ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KWN4	Ricin B-type lectin domain-containing protein	Low	9.6	1	166-194	IDEDFFPRRNSPRKKSRKNCRSEDDDDDD	E.R.(10),nucl(4.5),golg(4),cyto_nucl(3.5),mito(2),extr(2),pero(2)	SPRKKSR (176-182, prob:0.698)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KYK6	Uncharacterized protein	Low	9.8	1	15-38	MNFLKQQSLKQRLERNIRNKEAQN	nucl(18),cyto_nucl(12.5),cyto(5),plas(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M1X1	Importin (Fragment)	Low	9.1	1	363-391	TKRFFSTTFNKKKEFKRVHDKKICVRFLG	nucl(15.5),cyto_nucl(13.5),cyto(8.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M8Z3	Uncharacterized protein	Low	9.1	1	110-134	CSDYYFFHKKKKKFVLSKNYKNEDW	nucl(14.5),cyto_nucl(10.5),cyto(5.5),mito(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MBU0	Pre-mRNA 3'-end-processing factor FIP1	Low	8.9	1	99-119	SDGTKYKRREEYDQNRNRRQW	nucl(16),cyto_nucl(12.833),cyto(7.5),cyto_pero(4.666)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MKQ9	DUF5094 domain-containing protein	Low	8.4	1	46-65	MKTPRKRITLKTPKRSTKTP	nucl(12.5),cyto_nucl(9.5),mito(9),cyto(5.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KKV6	Phosphopyruvate hydratase	Low	5.9	1	235-254	SGILKSKMPPCPCKNKKMPP	mito(17),cyto_mito(11.666),mito_nucl(11.666),cyto_nucl(5.666),nucl(5),cyto(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KQW0	Ring finger protein	Low	8.3	1	5-26	GYYVKDKKKEPLKNTYKHKIAP	nucl(11),cyto(11),cyto_nucl(11)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KRK8	Uncharacterized protein	Low	7.1	1	14-34	IYPCVLRKKRHCLEKDLLKDR	E.R.(8),nucl(6.5),cyto_nucl(5),pero(3),cyto(2.5),mito(2),golg(2),vacu(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KVF1	Estradiol 17-beta-dehydrogenase 12	Low	9.7	1	266-285	HRKFHLEKRLEERNKRKMVA	E.R.(6),cyto_nucl(5.833),nucl(5.5),cyto(5),golg(4),cyto_mito(3.833),plas(3)	KR (280-281, prob:0.607)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KY97	Polar tube protein 2	Low	7	1	249-268	EPGPEEKKAKKEESNNKKEE	mito(15.5),cyto_mito(9.666),nucl(8),cyto_nucl(6.333)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M3F2	Smr protein, MutS2	Low	9.9	1	49-68	INCNKIKKPICKQPIFKKEL	nucl(17),cyto(9),mito_nucl(9)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MAU2	Uncharacterized protein	Low	8.5	1	279-300	TGYLCKTLKNRISSNKRTERYR	nucl(9),E.R.(7),cyto(4),pero(3),golg(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MM73	Uncharacterized protein	Low	6.6	1	1-20	MNRKKLIKMMKRIKNFKSYK	mito(19),mito_nucl(14.333),nucl(7.5),cyto_nucl(4.666)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MQQ6	Ring finger and WD repeat domain-containing protein 3	Low	9.7	1	340-364	TCSYYNPQYKQIRRHRDKIIDKYLY	nucl(17),cyto_nucl(11.5),cyto(4),pero(2),E.R.(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KZE0	Uncharacterized protein	Low	8.5	1	12-32	LIKAIRQSGDRKKRRFWLSRG	nucl(16),cyto_nucl(11.333),mito_nucl(10.999),mito(4.5),cyto(3.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M0M2	Uncharacterized protein	Low	6.9	1	11-35	ITVCASLHNKNRKRQYESHINNQSV	mito(6),nucl(5.5),pero(5),cyto_nucl(4),E.R.(4),extr(2),golg(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M540	General transcription and DNA repair factor IIH subunit TFB4	Low	8.8	1	190-209	CKFVPVCKRCKTKFNFIKNK	nucl(14),cyto_nucl(13),cyto(8),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFC6	Uncharacterized protein	Low	8.3	1	180-211	LNCTAKQRKQIRILFKKYKKSKYYRSFKFLQK	nucl(9),mito(6),golg(5),cyto(2),E.R.(2),plas(1),pero(1),vacu(1)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MH05	Uncharacterized protein	Low	8.2	1	32-53	YSCKNSKIYKMYKKTPKPLRYL	nucl(11.5),cyto_nucl(11),cyto(9.5),mito(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MI37	Uncharacterized protein	Low	8.8	1	207-228	YIQHTTKMNRGRKQKDFNLPSM	nucl(12.5),cyto_nucl(9),mito(7),cyto(4.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MJK9	Cyclin N-terminal domain-containing protein	Low	9.3	1	143-168	YGCVKETQKIKQKKCAKIRRFISKIF	nucl(15),cyto_nucl(10.5),mito(5),cyto(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MMT4	Putative esterase	Low	7.8	1	36-61	KPELYFCSTKKKRVDRMESLHKKHMP	mito(13),nucl(8),cyto_mito(8)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KS42	Protein translocation protein SEC63	Low	6.9	1	186-205	LPFYAFKKWKSMKNKNRLGV	mito(8),nucl(5),E.R.(5),cyto_mito(5),plas(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M1S8	Uncharacterized protein	Low	5	1	189-209	MVLFSKKKAVEEQRRHKNKED	plas(12),E.R.(8),mito(4),golg(2),cyto_mito(2),mito_nucl(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M2V8	Uncharacterized protein	Low	5	1	94-113	LKPKGKFKYKIPKTNTTKVF	mito(8),E.R.(7),golg(4),mito_nucl(4),plas(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M4S2	Serologically defined colon cancer antigen 1	Low	9	1	1-27	MDTIKIKSKIKEEKKKLTRPVFWFEKF	cyto(17.5),cyto_nucl(11),nucl(3.5),mito(3)	KK (14-15, prob:0.609)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M673	Uncharacterized protein	Low	9.3	1	137-162	LGEFYKKYKNKVKYLKMKKEAKETEF	nucl(16),cyto_nucl(13),cyto(8)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M7R5	Uncharacterized protein (Fragment)	Low	9.6	1	7-38	EFDQCDRKKCSGQKLIRAKKVTPQPKSKYFNG	nucl(16.5),cyto_nucl(11),mito(8)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MDF6	Isoleucyl-tRNA synthetase	Low	6.8	1	874-893	ENLKKDMKTMKKKMNIISKF	cyto(15),cyto_nucl(12),nucl(7),mito(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MF16	Uncharacterized protein	Low	8.1	1	14-41	PFKFESPSKSKHNSKHNKNNNPSPPLNN	nucl(11.5),cyto_nucl(11.5),cyto(10.5),mito(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MF93	Ricin B lectin	Low	6.9	1	177-199	SEETGKKKKVQRMKSKTDPDLKV	E.R.(7),nucl(5),mito(4),cyto_nucl(4),cyto(3),extr(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFX7	Inner membrane protein yhjD	Low	8	1	35-55	FWIFWRLPRHRPRRKALIRGT	plas(20),mito(3),E.R.(2)	RHRPRRK (43-49, prob:0.682)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MKR5	Histone acetyltransferase GCN5	Low	8.7	1	301-320	DPSLKLRDDKRNRNNCLNGF	nucl(13.5),cyto_nucl(12.5),cyto(10.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MN47	Uncharacterized protein	Low	8.1	1	2-50	KDAKNSKKMKVITKLNKKMDLIKQEMYNTTRYRRKCRNVIDFEKRQKTA	nucl(11.5),cyto_nucl(10),mito(8),cyto(7.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MP57	Uncharacterized protein	Low	9.4	1	176-199	IKYSELKKDVKREVKKRNCGWCFI	nucl(17),cyto_nucl(12.333),cyto(5.5),cyto_mito(3.666)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KRT5	60S ribosomal protein L21	Low	9.3	1	39-62	MSSHGFRRKTRQILRKDHRKHGMP	mito(15),nucl(4),cyto_nucl(4),plas(3),cyto(2),E.R.(2)	K (54-54, prob:0.6)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KWE2	Uncharacterized protein	Low	9.1	1	4-33	QTFQRHTSTKKEPLKVQRNKKKCDNAPYSC	nucl(16.5),cyto_nucl(11.333),cyto(5),mito(4),cyto_pero(3.333)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KWK3	Uncharacterized protein (Fragment)	Low	9.3	1	204-225	YLDLLKNKKFIKRKNNLFYVEK	nucl(16),cyto_nucl(12.5),cyto(7),golg(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KWW6	Uncharacterized protein	Low	8.2	1	225-244	LIKKRDKTRRTILKLRNSFI	mito(12),nucl(8),cyto(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MC74	Transcription-associated protein 1	Low	9.2	1	505-525	IIRLLKPEKINKNKTKRILLA	nucl(16),cyto_nucl(14),cyto(8)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MDK4	60S ribosomal protein L18	Low	9.5	1	5-24	FKKKFIPKSAVVKNKKIRSP	cyto(12.5),cyto_nucl(10.333),mito_nucl(7.833),mito(7.5),nucl(7)	K (148-148, prob:0.603)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ME24	Ricin B lectin	Low	9.2	1	166-193	YELYTDRQLPRKKHHRHHHHHHHYDYDY	nucl(15),cyto_nucl(11.5),cyto(6),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFZ2	Sec61beta	Low	7.7	1	3-26	KVPNNEVKQKQLRQRQKHLNELLY	plas(14),nucl(7),mito(3),E.R.(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MIH0	Uncharacterized protein	Low	6.3	1	97-118	TFIDNLRKKCKQKNTENKKFTG	mito(15),cyto(7),nucl(4),cyto_pero(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MK06	Uncharacterized protein	Low	9.8	1	18-47	DESTFPSKTYKKNLCRKKHCDKNCLKYAGE	nucl(19.5),cyto_nucl(14),cyto(7.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ML48	Uncharacterized protein	Low	8	1	86-106	LDYWKKIRNRKRALKIPNLPP	E.R.