase	Low	5.8	1	258-277	LAFGNKRKRWYRPVTLQQLL	cyto(19),cyto_nucl(12),nucl(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZF1	Aminotran_1_2 domain-containing protein	Low	6.5	1	64-83	ECNQYSPTKGRPRLKKAIAD	cyto(15),mito(5),nucl(4),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q214	Uncharacterized protein	Low	5	1	1208-1230	GMLVCCCKSRRRTNPNPASQATT	extr(20),cyto(3.5),cyto_nucl(2.5),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLG8	S5A_REDUCTASE domain-containing protein	Low	6	1	165-185	VSEQQRHNWKKRPQNRGQLYV	plas(13),mito(7),nucl(3),cyto(3),cyto_nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y231	Uncharacterized protein	Low	9.5	1	736-755	SPPSEKEKAPTRPRIRKSVV	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIA4	Thioesterase domain-containing protein	Low	9.8	1	39-61	AADHDSKKKLKRSRSSQSPSTHP	cysk(13),nucl(5),cyto(5),cyto_nucl(5)	K (47-47, prob:0.606)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM13	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	1	30-61	TTACDHCRAKKSKCDGQRPCSRCKRHGVDCIY	nucl(11.5),cyto_nucl(9),mito(6),cyto(5.5),plas(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG66	Uncharacterized protein	Low	5	1	472-495	LILTKFRKSHWHWQERRRYRPWMS	plas(26)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH23	Mitochondrial genome maintenance protein MGM101	Low	8	1	236-260	MVEHAVTKKRRKHWMRKEDELKYPL	mito(26.5),cyto_mito(14)	KKRRKH (243-248, prob:0.69)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS99	Zn(2)-C6 fungal-type domain-containing protein	Low	8.7	1	34-59	VDGCVYRQRPFKRQRRSEHESRSPPA	nucl(11),plas(10),mito(3),cyto(3),cyto_mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1M1	Amidohydro_3 domain-containing protein	Low	9.3	1	16-41	PFDQYAGTRRRGRSKRRLIRLAVAAV	cyto(9.5),cyto_nucl(8.5),mito(8),pero(5),nucl(4.5)	RRRGRSKRR (24-32, prob:0.792)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2S2	WD_REPEATS_REGION domain-containing protein	Low	9.8	1	87-111	STPTASPSRKRQKLKAGDRFIPNRN	nucl(19.5),cyto_nucl(14),cyto(7.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XZK7	Uncharacterized protein	Low	9.1	1	241-261	GQEAKTKRKEEREKRFGLSRG	mito(14),pero(6),cyto(4),nucl(3)	AKERQGRRHGGQEAKTKRKEEREKRFGLSRGRL (231-263, prob:0.974)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0U5	Uncharacterized protein	Low	6.5	1	18-42	GGQINAQQHKHKKRKEHASTGFTAA	plas(9),mito(8),cyto(5),nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCC0	Uncharacterized protein	Low	7.3	1	1-21	MYKKSRRPNGQRQRSESRWGA	mito(14),nucl(7.5),cyto_nucl(6.5),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJF2	Uncharacterized protein	Low	6.4	1	544-563	LAKAMCRTRRQPEHDVERGR	mito(9),cyto(6.5),cyto_nucl(6),nucl(4.5),plas(3),pero(1),E.R.(1),golg(1),cysk(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ19	Uncharacterized protein	Low	9.8	1	69-90	LKAVPKKKTSHMKKRHRQMAGK	mito(17.5),cyto_mito(10.5),nucl(6)	PKKKTSHMKKRHRQM (73-87, prob:0.865)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WN78	Uncharacterized protein	Low	8.8	1	144-170	YFSSTAPRSRSPRKRRRTPPSENASPS	mito(9),extr(9),nucl(2),cyto(2),plas(2),cyto_nucl(2)	RSRSPRKRRRTPPSENASPSPTPRPR (151-176, prob:0.935)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJQ0	Uncharacterized protein	Low	7.6	1	100-119	GNYALKQKWQQKKQDCDNQY	mito(8),nucl(7),extr(7),cyto(2),plas(1),pero(1),E.R.(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YK15	Glycosyltransferase family 20 protein	Low	7.3	1	20-39	ESELPSRRRSPPFQLERRGS	cyto_nucl(10.333),cyto(10),nucl(9.5),cyto_mito(6.833),pero(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLB1	Protein SSH4	Low	8.4	1	431-454	KVFDNPKKNKVSKVKQNNKRDDSM	nucl(12.5),cyto_nucl(9.5),cyto(5.5),pero(5),mito(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPB0	Plasma membrane ATPase	Low	5.4	1	64-83	KEDEAKPKKAWQFWKKSDDA	plas(22),pero(2),nucl(1),E.R.(1),golg(1),cyto_pero(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU33	Protein kinase domain-containing protein	Low	6.8	1	261-283	IMAWMKAEKAKRTKHRDESSESA	cyto_nucl(9.333),cyto(8.5),nucl(8),cyto_mito(7.166),pero(6),mito(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYD3	Glutamine amidotransferase type-2 domain-containing protein	Low	7.3	1	1627-1653	DKTKGFMKYQRRSEKYRQAKTRTRDWG	cyto(13.5),cyto_nucl(11.5),nucl(8.5),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1K4	Uncharacterized protein	Low	8.7	1	371-394	GRVRVLTKDKSQRVRKPEWTEKDL	nucl(13),cyto_nucl(10.5),cyto(6),cysk(4),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEM4	Uncharacterized protein	Low	5.5	1	1-22	MASTRWRRRWSRGKQTSYAPLR	mito(24),cyto_nucl(2),nucl(1.5),cyto(1.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHI4	S5 DRBM domain-containing protein	Low	7.5	1	150-171	ETERSYRKERTRRPTSKQDTEE	mito(13.5),cyto_mito(9.5),nucl(9),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHZ4	MYND-type zinc finger protein samB	Low	8.1	1	87-112	RVRYCSRSCQSKAWKREHKYECKVLA	cyto(10),nucl(8),cyto_pero(8)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJI0	Uncharacterized protein	Low	9.9	1	224-245	RGYSPRRDDYRRRTPPPRGYYD	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKZ1	F-box domain-containing protein	Low	6.6	1	41-60	DSVRHLRRLSRTCRRIQHLA	mito(18),nucl(4.5),cyto_nucl(4),cyto(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPZ3	MFS domain-containing protein	Low	5	1	44-63	NTQHICLKKLRRKLDWHLVP	plas(24),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV24	Photolyase/cryptochrome alpha/beta domain-containing protein	Low	8	1	11-32	VRPDPSPSKKRHIEVKREPSNG	nucl(12.5),cyto_nucl(11.833),cyto(10),cyto_mito(7.333)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI05	Uncharacterized protein	Low	8.6	1	354-376	MVGVKQRKKCDHCKKGCGPFRGC	nucl(12),mito(10.5),cyto_mito(7.5),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN53	DUF2439 domain-containing protein	Low	9.4	1	25-48	DFNCLYTHDVKKKAKKWQDGLLRY	nucl(14.5),cyto_nucl(9.5),mito(9)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNX4	AB hydrolase-1 domain-containing protein (Fragment)	Low	6.6	1	12-31	ADIHKFKRIKPDDEKENPFV	cyto(13),cyto_nucl(11.833),nucl(7.5),cyto_mito(7.499),pero(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRJ3	Uncharacterized protein	Low	6.1	1	80-104	TFPTTKECIHLRRRHRSLSKAPASR	plas(18),nucl(3),E.R.(2),vacu(2),mito_nucl(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXY8	Uncharacterized protein	Low	8.4	1	218-239	RLNDWLMKKKRRQLKEVGYELQ	nucl(12.5),cyto_nucl(10),cyto(6.5),mito(4),plas(1),pero(1),E.R.(1),golg(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4A1	Uncharacterized protein	Low	9.1	1	309-328	EERFQKFKASRKPCTVCGKH	nucl(11),mito(8),cyto_nucl(8)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLY2	Uncharacterized protein	Low	7.8	1	44-63	SDTSQHSRSCYRRRIHRAAE	mito(11.5),nucl(9),cyto_mito(8),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YK44	Uncharacterized protein	Low	8	1	31-55	IDHEIERARKRRRHSSYNPRSWSLE	plas(23),E.R.(2)	RKRR (39-42, prob:0.654)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBZ0	Glycosyltransferase family 90 protein	Low	5	1	147-170	LWDWWSVQRKTKRRRTISESDDDA	plas(23),extr(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJV2	BTB domain-containing protein	Low	9.3	1	215-242	QTTSVHKQPNFPRRRKWHKHADAAEFLQ	nucl(14.5),cyto_nucl(10),mito(5),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNQ6	Uncharacterized protein	Low	8.6	1	778-807	IQAKHAVDRERSRRHWWKKQDHKQASWMDQ	mito(13),nucl(11.5),cyto_nucl(7.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUN1	Mitochondrial distribution and morphology protein 12	Low	8.4	1	1-44	MCWTRFPQPQLPRLRRRLHLCESTPSPKPPRRHHHKLYDTTSMS	nucl(11.5),cyto_nucl(10),cyto(7.5),mito(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVC9	Helicase C-terminal domain-containing protein	Low	9	1	277-299	RKSRISTKPGFLRKKDNNKQGAI	cyto(18),cyto_nucl(11.833),cyto_mito(11.333),nucl(4.5)	KKAKQDLKRRGVESRTTRGAQKDPEAARKSRISTKPGFLRKKDNN (250-294, prob:0.88)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ63	Copper-fist domain-containing protein	Low	9.4	1	73-97	VVARSACPHKSKKGEKRSGECRCDE	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Z7	Sen15 domain-containing protein	Low	8.4	1	157-179	EEQRGEKDSKWRRNLPKRLLLAT	nucl(12.5),cyto_nucl(10),mito(8),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1V7	Uncharacterized protein	Low	8.9	1	80-100	PPDGVRPRRIPPRYTRRPTRM	nucl(13.5),cyto_nucl(9.5),mito(7),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIW9	Uncharacterized protein	Low	9.1	1	1-24	MSAGGTKKARKQKVKAQRTKGMGV	mito(20),cyto(4),nucl(3)	KKARKQKVKAQ (7-17, prob:0.776)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YID5	BTB domain-containing protein	Low	7.5	1	301-322	QKQDSNPVRKPRCHYHNHSEGD	mito(17),nucl(7),cyto(1),plas(1),pero(1),cyto_pero(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG76	tRNA 4-demethylwyosine synthase (AdoMet-dependent)	Low	9.4	1	86-109	ATISKGPRRIQGKRISRPKQEAGA	cyto(14),cyto_nucl(10.5),nucl(5),mito(4),pero(3)	PRRIQGKRISR (92-102, prob:0.674)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGT1	Uncharacterized protein	Low	9.6	1	27-46	LSKLTRYNSRTKNKGSRYYH	nucl(12),mito(7),cyto(5),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIH3	Uncharacterized protein	Low	9	1	282-304	RWEARHSDTRRERQRQEQRVSVG	mito(12),nucl(10),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMY0	Uncharacterized protein	Low	8.6	1	2-25	ASNTSTPRSRSRSKRSTTNLSDLR	mito(13),nucl(11.5),cyto_nucl(7.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNY2	Nickel/cobalt efflux system	Low	5	1	351-371	LSVLLYKPWRKRVDRNREAIV	plas(22),mito(2),pero(1),E.R.(1),vacu(1),cyto_mito(1),mito_nucl(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRX8	Uncharacterized protein	Low	8.2	1	95-114	GTFLHSARPRRQRRLTGPLD	mito(14),nucl(8),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PST4	Uncharacterized protein	Low	6.1	1	7-30	RSFCADKSRHRAPGKRQHGWLKNN	mito(19),cyto(4.5),cyto_nucl(4.5),nucl(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT01	Uncharacterized protein (Fragment)	Low	9	1	110-129	VEMPKAVIRKRKRDDQSTEK	nucl(10),cyto(9),mito(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUI8	Lysophospholipase	Low	8	1	741-774	KEQTKRTIRAVWQRKRAARLRREKEQREMQRLVK	mito(15.5),cyto_mito(10.5),extr(6),cyto(4.5)	WQRKRAARLRREKEQ (752-766, prob:0.855)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Q8	Serine/threonine-protein phosphatase 2A activator	Low	8.3	1	12-35	NLSNALPKLTPRRRPRTEEAPLNP	nucl(11),cyto_nucl(9),mito(8),cyto(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4G9	Isocitrate lyase	Low	5	1	1-23	MFRSAARVLRQRQRCLRQPVVTE	mito(24),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG04	Fatty acid hydroxylase domain-containing protein	Low	9.6	1	297-319	TESGPEAAKRRREKKMAKAKKAQ	cysk(6),cyto_mito(6),mito(5.5),cyto(5.5),nucl(5),plas(3)	AKRRREKKMAKAKKAQ (304-319, prob:0.982)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKN7	Uncharacterized protein	Low	5	1	35-55	EANGYRWRHGRRRSIVNNVLF	mito(13),plas(7),E.R.(4),cyto(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP38	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	30-63	VTAAGKKRTRTGCLNCRRKRRKCDENKPTCEGCQ	nucl(16.5),cyto_nucl(10.5),cyto(3.5),mito(3),plas(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPE4	Uncharacterized protein	Low	9.7	1	146-172	EHTRHREPERPSKRGRKLAQRKCQEPI	mito(16.5),mito_nucl(12.333),nucl(7),cyto_nucl(5.833)	TRHREPERPSKRGRKLAQR (148-166, prob:0.91)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PST1	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	Low	9.6	1	19-62	SSQLQRTGSGHRQKKPQSRQLLSCTKCRERKVKCDRTKPCSACC	nucl(12),plas(11),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTG8	TruB_N domain-containing protein	Low	9.6	1	42-75	LQREQDKRDAEKHNQKNKRKWRGRRETSVKMGHG	cyto(14.5),cyto_mito(9.833),nucl(6.5),mito_nucl(5.833),mito(4)	EKHNQKNKRKWRGRR (52-66, prob:0.904)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q437	WD_REPEATS_REGION domain-containing protein	Low	6.6	1	741-760	LDSRSCKRRKSEAADQGLKR	mito_nucl(7.666),nucl(7.5),mito(7.5),cyto_nucl(6.833),cyto_mito(6.833),cyto(5),extr(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLZ7	Zn(2)-C6 fungal-type domain-containing protein	Low	5.7	1	1-35	MPSRRPHTKTRHGCNTCKARKVRCDEEKPVCRNCT	mito(12),plas(10),nucl(2),cyto(1),pero(1),E.R.(1),cyto_pero(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCD3	Glycosyltransferase family 31 protein	Low	5	1	5-24	ASDWRNTKRRPTSQCCIVLL	extr(9),golg(6),plas(3),E.R.(3),cyto(2),vacu(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD88	Uncharacterized protein	Low	9.3	1	108-127	SSTSRPKKKLRVSTKSDSRE	nucl(15),mito(11),cyto_nucl(9)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDW8	FAD binding domain-containing protein	Low	5	1	97-116	KMCLKEYSKKWKKPWLSVHR	extr(16),mito(3),E.R.