(8),golg(4),mito(3),plas(3),mito_nucl(2),vacu(2),pero(2),extr(2),cyto(2),cyto_pero(2)	NRKR (94-97, prob:0.626)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MLR5	Transcription initiation factor 4F subunit	Low	8.1	1	10-29	VIKRVIYKNKKPKMVIVRRI	nucl(11.5),cyto_nucl(10),mito(8),cyto(7.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MR00	Uncharacterized protein	Low	8.9	1	77-96	LQVEIRKKRGRKNQLYNIVF	nucl(14.5),cyto_nucl(10),mito(8),cyto(4.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KLU4	60S ribosomal protein L13a	Low	7.5	1	1-23	MFKSFFNKRCRVNPRRGPFHHIL	mito(18),nucl(7.5),cyto_nucl(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KUS0	Uncharacterized protein	Low	8.9	1	302-324	FSGTKFKKSRNLKKIILIKRKND	nucl(14),cyto_nucl(10.5),mito(6),cyto(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KY12	Uncharacterized protein	Low	7.6	1	458-482	VLKDVKPVLPNKKHQDKKSQCINGI	mito_nucl(9.166),nucl(9),mito(9),cyto_nucl(7.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M0H5	Pre-mRNA-splicing factor CEF1	Low	9.4	1	160-185	KSAVHRISINKSRKLKKKKAKKNMKK	E.R.(5),golg(5),nucl(4),mito(4),mito_nucl(4),plas(3),pero(3)	NKSRKLKKKKAKKNMKK (169-185, prob:0.998)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M3X1	Uncharacterized protein	Low	8.6	1	41-63	GYETRIKIKNKTKRDSNIFKSSY	nucl(13.5),cyto_nucl(10.5),mito(9),cyto(4.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MAZ2	Uncharacterized protein	Low	8.4	1	1-22	MAKLFKLTKRIKNNKEIKPVIK	mito(14),nucl(11),cyto_nucl(7.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MBF8	Uncharacterized protein	Low	8.8	1	198-221	RKILNSQKRHSKKSRAHLCHHHFH	nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MIB3	Ubiquitinyl hydrolase 1	Low	8	1	109-133	VFKIDFHKKLKCKKCPLNKHLYLCL	nucl(12),cyto_nucl(9.833),cyto(5.5),cyto_mito(5.166),mito(3.5),plas(2),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MR90	Uncharacterized protein	Low	9.3	1	138-164	ESTAQNKYKNNKYNKKPKDHVNSHDKE	nucl(14.5),mito(11),cyto_nucl(8)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M507	Uncharacterized protein (Fragment)	Low	8.3	1	258-280	SEYLVFSKKKRNLGKSNFKSMSM	nucl(12.5),cyto_nucl(11.5),cyto(9.5),mito(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M607	Uncharacterized protein	Low	7.2	1	73-99	GFCGCCGKLIRRRKNAERSKNNHSRTL	mito(8),nucl(6.5),cyto_nucl(4.5),plas(4),golg(4),E.R.(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MB69	Uncharacterized protein	Low	7.3	1	47-66	FTSSRFFKFKLKKEKISELV	mito(14),nucl(6),cyto(4),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MDA6	Uncharacterized protein	Low	8	1	113-136	IIYVYRYFKKRRERKEFEQTINFY	nucl(10.5),cyto_nucl(8),E.R.(7),mito(3),cyto(2.5),plas(1),pero(1),golg(1),vacu(1)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MF37	Uncharacterized protein	Low	7.9	1	15-37	VLGGVSPKKSTKKDKFTTFYIKS	nucl(10),cyto_nucl(8),E.R.(6),cyto(4),pero(2),golg(2),vacu(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFJ9	Uncharacterized protein	Low	9.4	1	166-191	VVFIIKLSKRIRRKQRILFINKQIHY	nucl(16),cyto_nucl(12.5),cyto(5),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MKV3	Uncharacterized protein	Low	9.2	1	107-126	ASSNAPPKPQQPNNPPPPNN	plas(22),nucl(3)	KGKDGGGKKGGENVEGKKGGENVEGKGKGEPKGG (37-70, prob:0.832)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ML38	Uncharacterized protein	Low	9.2	1	2-22	ISDQLKKIKREQKSILGKSNI	nucl(15.5),cyto_nucl(9.833),mito(4.5),cyto_mito(4.333),cyto(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ML45	60S ribosomal protein L3	Low	9.3	1	15-36	AFGPRKRSKTIKPSIRAFPKDV	mito(16.5),cyto_mito(11.5),cyto(5.5),nucl(5)	RKRSK (19-23, prob:0.649)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KNS1	Transmembrane protein	Low	9.4	1	56-79	GEQIERYRKSRKVQRLIRKGIPIS	nucl(16),cyto_nucl(12.5),cyto(5),pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KPH0	Uncharacterized protein	Low	6.9	1	70-91	KDKSVKRKLNTPKNKKNDQDIK	E.R.(8),nucl(5.5),cyto_nucl(5),golg(4),cyto(3.5),pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MBX7	Transmembrane transporter	Low	8	1	138-160	RSLKKVKVFKKIKSKTKKQAVTT	mito(13),plas(6),E.R.(5),golg(3)	KKVKVFKKIKSKTKK (141-155, prob:0.819)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MIK9	Uncharacterized protein	Low	5.4	1	13-35	VYCEPFKKERQLIKRSKNYSKSA	extr(10),E.R.(5),mito(3),pero(3),golg(3),nucl(1),cyto(1),plas(1),cyto_nucl(1)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ML69	Uncharacterized protein	Low	6.7	1	441-469	LKEGILKYQKKNKKFYKAQCMIKKIKEKE	plas(8),E.R.(7),nucl(5),mito(5),mito_nucl(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MME1	Cell division control protein 53	Low	9.4	1	397-416	KITQLEEKRNKKKRLYWLWE	nucl(17),cyto_nucl(13.5),cyto(8)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MN74	60S ribosomal protein L8	Low	8	1	1-26	MGKVIRKIREVKKKERKNHELSIVKY	mito(22),cyto(3)	RKIREVKKKERK (6-17, prob:0.817)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MQ17	Uncharacterized protein	Low	8	1	95-118	KTNPKDSDKKKQAGNKNSSKKKII	mito(5),pero(5),golg(5),extr(4),plas(3),cyto_mito(3),cyto_pero(3)	KKKQAGNKNSSKKKI (103-117, prob:0.778)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KSW8	Uncharacterized protein	Low	7	1	2-22	DESLLKYKKPYFFKNFRNFED	cyto(15.5),cyto_nucl(12),nucl(7.5),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KT68	Aminoacyl-tRNA hydrolase	Low	8	1	79-104	LLSYIFLTRKKKKSKKFNKHPSGDYV	plas(9),E.R.(7),mito(6),cyto(2),pero(2),cyto_pero(2)	RKKKKSKKFNKH (87-98, prob:0.936)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M0N6	Transcription elongation factor 1 homolog	Low	9.9	1	1-21	MGRRKMRRTKIKKIPLVQEIE	mito(21),nucl(5)	RRKMRRTKIKK (3-13, prob:0.755)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MF61	Uncharacterized protein	Low	9	1	9-35	NKEKLKSTVKKEGKKYLKKIKNMSKVG	cyto(14.5),cyto_nucl(9.5),mito(8),nucl(3.5)	NKEKLKSTVKKEGKKYLKKIK (9-29, prob:0.88)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MIH5	Uncharacterized protein	Low	9.3	1	311-330	VVSDKIYKFKRQKYSFDFFV	nucl(16.5),cyto_nucl(13),cyto(8.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KPK0	Uncharacterized protein (Fragment)	Low	7.9	1	560-586	KPPIRILFTKYKKSKYYKSFNFLQKLS	nucl(10),cyto_nucl(10),cyto(8),pero(3),E.R.(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0LZX4	Transcriptional repressor for RNA polymerase II	Low	8.6	1	116-142	ENEKMVKYDKYRNKRIRRNSINSINGS	nucl(13.5),cyto_nucl(11.5),cyto(8.5),mito(2),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M805	40S ribosomal protein S26	Low	8.5	1	1-21	MPVKRRNHGKNRMNRGSCKPI	nucl(12.5),mito(10),cyto_nucl(9),cyto(4.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M8Y3	Uncharacterized protein	Low	7.4	1	111-134	KDRGSNRNLNKKKSKSKEDQTGDD	nucl(7),mito(7),mito_nucl(7),pero(4),E.R.(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFK2	Uncharacterized protein	Low	8	1	27-50	RSEYETHKLKWKKKYFNLIPNELK	cyto_nucl(12),nucl(11.5),cyto(11.5),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KN60	Endoplasmic reticulum junction formation protein lunapark	Low	8.7	1	24-43	ESEKKHKNLIRNNTKTKWRI	nucl(12.5),plas(9),cyto_nucl(8.5),cyto(3.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M1D4	Uncharacterized protein	Low	8.4	1	186-209	IKYSELKKDVKREVKKRNCGWCFI	nucl(13),cyto_nucl(9.833),cyto(4.5),cyto_mito(4.166),pero(4),mito(2.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M7E2	Splicing factor U2AF 59kDa subunit	Low	8.4	1	2-21	ILPLHKRKRKISFFDLESRF	nucl(12),cyto_nucl(9.5),mito(9),cyto(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M9H8	Phosphatidylinositide phosphatase SAC1	Low	7	1	433-459	DILTGKNLIKRKRYPRTKLFTPRQLAF	plas(13),nucl(6),mito(2.5),cyto_mito(2.5),cyto(1.5),pero(1),E.R.(1),golg(1),vacu(1)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFD5	Uncharacterized protein	Low	9.9	1	57-156	EAISSVKPRKIKRKSKKKKSRKSKEKMDKSEVPKKSKTKKEKKVKDKSAKKSEKDSSRKKRSKKTKAKKDKKISETKMARFKGQKTKDIKLKKPYVRTQR	plas(6),nucl(5.5),cyto_nucl(5),pero(5),E.R.(4),cyto(3.5)	KPRKIKRKSKKKKSRKSKEKMDKSEVPKKSKTKKEKKVKDKSAKKSEKDSSRKKRSKKTKAKKDKKISETKMARFKGQKTKDIKLKKPY (63-151, prob:1)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MJZ5	Uncharacterized protein	Low	8.8	1	27-46	FDDHKDGKNDKRPVKKQDTY	nucl(12.5),cyto_nucl(8),plas(4),E.R.(3),golg(3),cyto(2.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MMI1	DNA mismatch repair protein Mlh1	Low	9.8	1	611-630	SFNLIKRSTKGTKKNVEMFS	nucl(18),cyto_nucl(12.5),cyto(5),golg(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MNT8	Laminin subunit beta-4	Low	9.5	1	295-314	LEDFKKKLKNLINKNKQLEE	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KMS2	Uncharacterized protein	Low	8	1	45-64	VSSPNSKYSQNKKKYFRILE	plas(14),E.R.(7),golg(2),mito(1),extr(1),pero(1),vacu(1)	RKR (75-77, prob:0.617)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KPC8	Telomerase reverse transcriptase	Low	8.8	1	3-24	VMGLAEKKYKKAKVNCIFKTYK	nucl(14),cyto_nucl(10),mito(9),cyto(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KSV5	Uncharacterized protein	Low	8.7	1	123-142	IKKESWLRRKPKQENFKQLN	mito(17),nucl(10)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KWQ5	ATP-dependent RNA helicase DOB1	Low	6.1	1	142-181	HYFRTNKLYKIKDNKFHKEEFQKAMKTIKKKRVNEKDVME	mito(16.5),cyto_mito(11.666),cyto_nucl(6.333),cyto(5.5),nucl(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KWY9	Glutamate--cysteine ligase	Low	9	1	355-374	LNKRAYSKLRKEKVDKKISK	nucl(14.5),cyto_nucl(10.333),cyto(5),cyto_mito(3.333),pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KYL2	Ricin B lectin	Low	9.2	1	166-193	YELYTDRQLPRKKHHRHHHHHHHYDYDY	nucl(15),cyto_nucl(11.5),cyto(6),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M347	Uncharacterized protein	Low	9.9	1	57-80	ESILYHPKKYKKILKNFKKCGNNQ	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M771	Uncharacterized protein	Low	9.7	1	55-74	FTFLKKRKSEFKTKRNLIRS	nucl(18),cyto_nucl(13.5),cyto(7)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MEQ5	Uncharacterized protein	Low	8.2	1	244-264	LTVFIFKRYRLKKQNFKMAES	nucl(11),cyto_nucl(9.5),cyto(6),E.R.(5),pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFQ3	Endoplasmic reticulum junction formation protein lunapark	Low	8.5	1	24-43	ESEKKHKNLIRNNTKTKWRI	nucl(11.5),plas(8),cyto_nucl(8),cyto(3.5),mito(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MH18	Uncharacterized protein	Low	8.7	1	342-364	TNIKDIKPVKFKIKNRNKHSEYS	nucl(14.5),cyto_nucl(13.5),cyto(11.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MP86	Putative esterase	Low	7.7	1	36-61	KPELYFCPTKKKRVDRMESLHKKHMP	mito(14),nucl(7),cyto(3),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MPI8	Uncharacterized protein	Low	7.1	1	94-113	TPSWRFYRKNPLKFVKVKNE	plas(9),nucl(6),E.R.(6),mito(3),pero(2),cyto_mito(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KQD1	Uncharacterized protein	Low	9.6	1	31-51	LQPFQNPSKKKKKVLQVGILY	nucl(18),cyto_nucl(12),mito(5),cyto(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KQN3	Uncharacterized protein	Low	8.2	1	34-57	LSKYGRPTKKTKLQKNANKLEQAK	nucl(14),mito_nucl(11.833),cyto_nucl(9.833),mito(8.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KT11	Uncharacterized protein	Low	9.4	1	534-559	NGILQLRHAKKRKEARTRDSMQPLFR	cyto(7.5),E.R.(7),cyto_nucl(6.5),nucl(4.5),extr(3),pero(3)	KKRK (543-546, prob:0.649)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KWM0	Exonuclease 1	Low	9.6	1	83-105	ISKEKTNRDRSLRKEHYKKEVER	nucl(17),cyto_nucl(13),cyto(7)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M6C7	Pentose-5-phosphate 3-epimerase	Low	9.4	1	85-104	VIVPLGSRRKRRIYKISQST	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(2),extr(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M785	Uncharacterized protein	Low	5	1	233-258	LLYPSLKKKDSKKNTNTPYNNQRKCV	mito(14),plas(5),E.R.(5),golg(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M7F4	DBF4-type domain-containing protein	Low	8.7	1	7-29	QENKRFRTGPTKKSKKPGYCEVC	nucl(17.5),cyto_nucl(12.833),mito_nucl(11.166),cyto(6)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M8A6	TPR_REGION domain-containing protein	Low	9.9	1	46-66	LKHFETGKKLRKKRNYDEAIK	cyto(9.5),cyto_nucl(8.5),nucl(6.5),E.R.(4),pero(2),golg(2),vacu(2)	KKLRKKR (53-59, prob:0.773)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MEK4	Uncharacterized protein	Low	7.5	1	2-22	FPPKVFKKYKIDEIKNEEKNK	cyto(12),nucl(8),mito(6),cyto_pero(6)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFZ4	Uncharacterized protein	Low	9.1	1	227-252	VGKGHRAERQARKGGRKRRRARGSLE	cyto(14),cyto_nucl(10),mito(7),nucl(4)	VGKGHRAERQARKGGRKRRRARG (227-249, prob:0.996)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MGG7	Uncharacterized protein	Low	6.5	1	30-55	FSTTFIPRMNRKKKTTKKFVFEPKIP	E.R.(11),cyto(5.5),cyto_nucl(5.5),nucl(4.5),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MGW2	Uncharacterized protein	Low	5.7	1	510-534	CVLVLKCKTFKNKAKKFTLRVEMTN	plas(19),golg(3),nucl(2),pero(1),E.R.(1),vacu(1),mito_nucl(1)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MLN1	Uncharacterized protein	Low	7.1	1	34-53	IYRCLNRKCRSKHPLKVGLK	cyto(11.5),cyto_nucl(10),nucl(7.5),plas(3),mito(2),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MMK2	Uncharacterized protein	Low	9.6	1	363-382	TKAYIKRYPCYKNHSNLRSY	nucl(17.5),cyto_nucl(13),cyto(7.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KLV3	Uncharacterized protein	Low	9	1	187-208	YLDLLKNKKFIKRKNNLFYVEK	nucl(16.5),cyto_nucl(14),cyto(10.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KNW2	Ribosome assembly protein 1	Low	7.4	1	40-60	VDKICEKFKVKIKNQKNILST	cyto(13.5),cyto_nucl(13),nucl(9.5),mito(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KS17	Uncharacterized protein	Low	7.9	1	12-38	FSATFIPRMNRKKKTTKKFVFEPKIPT	nucl(10),cyto_nucl(10),cyto(8),mito(7)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M0P1	Uncharacterized protein	Low	9.4	1	5-24	TANERFMKKNTKKYTPETTF	nucl(17),cyto_nucl(12.5),cyto(6),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M8T3	Uncharacterized protein	Low	9.4	1	133-152	SGTLRKVVKNLSKKNNKKDN	nucl(15.5),cyto_nucl(10.5),mito(5),cyto(4.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MAW5	1-acyl-sn-glycerol-3-phosphate acyltransferase zeta	Low	5.7	1	376-410	INFSHMPKKGCSCRKKAFRYLKKKHGFRNCRMDML	golg(8),plas(6),E.R.(6),pero(4),nucl(2),cyto_pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MLR9	Leucyl-tRNA synthetase	Low	8.2	1	746-766	KTVSKRIITSKLKKNNKSVEV	nucl(11.5),cyto_nucl(10.5),cyto(8.5),mito(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KNX6	Condensin complex subunit 2	Low	8.7	1	79-103	SLEDETKKKSTRRKDTKTIEKNLAN	nucl(14.5),cyto_nucl(13.5),cyto(11.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KPT2	Histone deacetylase	Low	7.2	1	307-331	SPTYSLTPKFRRKFANKNDKNYLDS	cyto(13.5),cyto_nucl(13.5),nucl(8.5),mito(2),E.R.(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KR84	Uncharacterized protein (Fragment)	Low	9.3	1	306-328	GAIISIFRKNRKSKQREVVISLE	nucl(16.5),cyto_nucl(13),cyto(6.5),mito(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KRW8	Gene D protein	Low	5	1	132-156	TVKCCASKARSHKSKKSHLNANPGA	mito(14),cyto(12)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KUR5	Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2	Low	8.4	1	20-39	SKINGHPRRITKKQISEKIS	nucl(13.5),cyto_nucl(9.333),cyto_mito(4.833),mito(4.5),cyto(4),pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KXI9	Uncharacterized protein	Low	9.9	1	117-139	LDYLKMTRMKSEKKKEPKVVINE	nucl(18.5),cyto_nucl(10.833),mito(4.5),cyto_mito(3.833)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M0D6	Uncharacterized protein	Low	7.7	1	173-200	TLGEFYKKYKNKVKYLKMKKEAKETEFN	mito(13),nucl(9),cyto_nucl(7.5),cyto(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M3D7	Protein with DEXDc plus ring plus HELICc	Low	5	1	148-168	KFSERLKKIDARKRNEQEKNA	extr(10),E.R.(5),golg(5),pero(3),cyto(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M4X9	SANTA domain-containing protein	Low	9.9	1	17-38	KSYTIFKRKTPGYKRYNCENLK	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M7L4	tRNA-specific adenosine deaminase-like protein 3	Low	8.3	1	226-253	ALVHGRIKRVFIKNKRKNGPFTKYKLCY	nucl(10.5),mito(9),cyto_nucl(8),cyto(4.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MB11	Aminoacid transporter like protein	Low	5	1	354-374	LNEKKIFKKIQSKTKKQAVTT	mito(14),plas(7),cyto_mito(7),mito_nucl(7)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MBX6	Tau95 domain-containing protein	Low	8.9	1	42-67	DTVDSKRIYACKKRKNKDLFLHLRIE	nucl(15.5),cyto_nucl(13.5),cyto(10.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MI07	White-brown complex protein 7-like protein	Low	8	1	266-289	SVSTINKIKKKWKDKKKEYPILIT	plas(18),mito(4),E.R.(3)	KIKKKWKDKKK (272-282, prob:0.843)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MKZ7	Transcription factor TAU-like protein	Low	9.4	1	1-26	MNNELSLRSTKNKRRKYTEIELAIKE	nucl(16.5),cyto_nucl(10.333),cyto_mito(3.833),mito(3.5),cyto(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MR30	DNA-directed RNA polymerase subunit	Low	7.4	1	177-200	IVKSCPRCKAKSPKLIFNKNLKIQ	cyto(16),cyto_nucl(15),nucl(10)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KW05	Uncharacterized protein	Low	8	1	67-90	LVYFGFRKYKERRKKIGCADEQEL	nucl(10.5),cyto_nucl(10.5),cyto(7.5),E.R.