(3),plas(2),cyto_mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFM3	Uncharacterized protein	Low	6	1	9-29	LEKVGSREKRRQRGVDEGKLA	mito(20),nucl(3),cyto(3),cyto_nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK60	Uncharacterized protein	Low	8.1	1	47-73	ERYESTIQKRWLKKTKEQKRRILLASW	cyto(10),nucl(8),cysk(5),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQG5	Uncharacterized protein	Low	5	1	261-283	AIFAWRLWGKKKRERLPHDDAID	extr(27)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRP0	5_nucleotid_C domain-containing protein	Low	6.2	1	606-630	ERELRIVRKVMRRWRRSARIEGHAD	cyto(11.5),cyto_pero(9.666),cyto_nucl(9.333),pero(6.5),nucl(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q006	Uncharacterized protein	Low	5	1	16-43	ERSPTFPSYHSTRKKPRRWPLVLRFIKG	plas(23),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNH3	Cation-transporting ATPase	Low	7	2	144-164, 1341-1366	SMDSRPRKYSRKSSGYSRSSR, GKVVQRFSSTPKKRKEYKIISKEMRI	plas(23),golg(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XI40	Uncharacterized protein	Low	9.1	1	69-92	PDELKTKGERKRWREQMRARAIQA	nucl(15),cyto_nucl(12.5),cyto(6),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLK1	Uncharacterized protein	Low	5	1	5-33	EPAPPLRRLDPQTTKKKKDDDKQDIHDVF	plas(26)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBN0	DUF2415 domain-containing protein	Low	9.7	1	404-423	YIEARRRQRQHRQDLTNQRS	nucl(17.5),cyto_nucl(12),cyto(5.5),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCV2	Uncharacterized protein	Low	7.1	1	921-945	PQKKGFKAFFTRKKATQKKAWETYD	plas(11),nucl(6.5),cyto_nucl(5.5),cyto(3.5),E.R.(2),golg(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIR0	Uncharacterized protein	Low	8	1	51-72	NELPKKTPTKGPPANKPPAKKP	mito(12.5),cyto(9.5),mito_nucl(7.833),cyto_nucl(6.333),extr(3)	KKTPTKGPPANKPPAKKPAPPSTNKPAQADKS (55-86, prob:0.932)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSB6	Trehalase	Low	7.1	1	521-544	ETSSTWDRRAKKRRQQMDKLMWDE	pero(9),cyto(7),nucl(6),cyto_mito(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTL0	Uncharacterized protein	Low	8.6	1	17-37	QQNVKHNSPRIKRPVARSDTV	nucl(12.5),mito(9),cyto_nucl(9),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU43	Ubiquitin carboxyl-terminal hydrolase	Low	5	1	300-320	DAKTATKKRIEDRQKRGQGGD	cysk(12),cyto(7.5),pero(6),cyto_nucl(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXS0	Uncharacterized protein	Low	7.3	1	18-37	VSLVRMKKGKKRYEIACYKN	mito(13.5),mito_nucl(12.333),nucl(10),cyto_nucl(7.333)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3H6	Probable lysosomal cobalamin transporter	Low	8	1	287-308	ADLTRKLKRARHRKGRFQDEWT	plas(20),vacu(3),mito(2)	RKLKRARHRKG (291-301, prob:0.831)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMY9	Uncharacterized protein	Low	5.3	1	81-103	IDDGKCRRRREWRTLSKAQQQDY	plas(19),mito(4),nucl(1),cyto(1),cyto_nucl(1),pero(1),vacu(1),cyto_pero(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG43	Uncharacterized protein	Low	7.7	1	36-60	VQSTRLPTPPKSNRKRSFTRPAGIE	mito(16),nucl(8),cyto_nucl(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG65	MFS domain-containing protein	Low	8	1	80-100	ETPLAGGRRRRRRSSAQSFEL	plas(26)	RRRRRR (87-92, prob:0.701)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH75	Kinesin motor domain-containing protein	Low	7.7	1	617-637	FVYRPRTKIRRPALQSLHRPT	nucl(13),cyto_nucl(11.333),mito_nucl(9.833),cyto(8.5),mito(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ32	Zn(2)-C6 fungal-type domain-containing protein	Low	6.5	1	7-34	KTGCMTCLARKKKCDEKRPVCSHCERLG	mito(20),nucl(4),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJS1	MutS protein homolog 3	Low	5	1	21-41	SASLRTKQHVRNQVQQHPQTR	mito(23.5),cyto_mito(13.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMH7	Uncharacterized protein	Low	5.7	1	154-174	QGSSTDRQRKCQPCRRVSLVS	mito(15),extr(7),nucl(2),cyto(1),plas(1),pero(1),cyto_pero(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQS5	Uncharacterized protein	Low	9.9	1	63-88	PRPHSTQKAPSPKPRQKQRAQSTPFS	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4E2	Arginyl-tRNA--protein transferase 1	Low	7.7	1	59-80	EAEKNFPKTKEEKKRSKDSFDL	mito(13),nucl(8.5),cyto_nucl(6.5),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGW9	Uncharacterized protein	Low	8.2	1	45-64	LTRTPRRKFRICCKLQNRDT	cyto(13.5),cyto_nucl(13.5),nucl(12.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0N2	SURF1-like protein	Low	6.6	1	37-57	PPPFICTHCIRRNPRLRPSSI	mito(9),plas(9),nucl(4),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF58	Uncharacterized protein	Low	7.7	1	49-71	QMAYKLRKTTKCKRLHTVKPQAP	nucl(11),mito_nucl(9.333),cyto_nucl(8.833),mito(6.5),cyto(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF98	PepX_C domain-containing protein	Low	6.5	1	20-39	TTTLPAGHRKRPQCRPLATD	cyto(13),cyto_nucl(10),mito(6),nucl(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGJ5	Uncharacterized protein	Low	8.3	1	332-356	EFLLYHPHKARQRRKEHIKEHFDET	nucl(9),mito(9),mito_nucl(9)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHU6	Uncharacterized protein	Low	7.7	1	28-47	NSSMPSKEPKGKRSPRTLCS	nucl(8.5),cyto_nucl(7),plas(5),cyto(4.5),mito(3),E.R.(2),golg(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN57	Thioredoxin domain-containing protein	Low	8	1	10-34	ALPPLPPAKKRAPAKPKAKKDDAAQ	mito(9),cyto(9),cyto_mito(9)	RKRPAALPPLPPAKKRAPAKPKAKK (5-29, prob:0.984)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP27	Probable cytosolic iron-sulfur protein assembly protein 1	Low	8.1	1	278-297	SDDKTIRVWRRKPREKDEAP	mito(16),nucl(8),cyto(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTF7	Uncharacterized protein	Low	6.2	1	55-78	AELTLPTKKQQRPGTPKNWDKSNW	extr(9),cyto(7),cyto_nucl(6.333),cyto_mito(6.333),nucl(4.5),mito(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIJ8	PAC domain-containing protein	Low	8.4	1	586-605	LEKALKHRKNVTARVRWLNQ	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIH5	Uncharacterized protein	Low	7.8	1	204-223	EVVRRIFKLRERAKRGMRMV	cysk(12),nucl(9.5),cyto_nucl(8.5),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDK9	Uncharacterized protein	Low	9	1	173-193	ESSISKERKQWRKQEADMKDR	nucl(20),cyto_nucl(13.833),mito_nucl(11.999),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG97	Uncharacterized protein	Low	9.2	1	182-203	ISHPPRTSKYPLKKKKPPLLTS	mito(13),extr(5),cyto(4),nucl(3)	KKKK (194-197, prob:0.644)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJT3	Uncharacterized protein	Low	9.7	1	27-52	TSDWQILQSRKKRAPCKREVIRMGTE	nucl(18),cyto_nucl(13.5),cyto(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLZ0	Uncharacterized protein	Low	7.1	1	153-175	QNEDARQKTERRQIQQRIRSFCW	plas(16),nucl(6),vacu(2),mito(1),cyto(1),E.R.(1),cyto_mito(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS06	Uncharacterized protein	Low	9.6	1	109-129	KTYTRAEHLRRHQQNHKPGAY	nucl(12),cyto(6),mito(4),cyto_pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT97	Uncharacterized protein	Low	9.1	1	4-31	TQDAKPSKSSFLKKSKWGKIFKEQDTNN	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q049	Copper-fist domain-containing protein	Low	9.8	1	38-64	GRPVTQCQHCRLERKKRSAHVKCDCGE	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI51	EHN domain-containing protein	Low	6.2	1	20-41	QEEVNRLKRKLKDSRLPPKEIV	cyto(14),pero(5),nucl(3),cysk(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHQ5	Uncharacterized protein	Low	7.3	1	10-29	TKSLRKLRSLRSIKQKHESA	mito(14),nucl(7.5),cyto_nucl(6.5),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIH7	Adaptin_N domain-containing protein	Low	8.8	1	241-269	LMTTYSRKCFPRRTQRVKRATNQEQRAKD	nucl(16.5),cyto_nucl(16),cyto(10.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVE1	Uncharacterized protein	Low	6.1	1	83-105	AGGGIHHHRKHRKEETKDAPYYW	mito(9),plas(9),nucl(3),cyto(3),cyto_nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWB8	UBC core domain-containing protein	Low	7.8	1	152-181	IEAGKMWRENKKEFKRRVRRCVRDSQENAY	nucl(10.5),mito_nucl(9.5),mito(7.5),cyto(6.5),cyto_pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYU7	DAO domain-containing protein	Low	5.8	1	437-456	AYTRLFKWRDVPKGKRNGLE	extr(7),cyto(6),E.R.(4),nucl(2),plas(2),golg(2),vacu(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q026	DUF1308 domain-containing protein	Low	9.3	1	482-501	RSLVGKEKRGAPKQVREADV	nucl(16),cyto_nucl(12.5),cyto(7),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0V6	Uncharacterized protein	Low	7.5	1	1160-1187	DQSEKDINRQNKKTEERKQRGLMQWKPA	cyto_nucl(11.5),cyto(10.5),nucl(9.5),mito(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q398	Uncharacterized protein	Low	9.1	1	35-77	RDSRSPSPEKADNKRKSRSSYFAKEREKDNRQLRPKTQQRFSW	mito(17.5),cyto_mito(11.5),cyto(4.5),nucl(4)	NKRKSR (47-52, prob:0.665)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y155	Uncharacterized protein	Low	7.8	2	650-673, 706-726	RLYWSPQVKKTKKAHLFKRHDTAA, VRELNRTRKGYKKQPPVSMEH	plas(18),E.R.(3),nucl(2),vacu(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHA9	Mechanosensitive ion channel protein	Low	8	1	837-860	RGLLHRQSTRGKRKPSTEQSRPAF	plas(23),pero(2)	GKKKGHKR (354-361, prob:0.803)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP54	Uncharacterized protein	Low	8.8	1	32-51	TSTARRDMNRHVQRNSRQVA	nucl(13.5),cyto_nucl(8.5),mito(7),cyto(2.5),plas(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ62	Glycosyltransferase family 90 protein	Low	5	1	94-116	HDAARAYRTRRGRQPPPHFDLWF	extr(9),golg(6),E.R.(5),plas(4),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRJ4	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit	Low	9.9	1	170-197	LDEGKFKGRTKEKKPKENPWQKASRGKP	mito(15.5),cyto_mito(10),nucl(7),cyto(3.5)	KFKGRTKEKKPKENPWQKASRGKP (174-197, prob:0.94)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVV5	Methyltranfer_dom domain-containing protein	Low	5	1	1-29	MTAHRRFWMPWRSQKRSRTSQRIDDNDGD	mito(24.5),cyto_mito(13)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Z5	Atypical serine/threonine protein kinase BUD32	Low	6.7	1	40-68	PDTPAALKVRPKKHWRHPTLDKRLTRQRI	cysk(12),cyto(7),nucl(5),cyto_mito(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4C2	Uncharacterized protein	Low	9.3	1	115-135	VSGIIKDKYKQQRHNDDENQP	nucl(16),cyto_nucl(11.5),mito(5),cyto(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHE1	Zn(2)-C6 fungal-type domain-containing protein	Low	5	1	9-34	VVEGSCWTCKKRRLKCDLTRPICGKC	plas(16),mito(4),E.R.(3),mito_nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPJ6	Zn(2)-C6 fungal-type domain-containing protein	Low	5.8	1	48-70	NGQPPCTRCKKRGLSCTVNKSLQ	plas(13),mito(4),nucl(2),pero(2),E.R.(2),vacu(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPJ8	Uncharacterized protein	Low	9.9	1	465-485	RGPPCCRHKSAKLKARLQSSS	nucl(19),cyto_nucl(12.5),cyto(4),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRG0	RNase_PH domain-containing protein	Low	5	1	82-101	FSGMDRKRRGKNDKRVQEMQ	mito(14),cyto(11)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTC4	Uncharacterized protein	Low	5.9	1	258-279	LPEPKRQLPKQKQELNIQPPKE	mito(12),cyto(10),cyto_nucl(7.5),nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV62	Abhydrolase_3 domain-containing protein	Low	5	1	8-30	SAFKAACSRSARRRLHRLALARP	mito(24.5),cyto_mito(14)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2F8	Uncharacterized protein	Low	5	1	373-393	IEAQLSKQEKQRKMQEKKVKA	plas(20),E.R.(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5H1	Uncharacterized protein	Low	6.1	1	6-26	SIVLPARPKKQLRRLSSQDAT	mito(12),cyto_mito(12),cyto(10),nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD44	Jacalin-type lectin domain-containing protein	Low	9.9	1	6-25	KDISLRRRSKASSKNTKGDS	nucl(18.5),cyto_nucl(11.5),mito(4),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFI3	Uncharacterized protein	Low	8.2	2	67-89, 172-192	LGKREHKVFIKKSKQKRQCCSAP, KGSLRRATRRLIRLSRPQQRL	cyto_mito(7.666),mito(7.5),extr(7),cyto_nucl(6.833),cyto(6.5),nucl(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNU0	Uncharacterized protein	Low	7.8	1	331-356	EEWVKVRQSQQQRRTKAPKIEGSKYE	cyto(10.5),cyto_nucl(10.5),nucl(9.5),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQS0	Uncharacterized protein	Low	8.7	1	497-523	PVFSPLTTRHERKQREKERKAMRGAAT	extr(14),mito(4),nucl(2),cyto(2),plas(2),cyto_nucl(2),pero(2),cyto_pero(2)	KQREKERK (509-516, prob:0.662)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYA5	Uncharacterized protein	Low	8.1	1	10-31	VEDKTRQHRKIDRQHSKSVRQH	nucl(10.5),cysk(8),cyto_nucl(7.5),mito(4),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2C6	Uncharacterized protein	Low	5	1	722-741	AESTVRRHPRQRHYLHRVGP	plas(22),E.R.