(6)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KYY4	Ribosomal protein L15	Low	8.9	1	61-84	CYVVRVKKGNRKRQYNNGNTRGKC	nucl(14.5),mito_nucl(11),mito(6.5),cyto(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0LZN2	Putative metal ion transporter	Low	7.4	1	32-52	IITIYRKMKKGKNNQNIYRML	cyto(11),cyto_nucl(11),nucl(9),mito(6)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M457	Glucose transporter type 3 (Fragment)	Low	5	1	141-160	NEVKIFKKIRSKTKKQAVTT	plas(9),mito(8),E.R.(7),golg(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M5L3	Protein Jade-1	Low	9.6	1	173-197	LEKICEYWKQRKQHDKSFRMPQLNL	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFT6	Uncharacterized protein (Fragment)	Low	9.2	1	362-384	IKIITLCKSKRIKKAEQFVERAL	nucl(16.5),cyto_nucl(13.5),cyto(9.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MHM6	Heat shock protein 90	Low	6.3	1	18-37	FFGGKNKKNKNIKLYCNNVF	mito(17),mito_nucl(12),nucl(5),cyto(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MI49	DnaJ	Low	9.6	2	92-112, 270-289	SPDFYKKFKNYQSPRKFKREE, PIAFRTCSRCNKRFDTRIKM	cyto(13),cyto_nucl(12.5),nucl(10),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ML05	Ras-related protein Rab-5A	Low	9.9	1	167-190	TVANNVPKEKPKPHKKGLKLGESY	cyto(11),cyto_nucl(10),mito(9),nucl(7)	KEKPKPHKKG (174-183, prob:0.765)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ML40	UTP--glucose-1-phosphate uridylyltransferase	Low	8.8	1	22-41	ISEMKNKLDKLKNQYKDPKE	nucl(15),cyto_nucl(14),cyto(11)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MMN2	Uncharacterized protein	Low	9.2	1	104-123	KDFFSRKGKDVKNNKRSYKE	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(2),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KMZ7	Proteasome beta-type component	Low	7.3	1	143-163	NNCGMHRRPPCQKYHYKRKFF	cyto(12.5),cyto_nucl(12),nucl(8.5),mito(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KTH7	Uncharacterized protein	Low	8.7	1	53-74	MVHEMHKQKRRYNIKGRLNVES	nucl(14.5),cyto_nucl(13),cyto(8.5),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KYZ6	Uncharacterized protein	Low	8.7	1	20-40	LCKQYRLKSSKDPHKRIQVKL	mito(13),nucl(11.5),cyto_nucl(7)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0LZK6	Cyclin N-terminal domain-containing protein	Low	9.3	1	142-167	YGCVKETQKIKQKKCAKIRRFISKIF	nucl(15),cyto_nucl(11),cyto(5),mito(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M134	Splicing factor 3a, subunit 2	Low	9.4	1	33-52	FNEHCKSKKHLKNEVKTKEK	nucl(12),mito(8),cyto(7)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M744	Ankyrin repeat domain-containing protein 32	Low	9.2	1	469-488	EKDKKIIKSVRKWREKVEES	nucl(16.5),cyto_nucl(13.5),cyto(9.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M809	Vacuolar transporter chaperone 4	Low	6.5	1	38-58	VRTFYKRQAYQLKNNNKVRIS	plas(16),nucl(4),cyto(3),golg(2),mito_nucl(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MBH6	Uncharacterized protein	Low	7.5	1	341-363	PHPHHGAHGRHNRHNQHYHKSHH	nucl(9.5),cyto_nucl(7.833),cyto(5),extr(5),cyto_mito(4.833),mito(3.5),golg(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MHC4	Uncharacterized protein	Low	9.7	1	351-370	YAFRCCKNILKNSKNKKISF	nucl(17.5),cyto_nucl(12),cyto(5.5),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KPA9	Integral membrane protein	Low	5	1	293-313	IGILCYNLKRRKRPEIIEIEE	plas(11),mito(8),E.R.(7)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KS75	Putative membrane protein ycf1	Low	8	1	23-46	DDPANKKKDDSKDKQEDPNKKEPM	E.R.(7),cyto(5.5),extr(4),cyto_nucl(4),mito(3),golg(3),vacu(3)	KKKADEETKKKAEEDAKKKAEEDAKKKADEDAKKKAEEDKAK (145-186, prob:0.966)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KVB0	Translocation protein SEC62	Low	6.6	1	17-36	TTEKILRKTKRVNCFKGRDA	plas(19),nucl(4),E.R.(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KWE8	Uncharacterized protein	Low	7.4	1	227-246	TKLFRLWKAKSNKMNKTAFN	cyto_nucl(9.5),cyto(9),nucl(8),mito(7)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M5G9	Uncharacterized protein	Low	9	1	31-56	IAQGCFFHKNHKKNNRSNVKKKYTIF	nucl(12),mito(9),cyto_nucl(9)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M8F9	DNA polymerase kappa	Low	8.4	1	392-412	YKYSNFKSYTRRSKTNTVDSE	nucl(12.5),cyto_nucl(12.5),cyto(11.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MBB4	TOG domain-containing protein (Fragment)	Low	8.9	1	6-25	RLEEKMKSKNWKERQEAYVR	nucl(16.5),cyto_nucl(15),cyto(10.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KMB4	Uncharacterized protein	Low	8	1	317-340	GTIDGKKNAKKSKNEKSNSFCIPC	nucl(9.5),E.R.(8),cyto_nucl(7),cyto(3.5),golg(2),vacu(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KND0	CID domain-containing protein (Fragment)	Low	9.4	1	89-113	QKTFGKSKAEAKKHRPLYKKYCDLE	nucl(12),cyto(8),mito(7)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KSX2	Uncharacterized protein	Low	8.6	1	2-21	KQKNQKKTIKCDYYKIKEIK	nucl(13.5),cyto_nucl(12),cyto(9.5),mito(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KXV6	Uncharacterized protein	Low	8	1	134-153	YNLTKEKKYFYRYKFCKRVD	cyto_nucl(12),nucl(11.5),cyto(11.5),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M1M3	Uncharacterized protein	Low	8.6	1	317-337	GLLFIRRKRFEKQKIIHDDYD	nucl(13.5),cyto_nucl(9.833),cyto(5),pero(4),cyto_mito(3.833),mito(1.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MPL2	Uncharacterized protein	Low	9.9	1	227-251	CIYPSTKNNWKRKINYNIHVKRRCF	nucl(19),cyto_nucl(13.5),cyto(6)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MQA4	DNA mismatch repair protein Mlh1	Low	9.7	1	611-630	SFNLIKRSTKGTKKNVEMFS	nucl(18),cyto_nucl(13.5),cyto(7)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KRE7	Uncharacterized protein	Low	6.1	1	1-22	MKGCPTTIKNLNKKLKLKNTNC	mito(18.5),mito_nucl(12.166),cyto_nucl(4.833),nucl(4.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KRG0	Yer119cp like amino acid transporter	Low	5	1	370-391	NEVKLFKKIKSKTKKQAVTTFL	mito(12),plas(6),cyto_mito(6),mito_nucl(6)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KSI0	Putative methyltransferase NSUN5	Low	9.2	1	18-43	LKKIIEKKSTIKREVYKKKNPSEYLA	nucl(16),cyto_nucl(12),cyto(6),mito(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M0Q6	Eukaryotic translation initiation factor 2-alpha kinase 1	Low	9	1	340-365	EMNYLLKDLKRKKTVPKDFKNLYNAE	nucl(14.5),cyto_nucl(11),cyto(6.5),mito(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MH02	Uncharacterized protein	Low	9.6	1	338-362	AIIYIYRYFKKRRERKEFEQTINFY	nucl(19),cyto_nucl(13.333),cyto(5.5),cyto_mito(3.666)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MI34	Chitin synthase	Low	5	1	6-34	EILRNPSRSRFQRPIKSRVPKKGIWSKIS	plas(24),mito(1),pero(1),E.R.(1)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KME9	Protein HIR	Low	6.5	1	677-696	KTAKNHQKMKSVVKKFIKKI	E.R.(8),nucl(4),mito(4),mito_nucl(4),cyto(3),plas(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KTM3	Phospholipid-transporting ATPase	Low	8.5	2	1-24, 162-181	MPLPSKMRKAKNKITTSKYNKYTF, ESNLKKKTSQNDIKCNKDKD	plas(17),nucl(4),mito(3),E.R.(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KUQ2	Protein DBF4 like protein A	Low	8.7	1	46-65	QENKRFRTGPTKKSKKPGYC	nucl(13.5),cyto_nucl(9.5),mito(9),cyto(4.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KUZ4	Protein YOP1 (Fragment)	Low	6.9	1	119-141	YNYANNKYKEARNRKKIQDTTGD	mito(19),nucl(5),cyto(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MAR4	Sperm-associated antigen 4 protein (Fragment)	Low	7.8	1	322-344	ELETTLRRKIARKKFWRWVLFIC	nucl(10),cyto_nucl(9.5),cyto(7),pero(5),mito(2),E.R.(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MGX8	Uncharacterized protein	Low	9.5	1	227-251	CIYPSTKNNWKRKINYNIHVKRRCF	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MKW0	zinc_ribbon_15 domain-containing protein	Low	7	1	33-52	CPHCSKIYPRIYKKDKRRLA	mito(9),cyto_nucl(7),nucl(6.5),cyto(6.5),pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MLE7	Uncharacterized protein	Low	9.1	1	17-38	ILLDHKKIKYNKNPEYYRKKGL	nucl(16),cyto_nucl(12),cyto(6),mito(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KQ09	Uncharacterized protein	Low	8.3	1	101-121	DTSKTKWYKNFKILKRTPYRT	nucl(11),cyto(11),cyto_nucl(11)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KRV8	Uncharacterized protein (Fragment)	Low	7.4	1	240-259	KVDCKDKKIKNLIEKRNKIF	nucl(7.5),cyto_nucl(7),cyto(5.5),extr(4),pero(4),E.R.