(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKQ7	Uncharacterized protein	Low	7.8	1	29-50	PITGRDSKPAPKKLQKRFPGED	cyto_nucl(14),nucl(11.5),cyto(9.5),mito(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y297	Uncharacterized protein	Low	5	1	17-36	FTTARRTKPGSRKSSLKDDA	mito(22),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJN8	MFS domain-containing protein	Low	8	1	469-490	MLEAENKKRRAGKRNHWLEGKT	plas(27)	KKRRAGKR (475-482, prob:0.742)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEA4	Small nuclear ribonucleoprotein Sm D1	Low	9.8	1	82-101	DDTPKPKNKARKEQDKSAGV	mito(15),cyto_nucl(7),nucl(6),cyto(6)	KPKNKARKEQDKSAGVGGPGGMRGGRGGPRGGGRGRGRGRGRGRGF (86-131, prob:0.997)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMU8	PKS_ER domain-containing protein	Low	5	1	1-23	MPDRPSRRFRPNKSPRLRSSTPT	mito(12),plas(8),cyto(2),extr(2),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPX2	Uncharacterized protein	Low	6.6	1	73-100	TDYTQRCVQCNKKRKTARQTNGCSRCHG	cyto(10.5),cyto_nucl(8.5),nucl(5.5),mito(5),pero(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZT7	Uncharacterized protein (Fragment)	Low	7.1	1	1-23	YYDCTWRRPTGKKHKTWEGDGFA	mito(13),nucl(7),cyto(7),cyto_nucl(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0S2	Translocation protein SEC62	Low	9.1	1	324-359	AWHEDEKAMKKRKKEERERKKERRALKANEEKKGKK	plas(19),nucl(3),cyto(3),cyto_nucl(3)	KAMKKRKKEERERKKERRALKANEEKKGKKGEK (330-362, prob:0.999)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q113	F-box domain-containing protein	Low	6.6	1	115-138	KSGGRTNWKKQYKLRHNWSRGSCA	mito(5),plas(5),nucl(4),extr(4),pero(3),cyto(2),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5A9	Seryl-tRNA synthetase	Low	7.4	1	12-31	GGNPEKIKESQRRRHAPVEV	cyto(13.5),cyto_nucl(11.5),nucl(8.5),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFY6	Uncharacterized protein	Low	9.6	1	256-280	AFQAERISKKQHKKMNKNRTKGYED	cyto(13.5),cyto_nucl(12.166),cyto_mito(9.999),nucl(8.5),mito_nucl(7.499)	SKKQHKKMNKNRTKGYEDYLKKLKEADKKWAEGTKDVEKVERKLGKERAKAERKMARNPEKALKEFEKEERKLLKELDKEMEKRDKESGKERREAQKERGKVEKKEEKT (263-371, prob:0.993)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNI1	Clr2_transil domain-containing protein	Low	6.9	1	122-144	SPTNPCPCHRCGKKRTKVETGVV	mito(11),cyto(6),nucl(5),extr(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXZ7	Uncharacterized protein	Low	6.3	1	51-71	DEHGRIYHRKRSKSSREHISP	mito(9),cyto(8.5),cyto_nucl(7),extr(5),nucl(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZP6	Uncharacterized protein	Low	8	1	631-666	GARGRFRRMAGEKKKVQKEERRRRVRQSRERVEVGP	mito(22),cyto(4)	KIKHGARGRFRRMAGEKKKVQKEERRRRVRQSRER (627-661, prob:0.994)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3K9	Uncharacterized protein (Fragment)	Low	6.7	1	32-52	TQTLKRINRIKRPLNSIPQHH	extr(9),mito(8),nucl(5.5),cyto_nucl(5.5),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3L1	Uncharacterized protein	Low	8.4	1	169-188	LWHAFRYRDQRNNRDRRPFD	nucl(11.5),cyto_nucl(9),mito(8),cyto(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3U9	CN hydrolase domain-containing protein	Low	6.1	1	254-273	IDRERLRKVREQQPLLRRTD	cyto_mito(10),mito(9.5),cyto(9.5),nucl(4),cysk(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIZ7	Uncharacterized protein	Low	5	1	252-277	FVVVWHWWIGRRKRQREKNTAVRGHF	plas(18),E.R.(4),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEU3	Brr6_like_C_C domain-containing protein	Low	9.8	1	145-173	AKEMRVKKPRDLARQRSKRRRHSVSESEE	plas(17),nucl(5),cyto(2),mito(1),golg(1),vacu(1),cyto_pero(1)	KEMRVKKPRDLARQRSKRRRH (146-166, prob:0.939)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHD4	Uncharacterized protein	Low	8	1	52-72	EEFLHRRRRKVWKPVTSHRVG	mito(22),cyto(3)	RR (59-60, prob:0.609)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIT9	Uncharacterized protein	Low	5	1	84-106	ASAHSAKKKQKASKWTQDTTRRG	plas(21),E.R.(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ84	HET domain-containing protein (Fragment)	Low	8	1	64-83	RNLFKGLRRIRGRRDPARFW	nucl(12),cyto_nucl(10.833),cyto(7.5),cyto_mito(6.166),mito(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMP8	Uncharacterized protein	Low	8.8	1	1-24	MPKVPAKPRTKTTRDKPITNPTAK	nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN46	Uncharacterized protein	Low	5	1	15-35	IAQRRHYGRVRSKMQRQSGKT	mito(26)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPI0	Non-specific serine/threonine protein kinase	Low	9.2	2	24-44, 526-553	SPEQPPPKPARTKKTTAASKQ, QVYWPSQWKAPSRNKQKQEYVLHKRAKE	mito(13),cyto_mito(10),nucl(8),cyto(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPK4	Uncharacterized protein	Low	8	1	165-186	TKASLENRYRRKKPSNPEKDLA	cyto(23),cysk(3)	SASGKILRRLLKDKVKKEGTSGKAKL (538-563, prob:0.844)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ72	Uncharacterized protein	Low	7.1	1	48-67	TDSLRPHSRYRKLLRERLGT	mito_nucl(8.166),nucl(8),mito(8),cyto_nucl(7.833),cyto(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSZ0	CAP10 domain-containing protein	Low	8	1	411-437	VQEYDKVKKKEVKKRKPRGAPFESYAI	extr(12),plas(4),golg(4),E.R.(3),cyto(2)	VKKKEVKKRKPRG (417-429, prob:0.957)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYN4	Pyruvate carboxyltransferase domain-containing protein	Low	8.1	1	3-28	MLADPSKKYRKFKPLDIPDRKWPSKT	nucl(10.5),cyto_nucl(9.5),cyto(7.5),pero(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIC3	Acyl_transf_3 domain-containing protein	Low	5	1	33-61	LKLWQSKAGTNSKKQRPSKQPLRRTAYLD	plas(25)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ04	Non-specific serine/threonine protein kinase	Low	8.8	1	316-344	QCVLHPGTIRRRKPAKRRRISREELCEPA	mito(11),plas(6),cyto(4),E.R.(3),nucl(2)	RRRKPAKRRRI (325-335, prob:0.95)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKL4	Uncharacterized protein	Low	6.5	1	22-47	DLALALRQRSDRRRRRNGVFNPKMAV	cyto(7.5),cyto_nucl(6.5),plas(6),nucl(4.5),mito(3),extr(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM16	Uncharacterized protein	Low	5.7	1	148-167	HDQQRQRSARYKRSTRQGAW	extr(15),mito(8),nucl(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMH5	60S ribosomal protein L27	Low	6.5	1	52-74	QITRRMSKTRQNKRSKVKPFIKV	mito(18),cyto_nucl(5),nucl(4.5),cyto(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN66	RING-type domain-containing protein (Fragment)	Low	9	1	58-81	LDARKEGKRWIRGRVRVRKGSEGK	cyto(8.5),cyto_nucl(6.5),plas(6),mito(5),nucl(3.5),extr(1),pero(1),E.R.(1),golg(1)	ARKEGKRWIRGRVRVRKGSEGKGERKV (60-86, prob:0.977)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRM4	Uncharacterized protein	Low	8	1	33-55	SVTSGRSATRRHRHARSHHGGTS	nucl(10),mito(9.5),cyto_mito(8),cyto(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRN2	Spindle pole body component	Low	7	1	859-884	MNFNDVYQPVRKRRQKPTGVDKTQMS	cyto(10),cyto_nucl(9.833),nucl(8.5),cyto_mito(8.333),mito(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW96	TRUD domain-containing protein (Fragment)	Low	7.2	1	53-72	GDRKRKRESDGQDGNKKQRS	cyto(10),cyto_nucl(10),nucl(8),cysk(8)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYE7	Autophagy-related protein 27	Low	5	1	63-84	DICDTLKKTKDKPKEQCPTGTR	extr(10),cyto(5),E.R.(5),golg(3),mito(2),vacu(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q421	Homogentisate 1,2-dioxygenase	Low	6.9	1	436-455	SWEPLKPRFRRPTAGKAVNG	cyto(9.5),cyto_nucl(9.5),pero(7),nucl(6.5),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4B1	Uncharacterized protein	Low	9.5	1	1075-1111	TEGGKDDMKFRSRKKKKMTKKDKKEQEVRRRLRHIEW	cyto(14.5),cyto_mito(8.333),nucl(5.5),cysk(5),mito_nucl(3.833)	KFRSRKKKKMTKKDKKEQEVRRRLR (1083-1107, prob:0.994)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBY8	Uncharacterized protein	Low	9.3	1	127-151	TKEHETRRPERRKEDARAYNRRGRP	mito(14),cyto(8.5),cyto_nucl(7),nucl(4.5)	RRPERRKEDARAYNRRGRPGGSIPA (133-157, prob:0.848)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCC9	Uncharacterized protein	Low	7.1	1	384-413	VCEKRFQYKKDLGRHAPKHDPNRKKYYCSF	extr(12),nucl(6),plas(4),mito(3),cyto_nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN21	HDAC_interact domain-containing protein	Low	9.4	1	600-619	APTPASKDNKRKRNDRQGTA	nucl(16.5),cyto_nucl(11.5),cyto(5.5),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTT4	Uncharacterized protein	Low	9.7	1	147-166	KDEPRSARRHHNKKHAHSAA	extr(8),cyto_nucl(6),nucl(5.5),cyto(5.5),mito(4),plas(2),pero(2)	SARRHHNK (152-159, prob:0.651)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3B4	Uncharacterized protein	Low	9.1	1	58-77	ARMKRGLPEKKPIRNVRKVV	extr(11),mito(9),cyto(4),nucl(3)	MKRGLPEKKPIRN (60-72, prob:0.732)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q467	WD_REPEATS_REGION domain-containing protein	Low	7.7	1	140-164	APLPVKGSKKDQRVKPRNNIIKSNS	nucl(12),cyto_nucl(11.833),cyto(9.5),cyto_pero(7.166),pero(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XZM4	Uncharacterized protein	Low	6.2	1	140-161	CAKPERCTSRARRKASRSSHGF	mito(21),nucl(3),cyto(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJ62	Ubiquitin carboxyl-terminal hydrolase	Low	7.5	1	201-220	AFPARALRSRRRRQTLHSAD	cyto(9.5),cyto_nucl(9.5),nucl(8.5),mito(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBK8	Uncharacterized protein	Low	5	1	29-50	VFYLHQRHQRRQRLETIARQNN	extr(9),mito(5),plas(4),cyto_mito(4),cyto(3),pero(3),mito_nucl(3),cyto_pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEV5	Uncharacterized protein	Low	7.4	1	267-287	VPTHRDLKKRAERVRQLRVGV	cyto_nucl(9.833),nucl(9.5),cyto(9),cyto_mito(7.333),mito(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIY4	MFS domain-containing protein	Low	8	1	490-519	YVQGFRWRVKRAAKKSERKGQSKRETEGER	plas(25)	RVKRAAKKSERKGQSKR (497-513, prob:0.925)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ51	Uncharacterized protein	Low	8.2	1	11-39	VNVPKTRRTYCKGRDCKKHTQHKVTQYKA	mito(10),nucl(9),cyto_mito(9)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKX2	Uncharacterized protein	Low	5.9	1	6-25	GYNQLKCRAGPRRRQFGRGC	mito(20),cyto_nucl(3),nucl(2.5),cyto(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMC7	Uncharacterized protein	Low	5	1	375-394	AIIQPSKRPMRVKVKKTFGD	plas(12),mito(11),vacu(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPX0	Uncharacterized protein	Low	7.1	1	569-593	SLSGSVRQCRRRSRSKKSKSMLSTY	extr(11),nucl(6),mito(6),mito_nucl(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1J5	MFS domain-containing protein	Low	8	1	518-540	FVQWRGRNWRKAKASPPPSPRVD	plas(26)	WRKAKASPPPS (526-536, prob:0.689)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMF0	Uncharacterized protein	Low	9.4	1	496-515	RQEHDKKDRKWKKLVNRVMV	nucl(12),cyto(6),pero(5),mito(2),cysk(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ56	Acetolactate synthase	Low	8	1	680-700	LVYDEAKEKERRQRTKERSGR	mito(25.5),cyto_mito(13.5)	KERRQRTKERSGR (688-700, prob:0.756)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLB5	Uncharacterized protein	Low	9.8	1	219-247	GGDYYSDREKKKRYRRSDREKERGGSKCV	mito(13.5),mito_nucl(11.499),nucl(8),cyto_nucl(7.833),cyto(4.5)	REKKKRYRRSDREKERG (226-242, prob:0.895)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXL0	Uncharacterized protein	Low	5	1	33-55	AERLRIKPRSHSNQQVKPHHIKR	plas(25)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3F9	Uncharacterized protein	Low	7.2	1	53-72	AEPPYRPPPPPRKRLTDEEE	extr(12),nucl(6),cyto(3),plas(3),mito(1),pero(1),E.R.(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0Y7	Uncharacterized protein	Low	5	1	327-347	FQSKHRRKLLCDKMTRSRSRD	plas(24),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI34	Uncharacterized protein (Fragment)	Low	7.4	1	102-126	DGLSTKPRVARRTRRTSLKAWRISH	cyto(7),nucl(6),extr(6),plas(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJD6	RNA-dependent RNA polymerase (Fragment)	Low	9.2	1	956-982	KMWPHWSEPKGKSKRKVYTSKKVLGQL	plas(13),cyto(5),nucl(3),mito(2),golg(2)	K (969-969, prob:0.603)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YP58	Uncharacterized protein	Low	9.2	1	264-291	QDLTVKVESKKQRNKNTKQTRIVKKTIP	nucl(16.5),cyto_nucl(13.5),cyto(9.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF04	acidPPc domain-containing protein	Low	7.3	2	32-53, 414-433	LSHYERRLPKWRYQVRHRLIPI, IANRAQQRRDRSRSPQKGLQ	plas(22),nucl(1),mito(1),cyto(1),cyto_nucl(1),E.R.(1),golg(1),cyto_mito(1),mito_nucl(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIG7	Tyrosine--tRNA ligase	Low	9.1	1	358-382	AYPPLPPPEKKAKKAKNLGSRFPGA	cyto(21),cyto_nucl(13.833),nucl(4.5)	PPEKKAKKAKNLGSR (364-378, prob:0.878)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNS2	Uncharacterized protein (Fragment)	Low	5	1	183-206	GHHSQRYRDRDVRQYKKERPARVG	extr(21),mito(3),cyto(1),pero(1),golg(1),cyto_pero(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUQ4	C3H1-type domain-containing protein	Low	8.7	1	503-525	AVKETHKRGKSGCRIRRPASFSP	mito(14),nucl(10),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUY9	Uncharacterized protein (Fragment)	Low	7.5	1	116-138	DVIMKHLKRHKLRSKFKLRLLDN	mito(18),nucl(7.5),cyto_nucl(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX10	Uncharacterized protein	Low	7	1	220-240	TTQNTGFKKKQQRPKAQAFGP	cyto(16),cyto_nucl(13.333),nucl(8.5),mito_nucl(5.666)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0D3	V-type proton ATPase subunit C	Low	9.5	1	349-372	GGNAISKDKKGRPKQDDSSTQQEM	mito(7.5),cyto_mito(6.999),cyto_nucl(6.833),extr(6),nucl(5.5),cyto(5)	RAKKAK (333-338, prob:0.651)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0K7	Mitogen-activated protein kinase	Low	8.3	1	250-269	VQSLPKRERQPLKNKFKNAD	nucl(11),cyto(11),cyto_nucl(11)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q115	Uncharacterized protein	Low	5	1	559-582	SNGPVRHSRNPMRRPPKQNRTSAA	mito(12.5),cyto_mito(8.666),extr(8),cyto_nucl(4.333),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFM4	ANK_REP_REGION domain-containing protein	Low	6.9	1	25-49	LETFRTALKHRSRGRLRTIPRSEQQ	cyto(8.5),cyto_nucl(8),nucl(6.5),mito(3),E.R.(3),pero(2),extr(1),golg(1),cysk(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGM9	Uncharacterized protein	Low	8.9	1	482-501	EDEEATPKQRKKQARVDGRG	nucl(15),cyto_nucl(12),cyto(7),mito(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL51	Uncharacterized protein	Low	7.2	1	35-56	MTYKELSKEWKRQNNRDGQCDS	mito(16),nucl(7),cyto_nucl(6),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL93	Ribosomal_L16 domain-containing protein	Low	6.9	1	1-31	MARRPARCYRYCKNKPYPKSRFNRGVPDPKI	mito(13),nucl(6),cyto(6),cyto_nucl(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLE9	Uncharacterized protein	Low	9.2	1	251-271	LGLPRHFGKRRRFDRWLAATS	nucl(15.5),cyto_nucl(11.5),cyto(6.5),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNA1	Uncharacterized protein	Low	6.1	1	632-658	LWAQRLLTEKQRKRCMKWGLERSNFAA	mito(16.5),cyto_mito(11.5),cyto(5.5),nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR81	MFS domain-containing protein	Low	8	1	493-513	LLLRWRSPYWRAKKKAAAAKS	plas(19),mito(3),E.R.(3)	AKKKAAAAK (504-512, prob:0.714)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWI3	Uncharacterized protein	Low	6.8	1	180-200	DYDPKLPKSKQKYRVHCSEGA	cysk(15),nucl(5),mito(4),cyto_nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL89	Glycosyltransferase family 8 protein (Fragment)	Low	8	1	34-53	LCTCDVSKRKRDRLKADGAT	nucl(10.5),cyto_nucl(10),cyto(8.5),pero(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEL3	Uncharacterized protein	Low	5	1	201-220	HTFPRDQRPHRQRDLPPPRT	mito(17),cyto(5),extr(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEN0	Uncharacterized protein	Low	8	1	260-285	IIVLSVMRRRTKKRRASTMPPQRDGD	plas(15),mito(4),E.R.(4),cyto(3)	RRTKKRR (268-274, prob:0.731)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFW8	Uncharacterized protein	Low	9.3	1	187-211	RDFAQSRPSEKPRRKQSALRKQPTM	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTU7	BRCT domain-containing protein	Low	7.8	1	75-99	AEIVLSKVKQKKRCQFDLRGKGLPT	cyto(10.5),cyto_nucl(10.5),nucl(9.5),mito(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJ12	Ubiquinone biosynthesis protein coq4, mitochondrial	Low	8	1	254-275	LREIRKALRDERRREKEPKGSI	mito(23.5),cyto_mito(13.5)	KALRDERRREKEPK (259-272, prob:0.743)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCM2	Uncharacterized protein	Low	9.8	1	10-31	TLIIERCKKRIQNYRKRLSSCV	mito(13),nucl(12)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJR0	Zn(2)-C6 fungal-type domain-containing protein	Low	6.4	1	56-92	VSGRARVTKRNKPTLNCLECVERKSKCDRVRPSCFTC	cyto(8.5),cyto_nucl(7),nucl(4.5),mito(4),plas(3),pero(3),extr(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKI0	Uncharacterized protein	Low	7.7	1	196-219	CEGAQRKTSQGRNRRQRVPAHLLN	nucl(8.5),mito(8),cyto_nucl(7),cyto(4.5),cysk(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLQ9	Uncharacterized protein	Low	8.5	1	132-151	HSHPSHPQHQRRPQHPHNTR	mito(14),nucl(11.5),cyto_nucl(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q320	Uncharacterized protein	Low	8.9	1	111-131	AYPSPKAQKRAQSPRHEHSKI	nucl(15),cyto_nucl(12),cyto(7),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJ18	Uncharacterized protein	Low	8	1	219-243	KDTGKKSYFGRKGSKRSTRERGSFI	plas(20),extr(3),E.R.(2)	RKGSKR (229-234, prob:0.632)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIK8	Uncharacterized protein	Low	7.2	1	341-365	DLKWVRTHFHPDKFRRCPEEKRAVF	mito(10),cyto_nucl(8),nucl(7),cyto(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK06	tRNA (guanine(26)-N(2))-dimethyltransferase	Low	8	1	92-129	GEDWMDRKRLRNERNKDRHNKKQNKKRKLAESKHDTTE	cyto(12),cysk(5),mito(4),pero(4)	RKRLRNERNKDRHNKKQNKKRKL (98-120, prob:0.979)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY16	Glycoside hydrolase family 3 protein	Low	5	1	1-20	MNNTKRQRRWWVPSRFLCFL	extr(25)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYE4	Glycoside hydrolase family 63 protein	Low	6.7	1	202-224	TEGTSKSRPRHQHPSDKGKPLDR	cyto_nucl(7.333),cyto(7),nucl(6.5),cyto_mito(5.833),extr(5),mito(3.5),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0F0	Chloride channel protein	Low	5	1	67-88	KDSYRLRSTRGKRGLRYRFFDL	plas(27)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2A7	HMG box domain-containing protein	Low	9.7	1	213-236	HQQQYPTYRYRPKRSGRRNSLSSD	nucl(17.5),cyto_nucl(11),mito(5),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4J2	Magnesium transporter	Low	8.5	2	62-84, 89-111	RPPPSIRQSCTNRDRTRHRSFSV, GADPFWRRLRQPRNAAKPARPDD	mito(16),nucl(4),cyto(3),plas(1),extr(1),E.R.(1),golg(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNI3	Uncharacterized protein	Low	9.6	1	90-114	NSHTHRCSSRDRRPGQSRKLCLTPK	nucl(18.5),cyto_nucl(12.333),cyto(5),cyto_mito(4.333)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVB3	Uncharacterized protein	Low	5	1	655-675	PTPQHSRTPSPQKQGRRVVSR	plas(11),mito(5),E.R.(5),cyto(2),extr(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYD2	VWFA domain-containing protein	Low	7.3	1	1-20	MFSSLKHKFSRKNDNSIERG	cyto_nucl(11.5),cyto(10),nucl(9),mito(4),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1W5	WD_REPEATS_REGION domain-containing protein	Low	7.2	1	103-122	SLAARRKKPKTNEQASDPRM	cyto(9.5),cyto_nucl(9),nucl(7.5),mito(5),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2V0	BHLH domain-containing protein	Low	9.5	1	194-219	APASAPPKKKGGRKRKAETQLQPQPE	plas(18),nucl(4),E.R.(2),mito_nucl(2)	APPKKKGGRKRK (198-209, prob:0.963)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIC1	Uncharacterized protein	Low	9.4	1	75-105	KRGKKGKATAKSKPKPKPKPRKITKSTTGRI	mito(19.5),cyto_mito(11.5),nucl(5)	KRGKKGKATAKSKPKPKPKPRKITKS (75-100, prob:0.999)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIQ9	acidPPc domain-containing protein	Low	8	1	27-58	LPSLPIYVPHRIRRRFRSTRSKIRSRQAPTSS	plas(21),mito(5)	RRRFRSTRSK (39-48, prob:0.656)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN11	Uncharacterized protein	Low	6.3	1	223-242	GEKLREKYYKDRRANFPPDH	cyto(9.5),cyto_nucl(8.5),cysk(7),nucl(4.5),mito(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNT7	Uncharacterized protein	Low	7.2	1	4-23	VSEKEAKKALRKQIKDKVSA	cyto(14),nucl(6),pero(4),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZW3	Uncharacterized protein	Low	9.7	1	224-244	WKDYGDHLKKRKRHEDEMVAE	nucl(14),cyto(8),mito_nucl(8)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIS5	Putative epoxide hydrolase	Low	6.9	1	72-93	NFSWRTFEKKLKKYPQYTVPVK	cyto(10.5),cyto_nucl(9),nucl(6.5),cysk(6),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI49	Uncharacterized protein	Low	6.8	1	1-22	MKSDIQRRKRKQNFPHRTICAD	mito(15.5),mito_nucl(12.166),nucl(7.5),cyto_nucl(5.833)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL79	Uncharacterized protein (Fragment)	Low	8.5	1	9-29	QSDRRSCPKPKPSSRVLPRRL	mito(13),nucl(11),cyto_nucl(7.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ06	Uncharacterized protein	Low	6.4	1	563-586	STNHSTRAQRKQGKMLRQLRNIDR	cyto(10.5),cyto_nucl(8),mito(7),nucl(4.5),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPY0	MHYT domain-containing protein	Low	8	1	684-708	AFAPLFARKLPKRHRKAKLSVVLAD	plas(22),E.R.(3)	RKLPKRHRKAK (691-701, prob:0.834)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRH4	WD_REPEATS_REGION domain-containing protein	Low	5.6	1	437-460	MVWDRKENWKWRFQRPQGRAMKLW	cyto(13),cyto_nucl(8.333),cyto_pero(8.333),cysk(8),nucl(2.5),pero(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YHT9	Uncharacterized protein	Low	7	1	281-301	YTTHSHRAFHHQDYKRRRPDC	mito(19),nucl(6),cyto_nucl(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PME5	Uncharacterized protein	Low	5	1	1-20	MTFHCTHGRQRTRRMPCASV	mito(22),extr(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPM8	Peptidase_M14 domain-containing protein	Low	9.3	1	60-79	SSTPNARPHCDKPRPPPQTF	extr(7),cyto_mito(6),mito(5.5),cyto(5.5),nucl(4),pero(3)	KRRRRR (581-586, prob:0.803)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT65	Uncharacterized protein	Low	9.9	1	22-41	APPLRRRKRLIQNISADWKK	nucl(17.5),cyto_nucl(10.5),mito(5),cyto(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUK9	Glycosyltransferase family 2 protein (Fragment)	Low	5	1	446-466	WVPSGDSKAHKNNKYRNMRIL	plas(22),golg(2),vacu(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVH9	RHOMBOID-like protein	Low	8	1	97-125	DDPFVRDVDPRKKKHRTDRGKQGWFKGKI	plas(26)	RKKKHRTDRGK (107-117, prob:0.812)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVN2	DH domain-containing protein	Low	7	1	66-86	DEAARKRSMKRRQTIEELIRT	mito(10),cyto(6),nucl(5),plas(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYT5	Uncharacterized protein (Fragment)	Low	9.3	1	10-29	MDRPLDAKIKRNDRRRLLTG	nucl(16),cyto_nucl(13),cyto(8)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q041	Glycoside hydrolase family 16 protein	Low	7.4	1	674-698	NYDGGSTKRFKKTKRSSETTRSWLP	plas(9),nucl(6),mito(4),cyto(3),golg(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL21	RING-type domain-containing protein	Low	6.7	1	271-292	VTATPRVPKSTKAKRKWTKLTI	cyto(10),cyto_nucl(9),pero(7),nucl(6),cysk(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG01	Uncharacterized protein	Low	7.6	1	50-75	LTLCHPGSCYRRRRRQRVLGKPTTWS	mito(10),nucl(9),cyto_nucl(9),cyto(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKN0	Nuclear protein localization protein 4	Low	6.2	1	137-156	KLDGKITRKKDQRMCKHGPM	cyto(14),cyto_nucl(10),mito(6),nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPN9	Uncharacterized protein	Low	6	1	243-266	STAIKECRWRPRNELPHTKRSMKI	mito(12),cyto(9.5),cyto_pero(6.5),nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPQ3	Uncharacterized protein	Low	8.3	1	1-22	MPSLGFLKKKRTKDSSQGSDNS	nucl(12),cyto_nucl(10),cyto(6),pero(5),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTS7	Septin-type G domain-containing protein	Low	9.4	1	1-25	MSSSPAIKLRRKKNVKKGIQFCLMV	mito(17.5),mito_nucl(12.166),nucl(5.5),cyto_nucl(5.333)	RRKKNVK (10-16, prob:0.71)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTV3	Biotin carboxylase	Low	6.7	1	2153-2173	WQNARRFFYWRLRRRLNEEYV	cyto(15.5),cyto_nucl(11.5),nucl(6.5),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYV1	Uncharacterized protein	Low	5	1	193-217	NYTSGFGKKKFWQRKPKDTTIRDTE	plas(11),extr(7),vacu(4),E.R.(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZM5	Squalene synthase	Low	5	1	346-368	CEVFRRFARKIHRKNKPSDPHFL	cyto(10),mito(5),E.R.(5),cyto_pero(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2S6	ATP-dependent DNA helicase II subunit 2	Low	9.1	1	561-580	VPPKAAGKRYSRKEAPKPLS	cyto(18),cyto_nucl(12.666),cyto_mito(11.166),nucl(6),mito_nucl(5.166)	VIKAAEVKKVPPKAAGKRYSRKEAPK (552-577, prob:0.912)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIU6	Uncharacterized protein	Low	8.3	1	66-98	PGTSYPPSTSSRRKRRGRSSSRKRNNAGNIPKI	plas(21),E.R.(3),nucl(1),mito(1),cyto(1),cyto_nucl(1),cyto_mito(1),mito_nucl(1)	RRKRRGRSSSRKRNNAG (77-93, prob:0.966)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMR2	Elongation of fatty acids protein	Low	5	1	280-300	FYISTYKKPVKKGRGRATSAL	plas(20),E.R.(4),pero(1),golg(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YK24	UBX domain-containing protein	Low	9.2	1	350-373	RYSLKMEKKNPVQKQRKESKKDVA	nucl(15.5),cyto_nucl(9.5),cysk(5),cyto(2.5),mito(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKL1	Eukaryotic translation initiation factor 3 subunit M	Low	9.2	1	414-439	VQNGQGYRPDRRQRNAPERQQQQSIE	nucl(17.5),cyto_nucl(12.833),cyto(7),cyto_mito(4.333)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM77	Uncharacterized protein	Low	9.1	1	136-156	IDNIREHYRRRHGQRSGDEEF	nucl(13.5),mito(11),cyto_nucl(8.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCI2	HET domain-containing protein	Low	7.2	1	391-410	RARVRRCKIFWKPERYSYRA	nucl(7.5),cyto_nucl(7.5),mito(7),cyto(6.5),pero(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDC4	Palmitoyltransferase PFA4	Low	5.7	1	104-123	CEAFKPPRAHHCKTCKRCVM	extr(6),E.R.(6),cyto(4),plas(4),nucl(2),pero(2),golg(2),cyto_mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH41	Uncharacterized protein	Low	7.6	1	60-79	SISFKRYAKALKEERHKLRD	plas(9),nucl(8.5),cyto_nucl(7),cyto(4.5),E.R.(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJZ2	Uncharacterized protein	Low	6	1	500-522	RELLKFVKEKKVRYKAVKEIEFI	cyto(15.5),cyto_nucl(10),mito(4),nucl(3.5),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUW9	Uncharacterized protein	Low	5	1	12-34	VPVADRGQRYPNRKLRRTCSIVL	extr(10),plas(8),mito(3),golg(3),vacu(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q236	Dolichyl-phosphate-mannose--protein mannosyltransferase	Low	5	1	6-25	GSLRNRGAKGHKRPTTPNGD	plas(27)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4D7	ABC transporter-like protein	Low	8	1	102-126	LSHISRQQSRTSRKSDKRINELVRD	plas(25)	AKKQARRGK (863-871, prob:0.686)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJG1	40S ribosomal protein S4	Low	5	1	1-20	MGRGPKKHQKRLSAPSHWLL	mito(21),cyto(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YME7	Uncharacterized protein	Low	7.9	1	185-206	KMNDDDDRRRERRREERVEDEY	cyto_nucl(12),nucl(10.5),cyto(10.5),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFX0	Uncharacterized protein	Low	9	1	420-441	LQTPAYAGKKRKRTCNEALSEQ	nucl(13.5),cyto_nucl(9.5),mito(6),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIJ6	Uncharacterized protein	Low	5	1	686-705	AIALRDKKSRRDSIHLGKEA	plas(10),extr(6),mito(4),cyto(4),cyto_mito(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJQ6	Uncharacterized protein	Low	9.4	2	336-357, 755-775	SEKAWKDKTWKDKRKTRFCGIP, YEPNTNRKWKRTAPGGCHCQW	plas(10),nucl(6),mito(3),cyto(3),cyto_mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNC8	Uncharacterized protein (Fragment)	Low	5	1	171-190	KEWTRWCKRWVKDPEKAVKK	mito(9),extr(7),golg(4),cyto(3),pero(3),cyto_pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNY9	Uncharacterized protein	Low	8.9	1	96-117	YQNKQNEMEKWKKKNNIQVVQQ	nucl(14),cyto_nucl(11),cyto(6),mito(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNZ9	Uncharacterized protein	Low	9.4	1	298-323	DEVEKPISKREAKRRAHKARQEALAA	cyto(19.5),cyto_nucl(14),nucl(5.5)	SKREAKRRAHKAR (305-317, prob:0.878)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSU4	Uncharacterized protein	Low	5	1	1487-1509	EDTTKHRLSKRRDKLKQWHSEEL	mito(9),cyto(7),plas(6),mito_nucl(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUN2	RF_PROK_I domain-containing protein	Low	8	1	117-138	ADKASKKKASAAKKSRRKYRGL	mito(25)	QSRTALKADKASKKKASAAKKSRRKYR (110-136, prob:0.988)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Y1	Uncharacterized protein	Low	8	1	98-121	VKQGYLKSLPRRNRRRPKTVGIAP	cyto(10.5),cyto_nucl(6.5),mito(6),plas(3),extr(2),pero(2),E.R.