(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KSL8	Uncharacterized protein	Low	6	1	17-40	VIYNPKDKKFYHKKKNLNEFNFKE	mito(6),E.R.(6),plas(4),pero(4),nucl(3),cyto(3),cyto_nucl(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KSQ8	Uncharacterized protein	Low	9.4	1	370-399	LFWCFYCCTKCFKKKKYRKLVSQNSEVLRY	nucl(17.5),cyto_nucl(12.333),cyto(4),cyto_mito(3.499),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M0S5	Tetratricopeptide TPR-1	Low	5.3	1	38-57	FETGKELRKRRNYDEAKKSF	golg(7),E.R.(6),mito(5),vacu(2),extr(2),plas(2),nucl(1),cyto(1),cyto_nucl(1),pero(1),cyto_pero(1)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M5I0	13S condensin subunit	Low	8.1	1	452-473	SEIMVNKRKKRNTINNTINNNN	mito(11),nucl(10.5),cyto_nucl(8),cyto(4.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MNS4	Uncharacterized protein	Low	9.6	1	83-105	EIFLPKVKKKFKFKPFGKSTKDL	cyto_nucl(6.333),cyto(6),E.R.(6),nucl(5.5),cyto_mito(4.333),pero(3),extr(2),golg(2)	VKKKFKFKP (89-97, prob:0.729)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M339	D-ribose transport binding protein	Low	8.7	1	141-165	EFERGKPLSKRKIKRKSVFKKGDDG	E.R.(12),golg(7),vacu(3),nucl(2),cyto(2),cyto_nucl(2)	RGKPLSKRKIKRKSVFKKG (144-162, prob:0.965)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MKS5	Coatomer subunit beta	Low	6.6	1	67-88	RSFNPQKMKLEKSNTKKFRSSR	mito(12),cyto(7),nucl(4),vacu(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ML74	Xaa-Pro aminopeptidase 1	Low	8.9	1	229-252	LIKNTEKLKRSKEYKPTPPKVFTN	nucl(15),cyto_nucl(13.5),cyto(10)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MNQ7	Nuclear prelamin A recognition factor-like protein	Low	8.1	1	383-403	DLYGRTFKKKEMKKTSFNVQW	mito(15),nucl(8),cyto(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KME0	Uncharacterized protein	Low	8.4	1	186-207	KYSELKKDVKREVKKSNCGWCF	nucl(13),cyto_nucl(10.333),cyto(5.5),cyto_mito(4.166),pero(4),mito(1.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KN25	Uncharacterized protein	Low	7.2	1	14-34	IYPCVLRKKRHCLERDLLKDR	E.R.(8),nucl(6.5),cyto_nucl(4.5),pero(3),golg(3),mito(2),vacu(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KP10	Uncharacterized protein	Low	8.7	1	374-397	LDSKLKTKCKFKTLLGKKCKDPEI	cyto(11),nucl(10),mito(3),pero(1),golg(1),vacu(1)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KP33	SMP-LTD domain-containing protein	Low	6.8	1	1015-1040	VYSIVYKNNGKKKRNIKIFMGCTRKG	E.R.(9),nucl(5.5),cyto_nucl(5),cyto(3.5),pero(3),mito(2),vacu(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KRX2	Uncharacterized protein	Low	6.1	1	108-128	GYHSKRMYYKHKCHKDKDDNY	mito(16),cyto(7.5),cyto_nucl(6),nucl(3.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KT44	Ubiquitin carboxyl-terminal hydrolase 23	Low	9.1	1	9-37	CENNIKKKLFYCQKKVKKETLCCNKCTKK	nucl(16),cyto_nucl(12),cyto(6),mito(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KWF3	Uncharacterized protein	Low	9.9	1	208-234	YFNLYPFRKMKRNKSRRSIIYENKKDN	nucl(17.5),cyto_nucl(9.833),mito(3.5),cyto_mito(2.833),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M129	Uncharacterized protein	Low	7	1	98-117	SKDSEKKNQAGNKNNSKKKI	E.R.(6),nucl(5),golg(5),cyto(3),pero(3),cyto_pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M360	NUC153 domain-containing protein	Low	8.9	1	255-277	YQKNNKLKDIMKEKRRRFEEKEM	nucl(15.5),cyto_nucl(13.5),cyto(10.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M531	Uncharacterized protein	Low	9.2	1	226-251	GGFITYCRSKKKQTKKMNRENVDNIL	nucl(15.5),cyto_nucl(12),cyto(5.5),pero(2),golg(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MBW2	Uncharacterized protein	Low	5	1	66-85	TKEILKTKVHRKRLTQKLYV	mito(7),E.R.(7),plas(4),pero(3),golg(3),cyto(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ME09	Uncharacterized protein	Low	9.7	1	73-94	YYEPETKKDKRNWFSRNFMCCN	nucl(18.5),cyto_nucl(14),cyto(6.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MIN1	Spindle pole body component	Low	7.9	1	595-616	INFSKIFKTKKRKILDLQMNLQ	nucl(11),cyto_nucl(10.5),mito(10),cyto(6)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ML54	Non-specific serine/threonine protein kinase	Low	8.3	1	6-29	NSTFYEEKKRYKEVKRRLEEDLNG	nucl(13),cyto(13),cyto_nucl(13)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KQ57	Uncharacterized protein	Low	7.2	1	112-133	DYYFFHKKKRNLFYRKITRMKI	mito(14.5),mito_nucl(12),nucl(8.5),cyto(2),E.R.(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KQA3	White-brown complex protein 7-like protein	Low	6.5	1	571-592	IGWYSFLKKYKPKLSIKLEDKV	plas(16),nucl(4),mito(2),cyto_nucl(2),golg(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KRZ7	Uncharacterized protein	Low	5	1	112-133	EFVVYKKKFKNKKTPIKCQIDL	plas(8),E.R.(8),mito(6),golg(3),mito_nucl(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KTL7	Nuclear protein localization protein 4	Low	9.4	1	132-153	MENYDKKKCKTHTSRTKCVHCE	nucl(17.5),cyto_nucl(13.5),cyto(8.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MIK7	Uncharacterized protein	Low	9.6	1	228-247	NVNIKDQKFKKRKNIINFIS	nucl(16.5),cyto_nucl(12),cyto(4.5),pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ML70	Uncharacterized protein	Low	9.3	1	21-43	DETGLLKTKKYKRDSRASFKENL	nucl(16.5),cyto_nucl(13),cyto(8.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MMT1	Endoplasmic reticulum junction formation protein lunapark	Low	8.9	1	24-43	ESEKKHKNLIRNNTKTKWRI	nucl(12.5),cyto_nucl(8),plas(7),cyto(2.5),mito(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MP90	Uncharacterized protein	Low	9.6	1	21-48	YAQNNECKKDNKEPNKRKNLPANQNGNE	nucl(18.5),cyto_nucl(14.5),cyto(7.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KRD6	Uncharacterized protein	Low	9	1	261-283	SEYLVFSKKKRNLGKSKFKSMSM	nucl(15.5),cyto_nucl(11.5),cyto(6.5),mito(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KS46	AsmA domain-containing protein	Low	8.6	1	399-425	AENPRRNERRCAASRHRQLRRRAAGQQ	nucl(12.5),cyto_nucl(10.5),extr(6),cyto(5.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KVU8	USP6-like protein	Low	9.6	1	56-79	GEQIERYRKSRKVQRLIRKGIPIS	nucl(16.5),cyto_nucl(12),cyto(4.5),pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MIY7	Helicase SKI2W	Low	6.8	1	138-159	EDIMRKSYKEHSKQKNEDKDLI	mito(7),pero(6),nucl(5.5),cyto_nucl(5),cyto(3.5),plas(2),extr(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MLF8	Thioredoxin	Low	5	1	423-448	VIYDPQKKHFRYKPVKLTRENFKHVA	E.R.(10),golg(4),extr(3),vacu(3),mito(2),cyto(2),plas(2),cyto_mito(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MP28	ADP-ribosylation factor GTPase-activating protein 2	Low	8.5	1	3-23	ELCNDKVKKLSKEPTNNKCMD	nucl(12),cyto_nucl(9.5),mito(6),cyto(5),golg(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KLY0	CDT1 domain-containing protein	Low	9	1	1-28	MKTKNLKDYLNKNKKKVKVIEDSRARES	nucl(14.5),cyto_nucl(11.5),cyto(5.5),mito(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KRI0	Uncharacterized protein	Low	6.1	1	14-39	IFTNKKAISTCKKCNKKMDRYYEVNN	plas(12),mito(5),nucl(3),E.R.(3),pero(2),golg(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KTD9	Uncharacterized protein	Low	9.9	1	13-36	LFVIAKFLKRRPRRIRFIGGRGTG	E.R.(6),nucl(5),golg(5),mito(4),cyto(2),plas(2),extr(1),pero(1),vacu(1)	KRRPRRIR (21-28, prob:0.771)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KU37	F-box/WD repeat-containing protein 7	Low	7.4	1	24-44	IVKRLAKTSKILRNNLKHNHM	nucl(11),cyto_nucl(10.833),cyto_mito(8.666),cyto(8.5),mito(7.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MB44	Zinc finger CCCH domain-containing protein 11A	Low	9.9	1	27-53	KDNLITCKIWKKTKKCRTDCPLRHSEY	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KUV9	Putative ATP-dependent RNA helicase DHX33	Low	8.3	1	297-316	NFELKKSKDTEKYLNQRKVI	nucl(12),cyto_nucl(11.5),cyto(9),mito(2),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KWP5	Uncharacterized protein	Low	6.5	1	47-68	DQPLYLRTKRIKPKQNLPTESS	mito(6),pero(6),nucl(4.5),cyto_nucl(4),plas(3),cyto(2.5),extr(2),E.R.(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MBU3	Uncharacterized protein	Low	6.9	1	107-128	FKTVPFVWKKRKGNFAPIKTNK	mito(10),cyto(8),cyto_nucl(8),nucl(6)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MEG0	WD repeat-containing protein 36	Low	6.3	1	95-114	LYNFIKKKEIYKFKSFKKGV	cyto(14),cyto_nucl(10.5),nucl(5),mito(2),pero(2),E.R.