(2)	PRRNRRRPK (107-115, prob:0.777)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4X5	Uncharacterized protein	Low	9.1	1	163-184	GPNVRLTKLKKKRGLKDFGMKE	cyto(18),cyto_nucl(12),nucl(4),pero(4)	KKKR (172-175, prob:0.63)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q553	Uncharacterized protein	Low	8	1	71-97	NDINSPRREWRKHGKKRKMYGLRKLAA	plas(19),mito(3),E.R.(3)	RREWRKHGKKRKMYG (77-91, prob:0.946)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHI8	Palmitoyltransferase	Low	5.7	1	648-673	GDTRLGHTRTKKQRIEKAKEDSKRYS	plas(21),nucl(2),cyto(2),cyto_nucl(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKX9	Rho-GAP domain-containing protein	Low	8	1	592-614	YEDGSKPRSRDNSRPRENAKPAT	nucl(10.5),cyto_nucl(8.5),mito(7),cyto(5.5),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFS8	Mitochondrial intermediate peptidase	Low	6.9	1	7-29	QQAWTCPKCLRQQVRQSRRSLVT	mito(19),nucl(5),cyto(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHC0	Uncharacterized protein	Low	8	1	318-339	AKSAIGAKRKWHDRFRPHKKTA	extr(14),cyto(7.5),cyto_nucl(4.5),mito(3)	GAKRKWHDRFRPHKKTA (323-339, prob:0.819)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ35	Uncharacterized protein	Low	8	1	157-185	VEEKERDTARKKQKKQKKMERKIRAQMDE	mito(9),cysk(8),cyto_mito(8)	REVEEKERDTARKKQKKQKKMERKIR (155-180, prob:0.983)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJZ6	Uncharacterized protein	Low	5	1	25-50	DQLVWHKKPQTTYKKFPKKLSSGDSH	plas(20),pero(4),cyto(1),golg(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3N6	Uncharacterized protein	Low	7	1	176-198	ASDARKQEPTQRRPEPKKSPSFF	mito(18),nucl(6),cyto_nucl(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q576	Uncharacterized protein	Low	6.8	1	10-34	AVSEQQRRSGRQQRWQQNRKQMPLD	mito(17.5),mito_nucl(12.5),nucl(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLV8	H/ACA ribonucleoprotein complex subunit CBF5	Low	9.5	1	446-496	GETNGEKKEKKEKKRKHEGETAEEKAERKAKKKAKKEKKAKRESMVTNDSD	cyto(15),cysk(7),nucl(4)	KKEKKEKKRKHEGETAEEKAERKAKKKAKKEKKAKR (452-487, prob:0.999)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHT3	APH domain-containing protein	Low	7.4	1	266-288	TEEQKGWRYKKPRDLNGNIVRPP	cyto_nucl(9),nucl(8),cyto(8),pero(7),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLY4	DUF4203 domain-containing protein	Low	6.2	1	335-354	MKIWKVVKEQKQRRDAQRLQ	plas(14),extr(4),nucl(3),E.R.(3),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC73	Uncharacterized protein	Low	5	1	341-364	APENDRTDRRRERNDRNPRQRAAP	mito(26)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDE1	Uncharacterized protein	Low	7.3	1	199-224	RGPARMHSGRVKHRHEHNRSQSRAQT	cyto(11.5),cyto_nucl(10.5),nucl(8.5),mito(3),plas(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH95	Uncharacterized protein	Low	5.9	1	50-73	DTLIGRFRKSEKNRVKNVYNHVES	mito(18),cyto_mito(11.833),mito_nucl(11.833),nucl(4.5),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKZ2	Uncharacterized protein	Low	8.1	1	441-464	LLNRLTRRPVPRRKLQRVQHQSPA	mito(16),nucl(8),cyto(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTB9	CDP-diacylglycerol synthase (Fragment)	Low	8.4	1	421-441	KYVGEKRSKGQQKAKTAPEKA	nucl(12),cyto_nucl(10.5),cyto(7),mito(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q144	Uncharacterized protein	Low	9.7	1	217-238	ADKDKCKKCKGERTIKQKKILE	cyto(17.5),cyto_nucl(12.833),nucl(7),mito_nucl(4.833)	GPRRRKAKGK (123-132, prob:0.854)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIU2	ABC1 domain-containing protein	Low	7.4	2	83-106, 542-561	LGKPKAAKTYRRSQKWLRRLVRLS, KTMKGIKKLSKMDQKQRQFE	mito(24),nucl(1),cyto(1),plas(1),cyto_nucl(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG71	Uncharacterized protein	Low	5	1	198-218	ADFRVRSRGLRRKMWWKNVRL	cyto(12),mito(9),plas(2),extr(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGL5	Uncharacterized protein	Low	5	1	553-572	GKRWTEQRRKSSAPRNHNLH	plas(17),E.R.(5),vacu(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYX7	Uncharacterized protein	Low	9.2	1	246-270	KDYGGEKPKEKPKPEQPAKKPDGYG	mito(9),cyto(7.5),cyto_nucl(6),extr(4),nucl(3.5)	KPKEKPKPEQPAKKPD (252-267, prob:0.834)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZB4	Uncharacterized protein	Low	9.6	1	31-52	DATATAILKKKKKPNSLIVTDA	nucl(17.5),cyto_nucl(13),cyto(7.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMG9	Uncharacterized protein	Low	9.7	1	40-64	RVEKAQGRSKTGKKRQRMTEHEENC	cyto(18.5),cyto_nucl(13),nucl(6.5)	K (52-52, prob:0.6)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIS3	AAA domain-containing protein	Low	5	1	355-378	ASASSPTKPAKRRAVRRSNTDLQS	cyto(11),mito(9),cyto_nucl(9)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE43	HET domain-containing protein	Low	6.8	1	46-65	DLDRARQKRGWKKIQHTILQ	mito(7),cyto(7),cyto_mito(7),nucl(6),pero(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIL1	Uncharacterized protein	Low	5	1	142-161	APASHKAPTRPQNQHRTDRA	plas(20),E.R.(3),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWL2	Uncharacterized protein	Low	5	1	174-196	DHTILLRKRYPRKPPSQTFKDPF	extr(11),plas(7),E.R.(3),mito(2),golg(2),vacu(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYH3	Uncharacterized protein	Low	8	1	175-194	DVNALSKKKQRWRQVFNPAV	cyto(16),mito(4),pero(3),extr(2)	RELRDRAKKEIR (552-563, prob:0.708)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0F5	Uncharacterized protein	Low	9.1	1	324-345	QFQQRTPRPRHLQKQHHQQGFQ	nucl(11),cyto(9),mito(4),extr(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0V2	Uncharacterized protein	Low	8.1	1	10-35	GDISPPPSSRRRKLASPRSPQRVPEC	nucl(12),cyto_nucl(11.5),cyto(9),mito(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1H9	G-patch domain-containing protein	Low	9.7	1	238-259	ILTTNRAKAKPKPKPLKRSGFG	cyto(16.5),cyto_nucl(12),nucl(6.5),mito(3)	RAKAKPKPKPLKR (243-255, prob:0.891)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJQ3	Glycerol-3-phosphate dehydrogenase [NAD(+)]	Low	8.2	2	26-47, 69-93	RIFTRQSRFHDRKPPSAQNFRS, VASNTPAQRQRQRQQLRRIHQPQES	mito(15.5),cyto_mito(11.333),cyto_nucl(6.333),cyto(6),nucl(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQL8	Uncharacterized protein	Low	5.7	1	69-93	VYVRPQERAKWRKMKQDRIRVYAAR	mito(20),cyto(3),nucl(2),cyto_pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS12	MFS domain-containing protein	Low	5	1	40-64	RRIRVRWCGFYKHKRPGPSRPPSVW	plas(23),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWY7	MPN domain-containing protein	Low	9	1	349-368	EKTDKEAKEEPKKDDKGKKK	cyto(12),cyto_mito(10.333),cyto_nucl(8.833),mito(7.5),nucl(4.5)	AKEEPKKDDKGKKK (355-368, prob:0.932)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXK9	Glycosyltransferase family 15 protein	Low	6.2	1	32-57	SEKITPRLSFFKKRIRIRGNSKISVP	mito(6),plas(6),nucl(4),E.R.(4),cyto_mito(4),cyto(2),pero(2),golg(2),cyto_pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZU0	Uncharacterized protein	Low	9.8	1	455-479	RFGGTDKRKIYNRKLRRSAQESSEF	nucl(17.5),mito_nucl(12.5),mito(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZW5	Uncharacterized protein	Low	5	1	42-65	YDQRDMRRLGKKQELKRRFRFFSI	plas(27)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGV7	Ubiquitinyl hydrolase 1	Low	6.7	1	63-82	QQQHSQQQRQQQHHHTPQHS	mito(12.5),cyto_mito(9.666),cyto_nucl(7.333),nucl(7),cyto(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKM0	ATP-dependent DNA helicase	Low	6	1	14-39	TVVRKLSQPVSKRRKVHNLTKATTFK	cyto(10.5),mito(8.5),cyto_nucl(7.833),mito_nucl(6.833),nucl(4),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJW0	CENP-V/GFA domain-containing protein	Low	6.2	1	103-126	AESWFRWRTRKLRHREDGLKRARE	mito(11),cyto(6),pero(5),nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ48	Uncharacterized protein	Low	8.6	2	24-50, 99-119	STCTSSRSRAHHEDRRHRRTCRGDIGG, VSTSRRQQTRRFSSHVRRYQH	mito(14.5),cyto_mito(10.5),nucl(6),cyto(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQC2	Peptidase_M48 domain-containing protein	Low	5.4	1	35-70	IPFQQPRQRTHWQRTWQQSQKRTYRRGQPLSYQRFK	plas(11),mito(10),E.R.(2),nucl(1),extr(1),pero(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSM4	Protein kinase domain-containing protein	Low	7.6	1	493-512	QEEETKRRKNFKQGYRGGNP	mito(10),nucl(8.5),cyto_nucl(8),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU88	Uncharacterized protein (Fragment)	Low	7.5	1	7-27	IIKGPRSRYNNKKVKPSLRRY	mito(18),nucl(9),cyto_mito(9)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUB4	Uncharacterized protein	Low	9.5	1	300-328	GVVSRDPRRVERKKPGKLKARKMPAWVKR	mito(17),cyto(6),nucl(4)	ALRRAGVVSRDPRRVERKKPGKLKARKMPAWVKR (295-328, prob:0.995)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1D9	IU_nuc_hydro domain-containing protein	Low	5	1	375-399	QWTRGMCVIDRRSRKKREDDHDGEI	cyto(6.5),extr(5),cyto_nucl(4),golg(4),mito(3),plas(3),E.R.(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q538	Uncharacterized protein	Low	8	1	170-191	PPSPARRSRRSGFRHRRIRSSP	plas(24),E.R.(2)	PARRSRRSGFRHRRIR (173-188, prob:0.849)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIG8	Uncharacterized protein	Low	6.2	1	12-44	WTLKAVRRSKFDGQKHEKKHDLQRDQTPRPNAK	plas(12),mito(9),nucl(3),cyto(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNS8	Uncharacterized protein	Low	8.5	1	3-26	ESIPERFNHRSKKGVRNQASKVEV	nucl(12.5),cyto_nucl(9.5),cyto(5.5),mito(5),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT94	Uncharacterized protein	Low	6.3	1	1-22	MEKDNLKKQFQPRPPQDESRYL	cyto(13.5),cyto_nucl(10.5),pero(6),nucl(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXY5	Uncharacterized protein	Low	8.1	1	215-237	TYINAHTKKKRLQALRRKYQDSS	nucl(9),mito(8),cyto(4),pero(4),cyto_pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYU4	Uncharacterized protein	Low	8.1	1	25-46	LYNKHLKEAKSRRYRWRWVGSC	mito(16),nucl(8),cyto(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3S4	Alpha-1,3-glucosyltransferase	Low	8	1	1-22	MANSHRPRKRRRNEISTSSSNG	plas(21),E.R.(5)	PRKRR (7-11, prob:0.668)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLQ0	Uncharacterized protein	Low	9.2	1	50-78	NTRAALHSDRHRVRRKKSDGQAKFRAKRV	mito(8),cyto(6),plas(6),nucl(3),pero(2)	RHRVRRKKSDGQAKFRAKRV (59-78, prob:0.896)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE30	Peptidase A1 domain-containing protein	Low	5	1	424-443	LWFFLWRKRRSQRGDSQVPV	extr(24),plas(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPL3	Uncharacterized protein	Low	5	1	184-207	RPATRGTEKPRRSPHPDEKTSRYE	plas(23),E.R.(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQA6	HECT domain-containing protein	Low	6.7	1	60-80	ASSRIQKVWRGHQARRKTFKL	mito(13),nucl(5.5),cyto_nucl(5.5),cyto(4.5),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQG0	Uncharacterized protein	Low	8	1	364-385	VAYYAIRKRKSKRGSVAQMDGH	extr(27)	KRKS (371-374, prob:0.625)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSU5	ATPase GET3	Low	6.6	1	275-295	PCDQCNSRRKMQKKYLEQIDD	cyto(19),cyto_nucl(13.5),nucl(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYB1	Uncharacterized protein	Low	8.1	1	398-418	VEWPPRCRCRVHCGKIKWTSE	nucl(11),cyto_nucl(10.5),cyto(8),mito(4),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2S9	Serine/threonine-protein phosphatase	Low	7.7	1	501-526	DSSALKSHIKKGRNKRQNMLNSPPAS	cyto_nucl(12.5),cyto(11.5),nucl(10.5),pero(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKV3	Uncharacterized protein	Low	9.7	1	22-45	GILDRRRCRMRQRGRKISRKGSSV	cysk(14),nucl(5),mito(5),mito_nucl(5)	RMRQRGRKISRKG (30-42, prob:0.777)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDX0	Uncharacterized protein	Low	8.8	1	1-22	MSPERCKRVSHRQPNHRHIATH	nucl(14),cyto_nucl(10),mito(9),cyto(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXK3	zf-Mss51 domain-containing protein	Low	6.1	1	37-56	KQPTNARRIHQSSKHRAAPA	mito(19),nucl(3),cyto(3),cyto_nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZX5	Casein kinase II subunit beta	Low	6	1	401-426	VQEVTQRRKPSVKKQRHHQTGPGAMV	cysk(20),nucl(3),cyto(3),cyto_nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1V6	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	Low	7.9	1	66-87	FVPPPVKQKPTQNVKGRIRQLE	plas(12),nucl(8),mito(2),golg(2),cyto(1),pero(1),vacu(1),cyto_pero(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2S3	DUF2293 domain-containing protein	Low	8	1	19-49	SLARALAKRRDKPYKTEQNRVFAKKRKLDLH	mito(23),cyto(3)	RR (27-28, prob:0.613)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5F3	Zn(2)-C6 fungal-type domain-containing protein	Low	9.5	1	52-87	KPAVHLQKRRRVTRACDECRRKKIKCDGKQPCTHCT	nucl(17.5),cyto_nucl(11.5),plas(5),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YP62	MFS domain-containing protein	Low	5	1	437-456	MYYRWVNKRRSEGREDWKLE	plas(26)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD78	DUF155 domain-containing protein	Low	9.7	1	69-91	AKALTKRKAASKHANKNSLRKVA	mito(9),cyto_nucl(6),nucl(5.5),cyto(5.5),extr(2),pero(2),golg(2)	TKRKAASKHANKNS (73-86, prob:0.75)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMC0	Serine hydroxymethyltransferase	Low	6.5	1	19-42	PSIFDIIRKEKRRQKHFINLIPSE	cyto(12.5),cyto_nucl(10.5),cysk(7),nucl(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP18	Zn(2)-C6 fungal-type domain-containing protein	Low	8.1	1	18-53	VMESRAPRIGHKKSRKGCAQCKRRHVKCNEESPCSN	cyto(9),nucl(8),mito(5),pero(2),cysk(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW54	MFS domain-containing protein	Low	5	1	490-511	IWTGGSIFKKRRKDKEEASEDA	plas(23),mito(1),E.R.