(2),vacu(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFN6	Uncharacterized protein	Low	7.7	1	2-21	EDAKKKLIKQAEKLREKKMF	cyto(11.5),cyto_nucl(11),nucl(9.5),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MHS9	RuvB-like helicase	Low	9.7	1	373-392	LSEIRRKKLNREKVDEEDVN	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MIM4	DNA-directed RNA polymerase I	Low	5	1	20-44	PLKYPSYPYPPPKKNPPHSYPPNLP	mito(12),cyto(11.5),cyto_nucl(6.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MM22	Meiotic nuclear division protein 1	Low	9.4	1	178-201	VINLKWKKRILMRRLRYHRHDYVE	nucl(17.5),mito_nucl(13.5),mito(8.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KMY8	Uncharacterized protein	Low	5	1	571-592	RDLNVFFTKRKLKKRIFLIFIF	E.R.(16),extr(5),golg(2),vacu(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KPL1	N(2),N(2)-dimethylguanosine tRNA methyltransferase	Low	9.2	1	225-247	FYIRVFVRVKRNRPKDSIRTNSM	nucl(17),cyto_nucl(14),cyto(9)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KU36	Uncharacterized protein	Low	8.2	1	8-34	FIKKNISTKKHTIKYGKRKGNKIYCHT	nucl(12),cyto_nucl(10.5),mito(10),cyto(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KUA3	Uncharacterized protein	Low	7.5	1	1-20	MESPLKQRRNKILKRLNITL	mito(13.5),mito_nucl(12.833),nucl(11),cyto_nucl(6.833)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M2F7	Uncharacterized protein	Low	5	1	379-401	MSALLKKYPTRNNFKKIKDHMNY	mito(9),cyto(8),mito_nucl(8)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M3K4	t-SNARE affecting a late Golgi compartment protein 2	Low	9.2	2	6-28, 52-71	INRTLEFKKCRPKLEKDLIREGY, QEKHCLPSFIPKKKRRDELE	nucl(8.5),cyto_nucl(6.833),mito(5.5),cyto_mito(5.333),cyto(4),plas(3),pero(3),E.R.(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ME66	Uncharacterized protein	Low	7.3	1	14-35	LFTKLGINKKKQKQTMEFQEGI	mito(16),nucl(7.5),cyto_nucl(6),cyto(3.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MLH8	Uncharacterized protein	Low	8.6	1	537-558	RVEVKVKKECLRRKNTFIENDF	nucl(12.5),cyto_nucl(10.5),cyto(5.5),mito(3),pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MLU6	Uncharacterized protein	Low	9.9	1	340-360	VLIFWKYKSKKERNENELILS	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KMV1	Uncharacterized protein	Low	6.5	1	15-41	ILLGIKIRYKLKKKLIRIKNYTIKYRI	mito(20),nucl(4),cyto(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KS15	Uncharacterized protein	Low	7.8	1	47-66	FTSSRFFKFKLKKEKISELV	mito(15),nucl(7),cyto(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KTR5	Uncharacterized protein	Low	7.8	1	145-164	IYKYRKNKLRRLFRREIECE	cyto(14.5),cyto_nucl(14.5),nucl(11.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M1R1	Uncharacterized protein	Low	8.1	1	436-461	GGFVAYCRSKKKQTKKMNRENVDDAL	nucl(11.5),cyto_nucl(10.5),cyto(6.5),E.R.(5),pero(2),golg(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M5S2	Uncharacterized protein	Low	7.4	1	78-99	GCLINQHYKKGKKQEKQSSSQQ	nucl(7.5),extr(7),cyto_nucl(5.5),golg(3),cyto(2.5),pero(2),E.R.(2),vacu(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MDF3	Casein kinase II subunit beta	Low	8.7	1	167-189	MISFPYKFKRKNVTPFKPRLYGF	nucl(13.5),cyto_nucl(12.5),cyto(10.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MEP3	Uncharacterized protein	Low	9	2	70-93, 563-588	MYKFSCKKIMYSKKKINLKLNGIT, ENEAKDKGFKKKLNTAKNKKNVQDIT	E.R.(8),nucl(6.5),cyto_nucl(6),cyto(4.5),pero(4),golg(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MEQ1	Uncharacterized protein	Low	7.6	1	154-174	IDDFCNKKDKRKCFKDCEFPT	nucl(8.5),cyto_nucl(6.5),E.R.(5),cyto(3.5),mito(3),extr(3),pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MHR0	Ricin B lectin	Low	9.8	1	166-194	IDEDFFPRRNPPRKKSRKNCRSEQDDDDE	E.R.(9),nucl(5),pero(3),golg(3),mito(2),cyto(2),extr(2),cyto_mito(2)	RNPPRKKSRK (174-183, prob:0.788)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MIC9	60S ribosomal protein L10A	Low	6.8	1	2-21	QDKMIKERKNIFKINKHFIL	mito(10.5),mito_nucl(10.166),cyto_nucl(9.333),nucl(8.5),cyto(8)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MKE6	26S proteasome non-ATPase regulatory subunit 12	Low	9.2	1	157-179	RSDITMRKIRKKYFKENKAINEE	nucl(16.5),cyto_nucl(14),cyto(8.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ML65	Uncharacterized protein	Low	8.3	1	2-50	KDAKNSKKMKVITKLNKKMDLIKQEMYNTTRYRRKCRNVIDFEKRQKTA	nucl(10),mito(10),mito_nucl(10)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ML78	Flap endonuclease 1-B	Low	7.3	1	186-209	VNKLIASQKKPKQSKLDRFFIKKG	cyto(16.5),cyto_nucl(14.5),nucl(9.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KT95	Uncharacterized protein	Low	9.5	1	461-484	YLTDYFNKKKKYHQEERYKEAKKE	nucl(16.5),cyto_nucl(11),mito(5),cyto(4.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M152	Class 2 transcriptional repressor	Low	5.9	1	48-69	EFVDKCLKKSKTKAVKRFKMNT	mito(20.5),mito_nucl(12.999),cyto_nucl(4.833),nucl(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M3S2	Uncharacterized protein	Low	9.8	1	174-193	SSKESEKNGLGKKKRSSKKK	extr(10),nucl(5.5),cyto_nucl(5.5),E.R.(5),cyto(4.5)	NGLGKKKRSSKKK (181-193, prob:0.978)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M9F3	Pescadillo like protein	Low	8.7	1	66-94	KHSHVIKTIKYNNKRLKKKQDLIDNRLYD	nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(6)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MET0	Uncharacterized protein	Low	8.6	1	165-190	FAAICLFLKRKNRKPKNNEVEEDHKL	nucl(14.5),cyto_nucl(12.333),cyto(7),cyto_mito(4.999),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MH27	Lysophospholipase NTE1 (Fragment)	Low	6.8	1	678-697	NGIYEKYFVNKKRTRRRYSV	cyto(11.5),cyto_nucl(10.5),nucl(6.5),mito(4),pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MJQ9	Chaperone protein dnaJ	Low	8.5	1	308-329	WLKEGRKAYYHEKKNWHKYPGQ	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MP05	U3 small nucleolar RNA-associated protein 15	Low	9.2	1	41-65	TQEKLFYKFGKKNIKKVNKFDDKIS	nucl(16),cyto_nucl(13.5),cyto(9)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MRP6	Uncharacterized protein	Low	9.2	1	582-603	NDSDYHKKIRKFKVGELKPNTI	nucl(17.5),cyto_nucl(12.833),cyto(7),cyto_pero(4.333)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KVR7	Uncharacterized protein	Low	7.4	1	1-24	MKKEKIYKQKFKKSKFKNLYIFFY	mito(11),cyto_nucl(10),nucl(9),cyto(7)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KWJ3	Uncharacterized protein	Low	7.8	1	170-189	RHDIVTKKYKCKINGFRRVI	nucl(10.5),cyto_nucl(10),cyto(8.5),mito(4),E.R.(1),golg(1),cysk(1),vacu(1)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M5P5	Chromatin structure modulator (Fragment)	Low	7.7	1	181-206	MTDIYDKLKFKKKPDKGSDNPNKSTD	nucl(9.5),cyto_nucl(8.5),cyto(6.5),E.R.(5),mito(2),plas(1),pero(1),golg(1),vacu(1)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M6Y2	Uncharacterized protein	Low	6.3	1	225-244	LYKLKKKLYEHFRKPEKVLR	mito(19),nucl(4),cyto(4),cyto_nucl(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MB56	Uncharacterized protein	Low	7.5	1	17-36	ACIPHFKKIKSHVKNVSQDI	mito(12),nucl(8.5),cyto_nucl(7.5),cyto(5.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MC01	Uncharacterized protein	Low	8.8	1	2-21	KQKNQKKTIKCDYYKIKEIK	nucl(14.5),cyto_nucl(12),cyto(8.5),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MCG1	Uncharacterized protein	Low	5.7	1	189-209	CVYKCVPKVYNPKPKNFGKKC	extr(10),E.R.(7),golg(4),pero(3),nucl(2),cyto_pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFL3	Uncharacterized protein	Low	7.7	1	236-262	LEELRDKFPPFKKKNIRKQAVFCNTKV	nucl(7),E.R.(6),golg(6),pero(3),cyto(2),vacu(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MGP7	40S ribosomal protein S26	Low	9.4	1	1-21	MPVKRRNHGKNRMNRGSCKPI	nucl(12),mito(11),cyto(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MHZ8	F-box/WD repeat-containing protein 7	Low	8.1	1	24-44	IVKRLAKTSKILRNNLKHNHM	nucl(11.5),cyto_nucl(11.5),cyto(8.5),mito(6)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MK64	DUF2439 domain-containing protein	Low	8.6	1	1-23	MIPCVYSKQKKKKLKTWFDGFVV	nucl(13),cyto_nucl(11),mito(7),cyto(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KRB7	Glycerol-3-phosphate dehydrogenase	Low	6.8	1	13-39	ISLYLSVRYYRKKRNEKMIKSFLKPYD	E.R.