(1),golg(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWE1	Uncharacterized protein	Low	6.4	1	608-636	LTILVKCAGNRQQSKRRSRRGDNGWDYEG	mito(5),extr(5),cyto_nucl(5),nucl(4.5),cyto(4.5),golg(4),plas(1),pero(1),cysk(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXG9	Alpha-1,4 glucan phosphorylase	Low	6.8	1	61-80	QREAWRKYSAREFKNKDEFD	cyto(14.5),cyto_nucl(11),nucl(6.5),pero(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXM9	alpha-1,2-Mannosidase	Low	5.8	1	1-22	MPASKRSNGKPQKLPRVQHEFK	cyto(11),cyto_mito(9.333),cyto_nucl(7.833),mito(6.5),pero(5),nucl(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0A0	Uncharacterized protein	Low	5	1	709-733	KREGHSNKSSKSCRNPPPRTATDRQ	extr(13),mito(9),cyto(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q427	Uncharacterized protein	Low	9.5	1	44-66	SFETPDGKRYRRKRKDSQDVIAE	cyto_nucl(5),nucl(4.5),cyto(4.5),mito(4),plas(4),golg(4),extr(2),E.R.(2)	RRKR (54-57, prob:0.628)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0C4	Uncharacterized protein	Low	7.7	1	106-128	LVILSPKFKKEKKRNFTQLTQGN	nucl(13),cyto_nucl(12.333),mito_nucl(9.499),cyto(8.5),mito(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2Y9	Uncharacterized protein	Low	8.7	1	87-110	FMTEPQKHNKGRRHHIPRGKALGG	cyto(16.5),cyto_nucl(10.833),cyto_pero(9.666),mito(5),nucl(3)	KGRRHHIP (96-103, prob:0.654)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL05	C2 domain-containing protein	Low	9.4	1	541-568	VLDCNKDAKKQQRMKKEQRERKEQEGDH	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMF3	Uncharacterized protein	Low	5	1	465-486	IAKISKTLQKRQMKNKDARTRL	plas(19),E.R.(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ30	Uncharacterized protein	Low	8.2	1	90-117	NLSACLKIAQRQRTRPKRYPPLRSATIV	mito(13),nucl(10.5),cyto_nucl(7),cyto(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN16	GED domain-containing protein	Low	9.9	1	107-128	TPESVAPRLRTRRRNRDYEQSD	nucl(18),cyto_nucl(13),cyto(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ25	WD_REPEATS_REGION domain-containing protein	Low	8.5	1	11-33	GFERDGNSRPRGRPNRRNATDIG	nucl(12.5),cyto_nucl(9.5),cyto(5.5),pero(5),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQW1	Cell division control protein 42 homolog	Low	9.4	1	177-197	AALEPPTVKKPKRKGKGCILL	cyto(18.5),cyto_nucl(13.833),nucl(6),mito_nucl(3.999)	KKPKRKGK (185-192, prob:0.785)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYH1	S5A_REDUCTASE domain-containing protein	Low	8	1	274-300	MAIWAQKKERRYRKELGGKYQKKRFAM	mito(10.5),cyto_mito(8.5),plas(8),cyto(5.5)	KKERRYRKELGGKYQKK (280-296, prob:0.727)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1T8	Flavoprotein domain-containing protein	Low	6.8	1	140-161	NPMTKKQLTKIRRKWNWIQVMQ	mito(8.5),cyto_mito(7.833),nucl(7.5),cyto_nucl(7.333),cyto(6),extr(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q202	DBF4-type domain-containing protein	Low	9.7	1	132-151	LESIRQWQKHYRRQFPQFVF	nucl(16),cyto_nucl(10),mito(8)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q240	Uncharacterized protein	Low	8	1	18-44	GESAVQRQARERREKRQKKMAEQGEDR	plas(15),cyto(4),mito(3),cyto_nucl(3)	RERREKRQKK (27-36, prob:0.744)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4C6	Uncharacterized protein	Low	7.3	1	349-372	FTNMVPKHLKKKSIRDMRVKGEGG	mito(11),nucl(7.5),cyto_nucl(7.5),cyto(6.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4S4	Lysophospholipase	Low	6.6	1	660-679	YESYQRKKAERQARVSNTVD	cyto(10.5),pero(10),cyto_nucl(8.5),nucl(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLZ5	Uncharacterized protein	Low	8	1	32-59	APTAIKEAKKRGKKKKVEKSKSTLTSKD	cyto(15),mito(9),cyto_nucl(9)	KEAKKRGKKKKVEKSK (37-52, prob:0.987)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2S0	Uncharacterized protein (Fragment)	Low	6.9	1	192-213	LQVHLLKRCKTRRSRERMCTAM	mito(14.5),cyto_mito(10),nucl(7),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNP1	Uncharacterized protein (Fragment)	Low	5	1	27-53	TTNQESYRKMCKKYNKAVKEKLAPTKY	plas(18),mito(4),E.R.(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGI8	Uncharacterized protein	Low	6.5	1	12-34	MHSTKQATLRKKRSSNWFKRKSG	mito(18),mito_nucl(13.333),nucl(6.5),cyto_nucl(5.166)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR67	Cytochrome b561 domain-containing protein	Low	5	1	379-398	YGENKRTKTRKLRSDSEGSH	plas(15),extr(5),mito(2),E.R.(2),golg(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZS8	1,4-alpha-glucan-branching enzyme	Low	6	1	176-199	WNPPTKYQFKHPRPPKPKSARIYE	cyto(12),cyto_pero(10.833),cyto_nucl(8.833),pero(8.5),nucl(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q457	G protein signaling regulator like protein	Low	5	1	389-412	EDEPWVPRYKKRNVIRKIFDREVW	plas(23),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI91	Uncharacterized protein (Fragment)	Low	5	1	1-20	RPLRPPSESRKVPRPRLFTQ	mito(23.5),cyto_mito(14)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBT7	Uncharacterized protein (Fragment)	Low	6.5	1	55-77	DRDWRFESKKKCHERHRLPYMHK	cysk(8),cyto(7),nucl(4),mito(4),mito_nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEC4	Uncharacterized protein	Low	9.6	1	173-192	EGQHRPAKRARTGERRWCAV	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI80	Uncharacterized protein	Low	8	1	288-310	VALWDAKSKRRIRQYPKLPASVL	cyto(14),cyto_nucl(9.333),cysk(9),cyto_mito(7.833)	GKPAKK (357-362, prob:0.663)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP36	Uncharacterized protein	Low	5	1	680-701	LRAFPSKKLRWREKSLWIHAPV	plas(24),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQP6	Uncharacterized protein	Low	6.5	1	423-443	TVTPNGTKKRVKNPIQPLPND	mito(16),nucl(4),cyto(3),extr(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUI5	MFS domain-containing protein	Low	5	1	296-315	APALLRRRGRKQRQESGNEK	plas(25)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVH2	Glycosyltransferase family 4 protein	Low	8.4	1	501-523	MERFGTIKQGRRRRREAGYLDND	plas(20),E.R.(4),nucl(1),pero(1),golg(1)	KQGRRRRR (508-515, prob:0.715)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIY7	Uncharacterized protein	Low	6.2	1	5-28	STDTPSTDLKPRPKTRRPFELGSA	plas(19),nucl(3),cyto(2),mito_nucl(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XM35	PH domain-containing protein	Low	7.8	1	40-68	SNGAAKPPKTLSKKHKHIRTPSSYTNPDH	mito(11.5),mito_nucl(11.5),nucl(10.5),cyto(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIH0	Uncharacterized protein	Low	9.2	1	555-579	ARPEIQPVPKRKSKWQPEPESEVAP	nucl(15.5),cyto_nucl(11.5),cyto(6.5),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDP8	Serine/threonine-protein phosphatase	Low	9.4	1	130-155	PPTQITDPKVKRKMKRRFQKDSAYTS	cyto(10),cyto_nucl(8.5),nucl(5),mito(5),plas(3),pero(1),golg(1),cysk(1),vacu(1)	KRKMKRR (140-146, prob:0.725)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHS1	Uncharacterized protein	Low	9.1	1	188-209	YDEFDRRARRRRDQVRINVIDT	nucl(14.5),cyto_nucl(10),cyto(4.5),mito(4),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNL4	L-ornithine N(5)-monooxygenase	Low	8.7	1	148-177	GCVGKELSKHQMKKKKKRSSRNDGEQAKPP	plas(6),golg(5),extr(4),cyto(3),E.R.(3),nucl(2),mito(2),mito_nucl(2),cyto_pero(2)	HQMKKKKKRSSR (157-168, prob:0.929)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRR6	Uncharacterized protein	Low	6.5	1	98-117	TGRHSEGRKHVKRLHDKNLC	mito(9),cyto(8.5),cyto_pero(6.5),nucl(5),pero(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW66	Uncharacterized protein	Low	5.8	1	24-50	RLQQETRSRSRSKKQEARHRQHFYTGR	cyto(20),cyto_nucl(12.5),nucl(3),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYK0	Uncharacterized protein	Low	8.9	1	686-708	ADYTTKRNTMRQKARNKAKKGLK	mito(16.5),cyto_mito(11.666),cyto_nucl(5.833),cyto(5.5),nucl(4)	RQKARNKAKKGLKIGSKSTGKKIELPLPSPPPPPRPKPAPELQIKRQK (696-743, prob:0.987)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5B2	Uncharacterized protein	Low	9.9	1	189-208	LSKKAHTAVKKRKHARHGLE	mito(21),nucl(5)	HTAVKKRKHAR (194-204, prob:0.777)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YPC5	Uncharacterized protein	Low	9.4	1	325-344	VDKARQEKANQDKARRNTLV	nucl(16),cyto_nucl(10.5),mito(4),cyto(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHJ2	Spindle pole body component	Low	6.1	1	42-67	RSLGKLSQLHRKLKRHLETIRNAHQS	cyto(7.5),cyto_nucl(7),mito(5),extr(4),nucl(3.5),plas(2),pero(2),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHQ2	Uncharacterized protein	Low	5	1	101-123	EQVPDRLKNSKKFRKSIWRFVDT	mito(15),cyto(5.5),plas(4),cyto_nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI83	Uncharacterized protein	Low	5	1	349-372	TTWMYELRPKQRHLRNQNAKEENG	mito(21.5),cyto_mito(12.5),cyto(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLG4	COP9 signalosome complex subunit 3	Low	8.1	1	8-27	LSFPPEKKKKEMTAREYDKE	nucl(13.5),cyto_nucl(11.333),cyto(8),cyto_mito(6.833),mito(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNQ0	37S ribosomal protein S25, mitochondrial	Low	9.9	1	46-67	QPLQRRQQPGAKPPRKRSRLFQ	mito(14.5),cyto_mito(10),nucl(7),cyto(4.5)	PGAKPPRKRS (54-63, prob:0.759)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT56	ABC transporter-like protein	Low	5	1	1561-1580	VNRVKAPFKRSGKKGEQQEG	plas(27)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUH2	DNA-directed RNA polymerase subunit	Low	7.6	1	151-172	IIKKISGECRKVKRCPHCESYN	cyto(13),nucl(7),pero(4),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX37	Uncharacterized protein	Low	9.9	1	538-557	AQNVRLKAIRKRAKMNDEED	nucl(19),cyto_nucl(13.5),cyto(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX68	DUF2235 domain-containing protein	Low	9	2	463-482, 563-584	TWQPYVRTYRPQRKKLLGGY, YSNNRWTWFKKVSRENKIAKTF	cyto(8),pero(6),cyto_mito(6),nucl(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2R4	Uncharacterized protein	Low	8.4	1	737-763	AILGCLLRCCKRRRRGVKRVASGPPAP	extr(24),nucl(1),mito(1),plas(1),mito_nucl(1)	RRRRGVKRV (748-756, prob:0.76)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WHW3	Uncharacterized protein	Low	5	1	290-311	AATPSNKKSKNKVLVRERDVQE	extr(24),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4B6	Zn(2)-C6 fungal-type domain-containing protein	Low	8.2	1	178-202	SSCLQCEKAKRPCRKAPSHQSQSEA	plas(17),nucl(8)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIC9	Uncharacterized protein	Low	9.7	1	216-240	KASQTTKLRKEKERKEKAKNRQFTY	mito(15),cyto_nucl(5.5),nucl(5),cyto(4)	LRKEKERKEKAKN (223-235, prob:0.868)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YK51	Uncharacterized protein	Low	6.7	1	1-21	MMEKLRQIRHRGQHEKHHVDV	cyto(8.5),mito(8),cyto_nucl(7.5),nucl(5.5),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHN5	Ubiquitin carboxyl-terminal hydrolase	Low	6.1	1	590-612	LQALRNRGSRRKGNERWWRISDD	extr(9),cyto(4),golg(4),nucl(3),E.R.(3),mito(1),plas(1),pero(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMR5	ABC transporter-like protein	Low	8	1	1496-1515	FFYWLVRVPKKKGSKKEKKT	plas(23),mito(3)	PKKKGSKKEKKT (1504-1515, prob:0.955)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVA4	Uncharacterized protein	Low	9	1	379-402	EDYTEYKRLRREHHDKKDGRPPSI	nucl(13),pero(5.5),cyto_pero(5.5),cyto(4.5),mito(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3U1	Dolichyl-diphosphooligosaccharide--protein glycotransferase	Low	8	1	736-762	QEATAFEKGNKRKKAGKRRGPRVLRVD	plas(24),E.R.(3)	KGNKRKKAGKRRGPRV (743-758, prob:0.986)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4K3	Vacuolar proton pump subunit B	Low	8.8	1	480-500	DQYYQRQSKKGNKDTQDNSEE	nucl(15.5),cyto_nucl(14.5),cyto(10.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3K1	Zn(2)-C6 fungal-type domain-containing protein	Low	9.7	1	9-55	VPSERACDRCRERRVKCDKRQPTCLRCEKLGKPCPGYDKKRKFVDEG	nucl(18),cyto_nucl(12),cyto(4),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF40	Uncharacterized protein	Low	8.8	1	76-96	ELSRTDKKKWQYTRSLAKKAV	mito(12),nucl(10),cyto(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHR0	TFCD_C domain-containing protein	Low	9.1	1	31-60	LYKSSPIDSRIKRVHKRVKRRDLDHVVNLI	cyto(11),cyto_nucl(8.5),mito(5),nucl(4),extr(3),pero(2),E.R.(2)	KRVHKRVKR (42-50, prob:0.701)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSD7	BTB domain-containing protein	Low	8.9	1	289-309	KGLSRRTSKTSHKDSRYCPCC	nucl(14.5),cyto_nucl(14),cyto(8.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT83	Uncharacterized protein (Fragment)	Low	5.4	1	101-120	VQSVSRRRTGHRRGQSRWSL	plas(11),mito(8),extr(5),nucl(1),E.R.(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXV4	Uncharacterized protein	Low	8	1	184-204	LTSYFAKKKIRKTRNLLGSTN	plas(18),E.R.(5),golg(2)	KEKASARKRKN (656-666, prob:0.851)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0D2	Glutamate decarboxylase	Low	9.3	1	157-176	ATLAMKKRWANKRKAEGKDF	cyto(13.5),cyto_nucl(10.833),cyto_pero(10.166),nucl(6),pero(5.5)	KRWANKRK (163-170, prob:0.656)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIB5	Uncharacterized protein	Low	5	1	35-55	MPNGLKQREKERKQQRGSSYE	cysk(12),cyto(5),pero(5),cyto_pero(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIJ4	Peptidase A1 domain-containing protein	Low	8.7	1	433-457	VWWFLFRNRKGRRSRKSKSQSYGTG	extr(11),plas(5),mito(3),nucl(2),cyto(2),cyto_nucl(2),golg(2)	NRKGRRSRKSK (440-450, prob:0.834)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLP9	Uncharacterized protein	Low	8.9	1	7-34	MSKLAISYSPKKDKSKRRTCPSLPNEIW	nucl(12.5),mito(11),cyto_nucl(8.