(9),nucl(5),mito(5),mito_nucl(5),pero(2),vacu(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KRQ2	Ribosomal protein L5 (Fragment)	Low	9.4	1	152-171	IRVKIKKSCAPKKPEKEHTK	mito(13),cyto(7.5),cyto_nucl(7.5),nucl(4.5)	KIKK (155-158, prob:0.62)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KSD8	Transcription-associated protein 1 (Fragment)	Low	9.3	1	639-660	NIIRLLKPEKINKNKTKRVLLA	nucl(16),cyto_nucl(13),cyto(8)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KWZ3	3-ketodihydrosphingosine reductase	Low	9.8	1	14-37	AIYYVIKPEKKDKRIKGKNILIIG	E.R.(8),nucl(5),mito(3.5),cyto_mito(3.5),plas(3),pero(3),cyto(2.5)	KKDKRIK (23-29, prob:0.655)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KX55	Midasin	Low	7.4	1	9-35	ASDYRRDKIWMKRRKSDKKDYTVRLFV	mito(16.5),mito_nucl(13.5),nucl(9.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MAI1	Uncharacterized protein	Low	6.2	1	187-209	YKCVYKCVPKVYNHKPKNFEKKC	extr(10),E.R.(7),golg(4),nucl(3),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MAM8	Uncharacterized protein	Low	5	1	138-160	KVKSFFNKIMVKRRKQDDKNVLT	plas(15),E.R.(6),mito(3),golg(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MC43	60S ribosomal protein L8	Low	7	1	1-23	MVLGKPKDKRLLKVKPTKEQLEE	cyto_nucl(11.166),nucl(11),cyto(10),mito_nucl(8.666),cyto_mito(8.166),mito(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFE2	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform	Low	9.7	1	10-30	LTSLRLKKIKIRKGLNQDLMW	nucl(17.5),cyto_nucl(13.5),cyto(6.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MQ14	Uncharacterized protein	Low	9.9	1	159-179	LSSLGYKKSNDRKNLKKHISE	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KPR1	Cleavage and polyadenylation specificity factor subunit 4	Low	8.3	1	121-142	CKHGANCKNKHVRRKMCYNYYL	nucl(12.5),cyto_nucl(11.5),cyto(9.5),mito(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KRF1	Uncharacterized protein	Low	8.7	1	267-289	SEYLVFSKKKRNLGKSKFKSMSM	nucl(14.5),cyto_nucl(12),cyto(8.5),mito(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KX62	Uncharacterized protein	Low	9.7	1	1-24	MSININCKKKWHPSRYETRKQVEE	nucl(23),mito_nucl(13.333),cyto_nucl(12.333)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MAU7	Uncharacterized protein	Low	8	1	40-65	VPSPNLKYKTNKEKELKKKTRPVKSK	plas(7),mito(5),E.R.(5),golg(4),cyto(2),pero(2),cyto_pero(2)	NKEKELKKKTRPVKSK (50-65, prob:0.928)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MAX2	Cell surface antigen (Fragment)	Low	7	1	926-947	RDLNVFFTKRKLKKRIFLIFIF	cyto(12),cyto_nucl(11.833),nucl(8.5),cyto_mito(7.999),mito(2.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MDQ1	DUF2439 domain-containing protein	Low	8.9	1	1-23	MIPCVYSKQKKKKLKTWLDGFVV	nucl(14),cyto_nucl(10),mito(8),cyto(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MKV1	Uncharacterized protein	Low	9.4	1	735-754	EYYVEIKKRKYRSDIKEVVN	nucl(17),cyto_nucl(11.5),mito(6),cyto(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MLU0	Uncharacterized protein	Low	7.6	1	46-70	TNEKITKIIKKKQVDKNKNRKYVIH	cyto(14),cyto_nucl(14),nucl(10)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MP76	Uncharacterized protein	Low	8.7	1	22-41	AQNNECKKDNQEPNKRKDLP	nucl(14.5),cyto_nucl(13),cyto(8.5),E.R.(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KKT2	DNA replication licensing factor MCM4	Low	7.1	1	265-287	DLYKRVLKREDVKSKNKKGNLKD	cyto(9.5),mito(9),cyto_nucl(9),nucl(7.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KSC1	Non-specific serine/threonine protein kinase	Low	6.9	1	59-81	IANVTKKYAKTKKIKAQNFKEVI	cyto(9.5),mito(9),cyto_nucl(8.5),nucl(6.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KT30	Nuclear pore protein (Fragment)	Low	7.2	1	24-52	YSQVITELKKIQKKNKKYFTPIKSQFTKV	mito(11),cyto_nucl(9),nucl(8),cyto(8)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KWB6	Translocase TIM22/17	Low	6.2	1	1-22	MLTEKIKKSFQKAKPKIFKTLT	mito(19.5),mito_nucl(12.833),nucl(5),cyto_nucl(4.333)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M472	Uncharacterized protein	Low	9.9	1	1-21	MTRKKYFKNKNQCQKLPDLDR	nucl(18),cyto_nucl(13),cyto(6)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFK9	Uncharacterized protein	Low	8.5	1	104-129	EDYLKKYEMKSKSRKNQKPCSNWEEM	nucl(13),cyto_nucl(13),cyto(11)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MGB4	Uncharacterized protein	Low	5	1	19-39	ERERTLIRRSKNYNKVCRKLL	E.R.(9),pero(4),golg(4),plas(3),extr(3),mito(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MLH2	Uncharacterized protein	Low	5	1	45-70	VSSPNSKYSQNKKKYFRILEEKERKT	E.R.(11),plas(7),golg(3),pero(2),vacu(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MLJ8	Uncharacterized protein	Low	8.1	1	137-157	ELKIKFIRYCRSKKGNHYSSY	nucl(9.5),cyto_nucl(7),pero(5),cyto(3.5),E.R.(3),golg(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KRK2	Zinc finger C2H2 protein	Low	9.1	1	209-231	YPDCKRAFKRFEHLKRHNKMHTG	nucl(18.5),cyto_nucl(13.833),cyto(8),cyto_pero(4.833)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KSD4	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22	Low	9.3	1	243-262	KACNIFHKLNKKKDKNDILI	nucl(14.5),cyto_nucl(9),mito(8),cyto(2.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KVP0	Uncharacterized protein	Low	9.7	1	6-28	GGDLNKKKVKQRVLDKKGDHQEK	nucl(18),cyto_nucl(12.5),cyto(5),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KVQ4	Uncharacterized protein	Low	7.4	1	441-469	LKEGILKYQKKNKKFYKAQCTIKKIKEKE	plas(8),nucl(6),E.R.(6),mito(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KW28	Uncharacterized protein	Low	9.2	1	318-392	KKEVTKTVKTSKSKKTKSPEEKAKKSRSKRSTNSKTAKENVENDEKKKSKSKSSDKKKKSSKSKKSKSKGTEKKA	extr(14),mito(4),nucl(3.5),cyto_nucl(2.5),pero(2),golg(2)	SGKKEVTKTVKTSKSKKTKSPEEKAKKSRSKRSTNSKTAKENVENDEKKKSKSKSSDKKKKSSKSKKSKSKGTEKKA (316-392, prob:0.999)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KX78	GTP-binding protein Rho1	Low	5	1	10-35	KLFLFKIKIKSKRKLMASQKMQKSGK	cyto(16.5),cyto_nucl(9.5),mito(7)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M550	Uncharacterized protein	Low	8.9	1	198-221	RKILNSQKRHSKKSRAHLCHHHFH	nucl(13.5),cyto_nucl(10),mito(6),cyto(5.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M960	Uncharacterized protein	Low	7.8	1	1-21	MYHPRVFKRTEQKQEENNVQS	cyto_nucl(12),nucl(11),cyto(11),mito(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MC57	Uncharacterized protein	Low	9.6	1	346-372	LVVFIIKLSKRIRRKQKNFIYKQTDSL	nucl(18),cyto_nucl(12.5),cyto(5),mito(2),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MCJ0	Uncharacterized protein	Low	9.4	1	64-84	GLNEYKKKLNDKKIKIKNMND	cyto(14),nucl(11)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MGM9	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	Low	9.9	1	185-204	IKNSKRRTIFELKRRRYNVF	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MI55	J domain-containing protein	Low	5	1	19-43	EDNYKRLIKKVHPQKNPKETQRYYE	plas(15),mito(8),E.R.(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ML51	Uncharacterized protein	Low	7.4	1	17-37	TENKISTKKVFKKASEKLEKD	nucl(6),mito(5),cyto_nucl(5),E.R.(5),cyto(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MLL5	Uncharacterized protein	Low	5.7	1	23-42	VTNTCNQKLKHKTNAQKVND	mito(23),nucl(2),cyto(2),cyto_nucl(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KPW9	Uncharacterized protein	Low	9.3	1	18-37	NATCSISKSHRRKSDLPFCL	nucl(14.5),cyto_nucl(10),mito(5),cyto(4.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KR47	CMP/dCMP-type deaminase domain-containing protein	Low	8.8	1	212-236	LVHGRIKRVFIKNKRKNGPFTKYKL	nucl(10),mito(9),cyto(5),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KX99	60S ribosomal protein L11	Low	8.8	1	130-159	ADLKRPGDRVSKRKRLRSRVGKSHKITKEE	mito(17),cyto_mito(12.333),cyto(5.5),cyto_nucl(5.166),nucl(3.5)	RPGDRVSKRKRLRSRVGKSHK (134-154, prob:0.95)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M5B1	Uncharacterized protein	Low	8.6	1	12-34	ATATIRRDNKRDQNNKKQSVAKR	nucl(12.5),cyto_nucl(9.5),cyto(5.5),mito(4),E.R.(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MIF4	Protein DBF4 like protein A	Low	8.5	1	46-65	QENKRFRTGPTKKSKKPGYC	nucl(12.5),mito(10),cyto_nucl(9),cyto(4.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MIF7	Uncharacterized protein	Low	9.4	1	352-377	EYSIVYKNNGKKKRNIKIFMGCTRKG	nucl(17.5),cyto_nucl(13.5),cyto(8.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KS24	Uncharacterized protein	Low	8.4	1	280-299	DSKVQEPKKKKSSSSCFGCF	nucl(12),cyto_nucl(9.5),E.R.