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFZ2	Uncharacterized protein	Low	9.5	1	136-157	AAVLKSTKTRKRKGSLRKTALL	cyto(8.5),cyto_nucl(7),nucl(4.5),plas(4),mito(3),extr(2),pero(2)	KTRKRKGSLRKTALLGGRR (143-161, prob:0.893)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMU3	Uncharacterized protein	Low	8.2	2	79-104, 434-459	GQGCPLRCVLQRKRPQHRSGRPDALP, VLCLSRPYWTKWRQRRPLTNIREDMA	plas(18),mito(4),nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNZ2	Uncharacterized protein	Low	8	1	17-49	KKRSKQARAHVARVNRQRQKQERQEQKRDSETA	mito(8),cyto(8),cyto_mito(8),extr(4)	KRSKQARA (18-25, prob:0.65)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPQ5	ATPase_AAA_core domain-containing protein	Low	8.4	1	316-337	VAALKSREDKRRKQRHVHDDDA	nucl(11.5),cyto_nucl(9.5),cyto(6.5),mito(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR23	Uncharacterized protein	Low	5	1	407-430	GNTIEEVRKQYRRRKARAEFITFH	extr(11),E.R.(5),golg(5),cyto(2),plas(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1P0	Uncharacterized protein	Low	5	1	628-648	EETAGERKKWRQQINKELEPE	mito(13),extr(7),cyto(5.5),cyto_nucl(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD96	AB hydrolase-1 domain-containing protein	Low	9.2	1	78-102	SRDSFECRFGRRKRDRQQVHECDDL	nucl(15),cyto_nucl(11.5),cyto(6),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJC4	F-box domain-containing protein	Low	8.5	1	207-228	LPSNRAPTKRRWSKEHRPSRLQ	nucl(11.5),mito(10),cyto_nucl(8),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLF8	FAD_binding_3 domain-containing protein	Low	5.4	1	513-533	AYDKIRRPRSQHQVDLSRKHG	mito(13),cyto(5),plas(5),nucl(1),pero(1),E.R.(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPA5	Uncharacterized protein	Low	8.1	1	6-31	IWPRLSKTSKCLWKRRQSDDTRQELA	nucl(11),mito(9),cyto_nucl(8.333),cyto(3.5),cyto_pero(3.166)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPR7	Putative phospholipase	Low	5	1	105-129	HPANKGARSSKPKHKWFPKPISLTA	plas(8),mito(7),cyto(3),extr(2),cyto_nucl(2),golg(2),vacu(2),cyto_pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ07	MYND-type zinc finger protein samB	Low	5	1	238-273	HGQALLKCSKCKKRCYCSKDCQKEHWKNHRGFCRAP	cyto(9),cysk(9),mito(4),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSW1	Uncharacterized protein	Low	7.3	1	115-140	LERRKQEVMKAKQKRIKEQFQVHACD	mito(16),nucl(6),cyto(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUG4	Phosphatidate cytidylyltransferase	Low	5	1	1-21	MTKPKKDVKFNHRERRLSKSS	plas(24),mito(1),pero(1),E.R.(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWD8	Uncharacterized protein	Low	9	1	88-111	IKALKEPPRDRKKEKNIKHTKSVP	cyto(12),cyto_mito(11.332),cyto_nucl(10.666),mito(9),mito_nucl(8.332),nucl(6)	KEPPRDRKKEKNIK (92-105, prob:0.811)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWK1	Uncharacterized protein	Low	5	1	691-711	VFSQVWLRRRRPNIYNKYNYL	plas(23),E.R.(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY13	Uncharacterized protein	Low	5	1	45-65	IAPGTKTEKIQRKSYRHCETR	mito(12.5),cyto_mito(11.833),cyto(10),cyto_nucl(7.833)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2E1	DUF202 domain-containing protein	Low	5	1	2-33	RACRCQCQRACTSPRKRCGPNRRRGVRANADS	plas(21),mito(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4M3	Uncharacterized protein	Low	5	1	65-84	QTYLDCTKRVKKCTQRQWFI	plas(16),mito(6),E.R.(3),cyto_mito(3),mito_nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKL7	Glycosyltransferase family 90 protein	Low	5	1	72-92	AAQYRSRRGRHPPPGFDKWYE	extr(14),golg(5),mito(4),plas(2),E.R.(2),cyto_mito(2),mito_nucl(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH78	Uncharacterized protein	Low	7.7	1	77-98	FHLHGKRTRRGRMTNRVRVRLP	cyto(8.5),nucl(8),mito(6),cyto_pero(5.5),extr(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLD6	TRP_N domain-containing protein	Low	8	1	610-636	AIITCVKENPHRKKRKEQEKLERDLDN	plas(23),E.R.(3)	RKKRK (621-625, prob:0.688)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTG3	Uncharacterized protein	Low	6.8	1	310-332	TGDLHKKELRFRNTKRPKMRCLA	cyto(10.5),mito(7),cyto_pero(7),nucl(6),pero(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ47	F-box domain-containing protein	Low	7.3	1	109-130	NDGERWQKLYRRLRTQARIFTW	mito(11),nucl(7.5),cyto_nucl(6),pero(4),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q335	Zn(2)-C6 fungal-type domain-containing protein	Low	8.6	1	42-68	AHTLTACTRCRQRKTRCDPGLPRCTPC	mito(16),nucl(9)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YPL4	Uncharacterized protein	Low	8	1	65-86	DPAGNARKRKRELPPSRYNFRP	mito(18),cyto(7)	RKRKRE (71-76, prob:0.733)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCU8	Valyl-tRNA synthetase	Low	9.4	1	88-113	AMSAASQPKQKEKKKQEILPPYKEET	cyto(11.5),cyto_nucl(9.833),cyto_mito(7.166),pero(7),nucl(6)	RELAKERAKADKLAKLAAKQEKQKAMSAASQPKQKEKKKQEILPPYKEETKKGDKK (64-119, prob:0.934)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPX5	Uncharacterized protein	Low	5	1	520-539	LVYGRWYKRKATKNSKEGEG	E.R.(8),extr(5),cyto(4.5),mito(4),cyto_nucl(3.5),pero(2),golg(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXA6	Uncharacterized protein	Low	8.8	1	278-299	EGDRKDRKKLGLPRRRGGAKKN	plas(13),mito(5),cyto(4),nucl(2),pero(2)	DRKDRKKLGLPRRRGGAKKNL (280-300, prob:0.98)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY15	Zn(2)-C6 fungal-type domain-containing protein	Low	8.5	1	1-27	MDDRAPNKRQKRRAVACERCNKQKIKC	nucl(12.5),cyto_nucl(10),cyto(6.5),mito(4),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0C3	HD domain-containing protein	Low	8.6	1	209-229	KTETGKRLARERTQRLKEFRE	nucl(13.5),cyto_nucl(12.5),cyto(8.5),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y2	Uncharacterized protein	Low	7.7	1	48-70	TIVACPRRRKSHPKNHLSRHDPS	mito(9),extr(9),nucl(8.5),cyto_nucl(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q563	Uncharacterized protein (Fragment)	Low	5.8	1	40-65	ELQNIIRNRFKRHRHNTSHRQLKICF	mito(21),cyto_mito(13),nucl(3),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNN6	Uncharacterized protein	Low	8	1	263-287	GVETRKERNRRLSLARFGRKKRDDD	plas(24),mito(1),E.R.(1),vacu(1)	RNRRLSLARFGRKK (270-283, prob:0.685)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y420	Uncharacterized protein	Low	9.3	1	106-129	CQMPTYKCRGKGRVKNFQPKIRPL	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL93	Uncharacterized protein	Low	7.2	1	20-54	VISPASHCKHCKHCKHCKHRKHPRREKTDIRQGMA	mito(21),nucl(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLY8	Uncharacterized protein	Low	8	1	506-528	KSNFAQKAKKWFTKKRGRSLAIP	plas(25)	KKWFTKKRG (514-522, prob:0.666)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIZ7	Carbohydrate-binding module family 14 protein	Low	8.7	1	133-162	NKPVAKPVKRPVKKPVKKKGGKKQGSGGTA	mito(12),extr(9),cyto(3),nucl(2),cyto_pero(2)	NKPVAKPVKRPVKKPVKKKGGKKQG (133-157, prob:0.996)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKF7	Uncharacterized protein	Low	9.3	1	462-483	LGAPKARAPKKLRKGKTPAMLW	cysk(8),nucl(5),mito(5),cyto(5),cyto_nucl(5),cyto_mito(5),mito_nucl(5)	PKARAPKKLRKGKTP (465-479, prob:0.945)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLL2	Uncharacterized protein	Low	9.9	1	39-60	ERMSLTKPGKWRKVRNSSAHEK	nucl(17.5),cyto_nucl(10),mito(8)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLT5	Uncharacterized protein	Low	5	1	269-290	RPGMLQCRRSKIKRIKTVLLHT	cyto(16),cyto_mito(12.833),cyto_pero(9.833),mito(8.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSK0	Phosphatidylinositol 3-kinase VPS34	Low	7.8	1	159-181	SNTTTPWQEPRKRGRRGQAEEPV	cyto_nucl(11),nucl(10.5),cyto(10.5),pero(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW71	Uncharacterized protein	Low	5	1	3-23	LSSLKRKANSPPENPPVRKKS	mito(24.5),cyto_mito(13)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXW3	Uncharacterized protein	Low	5	1	644-669	PDLLWHWRRHAPKRVRYKTPTGYVKI	mito(20.5),cyto_mito(13),cyto(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLS0	Maintenance of mitochondrial morphology protein 1	Low	7.5	1	460-482	READERDRRKQLRREDSSLRLRT	plas(9),nucl(7),cyto(4.5),cyto_mito(3.5),extr(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD49	Component of oligomeric Golgi complex 3	Low	9.8	2	10-31, 78-97	TSTPALAKEKPQHRRRASLLQQ, ASTRKECPLRRRDSLTERRL	nucl(9.5),cyto_nucl(9.5),cyto(8.5),mito(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFN6	Uncharacterized protein	Low	8	1	407-431	ESSGPGRRDSVRRRRGRQGGSGAKV	plas(17),mito(2),cyto(2),extr(2),E.R.(2),cyto_mito(2)	RRDSVRRRRGRQGGS (413-427, prob:0.827)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU77	Uncharacterized protein	Low	8.8	1	242-264	TEEVNKLRKGKKEQKEQGTQAEN	extr(9),E.R.(7),cyto(4),nucl(2),pero(2),golg(2)	K (207-207, prob:0.602)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXH1	Uncharacterized protein	Low	9.6	1	1192-1213	ANTQKAKKLGFFRRNRKVDPYA	nucl(12),mito(10),cyto(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0P0	ERF-3	Low	9.1	1	636-663	GALLHKLEPKTNRKSKKPPGFAKQGMNI	cyto(14),cyto_nucl(10),pero(5),nucl(4),mito(2)	RKSKKP (648-653, prob:0.683)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT20	Uncharacterized protein	Low	5.7	1	17-39	RRYSASSTTKSRRSRRNVWMALL	mito(10),plas(8),nucl(2),cyto(2),cyto_nucl(2),pero(2),E.R.(2),cyto_pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU55	DNA-directed RNA polymerase subunit beta	Low	7.9	1	1206-1230	IASLKKQQFECRPCKNKTRIAQIII	nucl(10.5),cyto_nucl(9.5),cyto(7.5),cysk(5),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVH5	Uncharacterized protein (Fragment)	Low	8	1	37-58	VEDPRRPGKLKKVKKQIPAYIP	plas(13),cyto(7),mito(4),E.R.(2),mito_nucl(2)	RRPGKLKKVKK (41-51, prob:0.776)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVK8	Aldehyde dehydrogenase	Low	5.5	1	20-44	TYATFKTKDIRWRKWQLKQLWWLLV	cyto(9.5),plas(7),cyto_nucl(6),mito(4),extr(3),nucl(1.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVT5	RNase III domain-containing protein	Low	5	1	31-53	STAHETRPRRDIRRQHLPSQRHS	mito(22),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVU7	Uncharacterized protein	Low	5	1	431-459	EPPKMPSLLRPTPKRQRSRQGLLKNQAVQ	extr(12),mito(6),plas(4),cyto_mito(4),mito_nucl(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXG3	MFS transporter-like protein	Low	7	2	3-24, 621-641	HPTSNLARAKRERKLPVQQLSI, DSANRTLSRRNSRRTMHKMSI	plas(19),mito(4),E.R.(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2M5	ELMO domain-containing protein	Low	5.6	1	267-287	AANGVKPRKHHPEKWRRLGFE	cyto(8),cyto_nucl(6),plas(4),extr(4),mito(3),nucl(2),E.R.(2),golg(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHC2	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	1	1-37	MSYARVKRTHRKSRLGCLTCKQRRVKCDETRPQCLKC	nucl(13),mito(13),mito_nucl(13)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y349	PALP domain-containing protein	Low	5	1	1-23	MGAQRLKTPPKQRPWRETPLIES	mito(25)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCW2	Uncharacterized protein	Low	6.1	1	67-89	LLQPCSDKTRHRHRHPLRALHVR	mito(18.5),cyto_mito(11.833),cyto_nucl(4.833),nucl(4.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR24	Oxidored_q6 domain-containing protein	Low	5	1	223-242	IFQLQKKMRHTKITRMWYRK	mito(23.5),cyto_mito(13)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVI5	Uncharacterized protein	Low	5	1	60-87	SSNVTPLPRRPSKQQQQQQQQPRQEPAR	plas(20),mito(4),E.R.(2),cyto_mito(2),mito_nucl(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVW0	Uncharacterized protein	Low	5	1	222-243	GEGRPWRIMKKEKEKEGQTKTL	mito(23),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWN9	Uncharacterized protein	Low	6.8	1	4-24	RGTLQRKHTRHSSARKQAAKL	mito(21),nucl(5.5),cyto_nucl(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ27	PH domain-containing protein	Low	9.2	1	40-61	WLNSHRKQWYRQYVRSTAKRQP	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q531	V-type proton ATPase subunit H	Low	8.4	1	34-56	DEDLKKIKAIDKVRKEQRKATIE	nucl(11.5),cyto_nucl(9),mito(8),cyto(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFN5	Uncharacterized protein	Low	8.5	2	413-436, 473-495	GSRVDDWNKWTRRRRWIRDAELVE, STAVKKKGWFGRRRLTNEKIRAI	plas(20),nucl(4),cyto(1),E.R.(1),golg(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQE1	Uncharacterized protein	Low	9.3	1	25-51	TTSQRYTVRPSERRRNKKKLSISHYTC	plas(9),cyto(5),nucl(4),mito(4),mito_nucl(4),cyto_pero(4)	RRRNKK (37-42, prob:0.668)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTH8	Uncharacterized protein	Low	8.5	1	305-325	GWQPRRLRRSRDHTWAGPKRP	nucl(11.5),mito(10),cyto_nucl(8),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWW9	C6 transcription factor-like protein	Low	8.9	1	21-47	TGLHLACRECQRKKIKCDRTYPCGQCT	nucl(12.5),cyto_nucl(8.5),pero(7),mito(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY59	Uncharacterized protein	Low	6.6	1	64-83	DTVRDFRKKLGERVRNNARY	cyto(11),cyto_nucl(9.333),cyto_mito(6.833),nucl(6.5),pero(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3V6	TGc domain-containing protein	Low	8.8	1	450-469	QEEHRLRLREARRNQDQQQR	nucl(12.5),cyto_nucl(8.5),mito(8),cyto(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKF4	DUF1996 domain-containing protein	Low	5	1	482-503	APGYDSKHKRHLEKHQHRHARL	extr(18),mito(5),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YPU0	Protein kinase domain-containing protein	Low	6.8	1	242-263	YSTGDKDSWHRHHKNKFPQEFW	cyto(6.5),cyto_nucl(6.5),nucl(5.5),mito(5),extr(3),plas(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC24	Uncharacterized protein	Low	7	2	61-82, 218-242	LSTRRRRPPTLHQLRAKQRRPT, SRCCNYRHSFAKTRHPKRRDDVLEP	extr(15),plas(8),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL29	Uncharacterized protein	Low	5	1	536-560	AFLPKTISGKIQRKKLKQLEWETVG	pero(13),cyto(10.5),cyto_nucl(8.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY70	Uncharacterized protein	Low	9	1	124-143	TDLPRWRNARHNKKAGPIED	nucl(14.5),cyto_nucl(11.5),cyto(7.5),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGG2	Uncharacterized protein	Low	8.8	2	73-93, 372-398	SSTGHTKRQLRSCRRTHDQSN, LPGKALTCKWHHKCKQCVITRRHGPVI	mito(9),cyto_nucl(8.333),mito_nucl(8.333),cyto(8),nucl(7.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y489	Uncharacterized protein	Low	8	1	218-237	RFAAWRKSALRKARNVERRA	mito(21.5),cyto_mito(13),cyto(3.5)	NDRFAAWRKSALRKARNVERRAMGRGGKKVKK (216-247, prob:0.989)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIF9	Uncharacterized protein	Low	8	1	229-255	WVIFFYRRIKRKREERRRGKEEKEETV	plas(13),extr(7),E.R.(5)	RRIKRKREERRRGKEE (235-250, prob:0.965)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDF9	Uncharacterized protein	Low	8.6	1	2-21	AENDEKGKKRERDDDPRGKI	nucl(14.5),cyto_nucl(11.333),cyto(7),cyto_pero(5.333),pero(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV28	Uncharacterized protein	Low	5	1	455-476	LLGWLQQRKDRKQARKRLEEGF	plas(22),E.R.(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV80	Aldedh domain-containing protein	Low	5	1	55-78	EAAHKAFKSWKKTKPSQISQILNK	cyto(24.5),cyto_nucl(13)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX08	Glycoside hydrolase family 16 protein	Low	5.6	1	18-39	WDDDRKFKPTLRERFNKDNVIN	plas(12),mito(4),extr(3),golg(2),vacu(2),nucl(1.5),cyto_nucl(1.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX85	Uncharacterized protein	Low	8	1	173-198	VVEKEPRRNLFKRRHKPSHEVERTNA	plas(21),vacu(3),E.R.(2)	KRR (184-186, prob:0.627)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZX4	ABC transporter-like protein	Low	5	1	690-711	SLLRPKGKRKTSIRQQQERQLF	plas(15),extr(5),E.R.(3),mito(1),pero(1),golg(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0T9	DAO domain-containing protein	Low	6.2	1	42-71	QIKTCKCKICDERVKKFCHRCKSCGRRICS	mito(15),cyto(5.5),cyto_nucl(5),nucl(3.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2X3	VHS domain-containing protein	Low	9.1	1	50-69	AARALRKKLKYGNAHRQIRS	nucl(15),cyto_nucl(11),mito(6),cyto(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4N4	Uncharacterized protein	Low	5	1	51-71	LLDPKASKTKHPREHSWNATG	extr(21),mito(2),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDF2	Uncharacterized protein	Low	6.2	1	45-72	CRERLHRMRTVCNKKWRTKDNEEKLYLE	cyto(9),cyto_mito(8.333),cyto_pero(7.833),mito(6.5),pero(5.5),nucl(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHK3	Zn(2)-C6 fungal-type domain-containing protein	Low	8.2	1	2-25	RSSIACIRCRRSKVKCVNNGVGTT	mito(13),nucl(9),cyto(2),pero(2),cyto_pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQY8	Zn(2)-C6 fungal-type domain-containing protein	Low	8.4	1	47-74	RSPTQPTTRVRAKHRRSRNACQECHVRK	plas(11),nucl(10.5),cyto_nucl(7),cyto(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUL7	BTB domain-containing protein	Low	7	1	15-40	SFSYKPEKSMSKKQRSFKEYPPTRRI	mito(14),nucl(6.5),cyto_nucl(6.5),cyto(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1D3	Uncharacterized protein	Low	8.5	1	455-476	VVKAQKTKPSTRPDQKSNWSHG	nucl(13),cyto_nucl(12.5),cyto(10),mito(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKR6	Uncharacterized protein	Low	9.4	1	228-252	RYDVKMEEAKRKKKERASFASSRKS	cyto(11.5),cyto_mito(8.5),cysk(6),nucl(5),mito(4.5)	AKRKKKERASFASSRK (236-251, prob:0.907)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLC1	Uncharacterized protein	Low	7.7	1	266-285	STSQRIRGEQRGRKRCARGW	mito(15),nucl(8.5),cyto_nucl(6),cyto(2.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSG7	Histone acetyltransferase type B catalytic subunit	Low	8.6	1	383-406	AANRSRSRITKREKAKNDNDRAYF	nucl(13.5),cyto_nucl(13),cyto(11.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2R7	Uncharacterized protein	Low	7.8	1	34-57	VSAPKTTRKALRPYKPRQSLKPGT	nucl(13),cyto_nucl(12.833),cyto(11.5),mito_nucl(8.333)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJB1	G-patch domain-containing protein	Low	9.1	1	3-30	ERATYRPPRSDYRQERERKSDRHQSSND	nucl(15.5),cyto_nucl(12),cyto(5.5),mito(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJJ8	Uncharacterized protein	Low	6.2	1	29-55	NEVLCPNTNKHNPQKYHKSCLRQNDGI	mito(15),cyto(6),nucl(3),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC72	Polyketide synthase-like protein	Low	5.5	1	1654-1676	PTAVTATKKPKQRKATPPQASGG	plas(17),E.R.(3),cyto(2.5),cyto_nucl(2.5),nucl(1.5),mito(1),pero(1),golg(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD21	Uncharacterized protein	Low	7.8	1	6-25	KTTTKKPSLLSRLRNKNQAK	mito(12),nucl(10),cyto_nucl(8.5),cyto(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF32	Uncharacterized protein	Low	7.1	1	240-263	KIMTKVRRQRIVKQYQRQHREKGF	cysk(10),nucl(6.5),cyto_nucl(5.5),cyto(3.5),mito(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF99	Uncharacterized protein	Low	7.3	1	1-20	MPISKKDRVRKEQKKADAAG	mito(14.5),cyto_mito(9.166),nucl(9),cyto_nucl(6.833)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJS2	Uncharacterized protein	Low	8	1	285-304	PDRLPAKRPQCKPHKADKAY	plas(24),vacu(3)	KKKRK (732-736, prob:0.695)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL96	Uncharacterized protein	Low	8.4	1	151-171	AQCQYERKYKKSRQYATEKEL	nucl(14.5),cyto_nucl(12.333),cyto(9),cyto_mito(6.333)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS72	Uncharacterized protein	Low	5	1	25-44	RYAATTPRRRHESKRWQSTE	mito(24),cyto_mito(14.833),mito_nucl(12.999)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTH2	CID domain-containing protein	Low	9	1	409-432	GGSSSDPRLKRRKLSHPSKDVDDE	nucl(14.5),cyto_nucl(12.5),cyto(9.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTV7	Uncharacterized protein	Low	5.8	1	783-803	ITLFGPIKRVSRKRKEFADVV	mito(19.5),cyto_mito(12),cyto(3.5),nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTV9	alpha-1,2-Mannosidase	Low	5	1	113-132	ASGERDKKDKRDPLRDFQDG	extr(22),E.R.(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWP2	Uncharacterized protein	Low	9.3	1	70-89	EKEARKRKSLREWDRLQRES	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(2),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y088	C2H2-type domain-containing protein (Fragment)	Low	8.1	1	391-415	SGDVCTRIVRRSRSRRHASRYTAAP	nucl(10.5),cyto_nucl(8.5),extr(7),cyto(5.5),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMB2	Uncharacterized protein	Low	8	1	93-120	VLVKVTVPKRTGRKRKRGSREPYCEVEE	cyto(12),cyto_mito(11.833),mito(10.5),cyto_nucl(8.833)	PKRTGRKRKRGS (100-111, prob:0.921)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKG9	Uncharacterized protein	Low	9.8	1	64-98	VVAAKRVTRKRKAGDDKAATPKKKKRNESLFSNEP	cyto(12),cyto_nucl(10),nucl(6),mito(6)	KRVTRKRKAGDDKAATPKKKKR (68-89, prob:0.965)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR73	Uncharacterized protein	Low	9.6	1	33-55	QVQPDRIRIKNRRKRYLDLHPEY	nucl(12),cysk(7),mito_nucl(7)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW84	SurE domain-containing protein	Low	5	1	256-277	AAPPRRNSWRHRHFKWAPRFTD	cyto(11.5),cyto_mito(9.166),cyto_nucl(8.333),cysk(6),mito(5.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZK6	Uncharacterized protein	Low	7.3	1	26-49	LPSLACCRRRKVKRVWNALRWKAV	mito_nucl(10.666),nucl(10.5),mito(9.5),cyto_nucl(9.333),cyto(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZM8	O-acyltransferase	Low	8	1	74-96	KATSAARRANRRATRRRIFPTVD	plas(19),E.R.(3),vacu(3)	RR (84-85, prob:0.601)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZQ3	Uncharacterized protein (Fragment)	Low	9.3	1	108-141	DDAGSRRKSYAHKKRLSRRQSVRSVRSKKTKSLL	cyto(8.5),cyto_nucl(7),mito(6),nucl(4.5),plas(4),extr(2),pero(2)	RRKSYAHKKRLSRRQSVRSVRSKKT (113-137, prob:0.915)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2J0	Uncharacterized protein	Low	5	1	195-219	LSSWMKVQQRLNRRRQRSLLLCFRE	plas(13),mito(8),extr(3),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGK0	Uncharacterized protein	Low	5	1	672-692	WGAWKYTKKDWLKKINWPLIF	plas(27)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLT5	NAAA-beta domain-containing protein	Low	5	1	353-372	EGKNRRLCAHHNYHNRRREH	mito(14),plas(4),cyto(3),extr(2),E.R.(2),cyto_pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNB4	Decapping nuclease	Low	8.6	1	357-380	SEEYDRKIISQRFRRHRENFSFED	nucl(12.5),cyto_nucl(11),cyto(8.5),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFY8	Polynucleotide adenylyltransferase	Low	9.1	1	778-800	LGSSAAKTKSQRKKGQETGSISG	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(3),pero(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPV2	Uncharacterized protein	Low	8.2	1	6-25	TAPARVKHYKRNSAEPKTKT	nucl(11),cyto_nucl(8.5),mito(7),cyto(4),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQR2	Glycerol kinase	Low	5	1	487-510	QMDGKSSKKMFRKWERAVRMCKGW	cyto(16.5),cyto_nucl(9),pero(5),cysk(5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU72	Uncharacterized protein	Low	8	1	211-230	PPAPPPKSSTRQKVEKHRAV	nucl(10.5),cyto_nucl(9),cyto(6.5),mito(5),pero(2),cysk(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2I1	Uncharacterized protein (Fragment)	Low	8.8	1	125-147	LWEGRKKRDAKRAAKAEERRLKD	mito(11.5),cyto_mito(10.833),cyto(9),cyto_nucl(6.833),nucl(3.5)	RKKRDAKRAAKAEERRLK (129-146, prob:0.928)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK39	Uncharacterized protein	Low	6.1	1	1-20	MKLCHRSCRWRVHARRPALV	mito(19.5),cyto_mito(11.333),nucl(4.5),cyto_nucl(3.833)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMA3	AAA domain-containing protein	Low	6.7	1	140-161	LFADCLPNRKKRRSHFNTFMLE	cyto_mito(9),mito(8.5),cyto(8.5),nucl(6),cysk(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSU0	AB hydrolase-1 domain-containing protein	Low	6.2	1	8-28	HSLARHTPKALRKTNARSRFA	mito(21),nucl(3),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZP7	Uncharacterized protein	Low	8	1	13-39	LAQGQSSTPRNRKERRADAKQNGKPIE	plas(18),mito(4),cyto(3)	NRKERRADAKQNGKPIEAPTSHPKLKLAQPDRSRP (23-57, prob:0.758)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q367	Sec39 domain-containing protein	Low	6.9	1	230-253	GPWMYGHTERKRRRLNQEHQDPID	cyto(10),cyto_nucl(9.5),nucl(7),mito(4),pero(2),plas(1),extr(1),E.R.(1),cysk(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y328	Uncharacterized protein	Low	8.3	1	77-100	REEWFVRTRKPSKRREYSRVHSSI	cyto_nucl(13),nucl(12.5),cyto(12.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP93	Uncharacterized protein	Low	5	1	1-25	MANHHVRGRCNRSPTRRCAHRTTPG	mito(14),plas(5),golg(3),cyto(2),pero(1),E.R.(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR25	AlcB domain-containing protein	Low	7.8	1	65-87	ADDLKARHIHRFKRPTLRNDHLF	nucl(9),mito(5),cyto(5),cyto_mito(5),cysk(4),cyto_pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSL0	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	1	30-51	GACERCRSKKIKCDGERPCSTC	nucl(12),cyto(12),cyto_nucl(12)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVI3	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	5-32	GKPSAGCENCRKAKKRCGLEQPACERCV	nucl(14.5),cyto_nucl(8.5),mito(6),pero(4)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY92	Fatty acid hydroxylase domain-containing protein	Low	5	1	436-458	AEELKARTRLRQFPRKRTTSSGM	plas(21),pero(2),E.R.(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q487	Protein kinase domain-containing protein	Low	8.6	1	315-336	KEVQREMYRRVQRKARRTEGSG	mito(13),nucl(9),cyto(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y304	Uncharacterized protein	Low	5	1	121-143	SKQTLKQKYQQGKKQRREQKGGV	extr(16),mito(6),cyto(3),mito_nucl(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCF2	RF_PROK_I domain-containing protein (Fragment)	Low	8	1	168-192	EAAGRRKMKEFQSRKKSARRGGGGR	mito(25)	AGRRKMKEFQSRKKSARRGGGGR (170-192, prob:0.954)
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLT9	Uncharacterized protein	Low	8.3	1	475-495	DDPIRSRQSKKRRCGLAEGAV	nucl(11.5),cyto_nucl(11),cyto(9.5),mito(3)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQF2	ENTH domain-containing protein	Low	7.8	1	163-183	GEPSHEQRRHQQRRNQRPDDD	mito(11),nucl(7),cyto(5),pero(2)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRC7	Glycosyltransferase family 69 protein	Low	6.4	1	66-88	SGSSLRTRYTPRRRRSLLCRAVQ	plas(7),mito(5),cyto_nucl(5),nucl(4.5),cyto(4.5),golg(2),pero(1),E.R.(1),cysk(1),vacu(1)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVU4	Uncharacterized protein	Low	8.3	1	1118-1142	VPRFDKSGNTRSKQRARKLQLGDID	nucl(12.5),cyto_nucl(11),cyto(8.5),mito(6)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY34	HET domain-containing protein	Low	9.4	1	52-76	PDDIRCSMHRHSRRRSNKRYIALSY	nucl(16.5),cyto_nucl(13.5),cyto(7.5)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0A9	PKS_ER domain-containing protein	Low	5	1	13-34	EDQKQWQQFKKQEFKLKPFEDR	cyto(25)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q368	2-oxoisovalerate dehydrogenase subunit alpha	Low	5	1	16-40	AQGTLRSKTRPGKCSNCQQRWNSVS	mito(24.5),cyto_mito(14)	
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q522	Uncharacterized protein	Low	7.5	1	5-29	EDSAKSKLSKRHARLRKQYEDIRTH	nucl(8.5),cyto_nucl(7.5),mito(6),pero(6),cyto(5.5)