(6),cyto(5),golg(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KTJ1	RNA 3'-terminal phosphate cyclase-like protein	Low	9.9	1	17-43	SYSLLSKKSVKIKIKRSREYKEDYVKM	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0LZM5	Uncharacterized protein	Low	9.4	1	18-47	DESTFPSKTYKKNLCRKKHCDKNCLKYAGE	nucl(17.5),cyto_nucl(13.5),cyto(8.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M5V3	Integrator complex subunit 11	Low	5.6	1	468-491	SSGVYAKLSIRKNKKNKIIEVFEV	cyto(22.5),cyto_nucl(14),nucl(2.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MBL5	Uncharacterized protein	Low	7.5	1	113-135	HLFKRFIPYYKKKKDKERTMIFS	nucl(7.5),cyto_nucl(6),pero(5),mito(4),E.R.(4),cyto(3.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFY8	Sec61beta	Low	8.1	1	3-26	KVPNNEVKQKQLRQRQKHLNELLY	plas(14),nucl(8),mito(2),E.R.(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MH34	Ubiquitin fusion degradation protein 1	Low	8.8	1	12-31	EPSWRLRPSKYSRDNQNNFG	nucl(14),cyto_nucl(12),cyto(8),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MIL9	Uncharacterized protein	Low	9	1	105-124	TPSWRFYRKNPLKFVKVKNE	nucl(10),mito(7),plas(6),E.R.(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MRF0	O-acyltransferase	Low	8	1	11-34	DLLHSKDVHKTKNKPQNNNIHGLY	plas(22),pero(2),E.R.(2)	KKGIISKKGSIKKSKRI (107-123, prob:0.887)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KPA5	Uncharacterized protein	Low	7.7	1	24-43	YPNIKFRSRRSILRQPEQSY	nucl(9),cyto(8.5),cyto_mito(7),mito(4.5),extr(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KVI7	Uncharacterized protein	Low	8.9	1	116-141	IHLFKRFIPYYKKKKDKERIMIFSFL	nucl(11),mito(9),cyto(4),vacu(2),cyto_pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M629	Uncharacterized protein	Low	9.3	1	263-288	TADHVLRCLKKKFKRKALFTVRESYY	nucl(16.5),cyto_nucl(13),cyto(8.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M6Y6	Uncharacterized protein	Low	6.2	1	4-32	NEFYPEFKSKYQKKTRKSKVDTRLQDINR	plas(16),nucl(3),mito(3),mito_nucl(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M7M2	Uncharacterized protein	Low	9.9	1	1-20	MKCKEKKSFDEDKNPKRVKE	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MB45	DNA-directed DNA polymerase alpha (Fragment)	Low	8.6	1	122-141	IGFTKIKKKIKQFKNYEEFF	nucl(12.5),cyto_nucl(9.5),mito(7),cyto(5.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MCT9	Uncharacterized protein	Low	6	1	29-50	VNTTIRKRYRKQNKQYLICHDE	E.R.(9),mito(5),plas(5),cyto_nucl(4),nucl(3),cyto(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MF66	Fanconi anemia group J protein	Low	8.6	1	671-690	NKFLEEKKSEEDKKNSKNLL	nucl(13.5),cyto_nucl(12.5),cyto(8.5),pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MIA7	Uncharacterized protein	Low	8.4	1	1-25	MNYEENEKRNKKRESRLKSVVQNVC	nucl(12),cyto_nucl(10.5),cyto(7),mito(6)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MLS0	Uncharacterized protein	Low	9.3	1	55-74	FTFLKKRKSEFKTKRNLIRS	nucl(16),cyto_nucl(13),cyto(8)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MRL6	Spindle pole body component alp14	Low	9.5	1	4-27	VERLEEKMKSKNWKERQEAYVRLK	nucl(19),cyto_nucl(15.5),cyto(8)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KQL6	ADP,ATP carrier protein (Fragment)	Low	8	1	93-112	KPIFIKKSTKKKGPKVKVGF	mito(12),plas(9),E.R.(3),golg(2)	KKSTKKKGPK (98-107, prob:0.81)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KW57	Cleavage and polyadenylation specificity factor subunit 4	Low	7.4	1	121-142	CKHGANCKNKHVRRKMCYNYYL	nucl(11),cyto_nucl(10.833),cyto(9.5),mito_nucl(8.833),mito(5.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0LZC9	Uncharacterized protein	Low	9.9	1	286-310	FAAICLFLKRKNRKSKNNEIEEDHK	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M0Z9	Uncharacterized protein	Low	6.2	1	1-20	MDYRREKDNQFEKNKKKETD	mito(10),plas(7),mito_nucl(7),nucl(4),golg(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MEC3	Uncharacterized protein	Low	8.2	1	1-24	MDNEKKENKVKPPRYNEKSLIKKF	nucl(11.5),cyto_nucl(11),cyto(9.5),mito(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFN1	Nuclear pore protein	Low	6.7	1	25-52	FQVITELKKIQKKNKKYFTPIKSQFTKV	mito(13),cyto(6.5),cyto_nucl(6.5),nucl(5.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MMY4	Paired amphipathic helix protein Sin3a	Low	9.5	1	99-118	VERLKRKQANNYIQKVKKRY	nucl(17.5),cyto_nucl(14),cyto(7.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KNF0	Uncharacterized protein	Low	9.3	1	82-104	NESVKIFKKSRSRPKKEYLEVLF	E.R.(7),nucl(4),pero(4),mito(3),plas(3),cyto_nucl(3),golg(3),cyto_pero(3)	RSR (92-94, prob:0.61)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KNF5	Pyruvate kinase	Low	7.4	1	17-36	FSTQKKITIKCREAKKPVIC	cyto_nucl(11),cyto(10.5),nucl(8.5),mito(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KSU9	GPI-anchor transamidase	Low	7.5	1	68-88	DEKKYLPYKKLKRHGHSIKDF	nucl(7),E.R.(6),plas(5),mito(4),cyto(2),pero(2),cyto_pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KW68	60S ribosomal protein L8	Low	8.8	1	1-26	MGKVIRKIREVKKKERKNHELSIAKY	mito(22),nucl(2),pero(2)	RKIREVKKKERK (6-17, prob:0.826)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M7B2	60S ribosomal protein L34	Low	9	1	110-137	KTVTGKYKNIKQKKHSKVRRCHECNAKL	mito(16),nucl(3),cyto(2),plas(2),pero(2),E.R.(2),cyto_pero(2)	NRRKVVKTVTGKYKNIKQKKHSKV (104-127, prob:0.786)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MD91	Eukaryotic translation initiation factor 5	Low	9.1	1	244-270	NELFKFFSKPQNNKKRSLDFKNEINKY	nucl(15.5),cyto_nucl(13),cyto(7.5),golg(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0ML30	Uncharacterized protein	Low	9.7	1	8-27	KEFVQKLRFVRPNKKYNQIL	nucl(17.5),cyto_nucl(13.5),cyto(6.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KPJ3	DNA polymerase epsilon catalytic subunit	Low	9.8	1	275-294	PENPHDKEDNHKKNKYNEDS	nucl(19),cyto_nucl(12.5),mito(4),cyto(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KRB2	Extracellular serine proteinase	Low	9.9	1	510-540	LIIYWICKMIRHRKERKREEVRKNSREYILE	E.R.(7),nucl(5),plas(4),pero(4),mito(2),extr(2),cyto(1),golg(1),vacu(1)	RHRKERKREEVR (520-531, prob:0.784)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KVM1	Cell division cycle protein 20	Low	8.3	1	338-362	DESLKFWRIVDKQKTNKKRESVDVR	nucl(11.5),cyto_nucl(9.5),cyto(6.5),mito(5),pero(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MAZ9	Oxidoreductase	Low	6.6	1	265-284	HRKFHLEKRLEERNKRKMVA	cyto_nucl(5.833),nucl(5.5),cyto(5),plas(4),E.R.(4),cyto_mito(3.833),pero(3),golg(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MCS2	DNA topoisomerase III	Low	6.2	1	36-61	KTENNKGRRFLKCKKAYKPCKFFEWA	mito(17),cyto(6),cyto_nucl(6),nucl(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MED6	DBF4-type domain-containing protein	Low	9.2	1	46-65	QENKRFRTGPTKKSKKPGYC	nucl(13.5),mito(10),cyto_nucl(9)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFM0	6-phosphofructokinase	Low	8.3	1	649-670	LSETAHRLRNRYKESKRHGIVI	cyto_nucl(13),nucl(12.5),cyto(12.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MG85	DNA replication licensing factor MCM2	Low	6.8	1	114-133	ITKNMKKKFIKYFKKNNTDI	mito(16),nucl(5.5),cyto_nucl(5),cyto(3.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MGG6	Uncharacterized protein	Low	9	1	46-67	MGDGHKARFKRRRRQVDALFQH	cyto(14.5),cyto_nucl(9.5),mito(4),nucl(3.5),pero(3)	ARFKRRR (52-58, prob:0.694)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MH58	Uncharacterized protein	Low	9.5	1	174-193	SSKESEKNGLGKKKRSSKKK	extr(10),E.R.(7),nucl(4.5),cyto_nucl(4.5),cyto(3.5)	NGLGKKKRSSKKK (181-193, prob:0.978)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MIB6	Uncharacterized protein	Low	8.8	1	400-424	IWEIDHRKRCQLRRRKNYVCYPCSD	nucl(13.5),cyto_nucl(11),cyto(7.5),mito(4)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KP23	Putative E3 ubiquitin-protein ligase	Low	9.1	1	563-588	LPNTHKYYKQSTVKRKFNKKVTVEDL	nucl(11),plas(9),mito(4),cyto(1),E.R.(1),golg(1)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KQV2	Uncharacterized protein	Low	8.9	1	18-37	LLDHKKIKYDKNPEYYRKKG	nucl(15.5),cyto_nucl(12.5),cyto(6.5),mito(5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KWQ0	Uncharacterized protein	Low	8.8	1	267-288	IYNERKKEVKWLYKPKESNKLI	nucl(14),cyto_nucl(11.5),cyto(5),mito(4),E.R.(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KX60	1-acyl-sn-glycerol-3-phosphate acyltransferase zeta	Low	6	1	414-448	INFSHMPKKGCSCRKKAFRYLKKKHGLRNCRLDML	plas(7),golg(5),mito(4),pero(4),nucl(3),cyto_mito(3),cyto_pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KZE8	Uncharacterized protein	Low	9.7	1	234-275	NDDDKKSKTNEKIKEKTQDKFKQNRNKVKRETMKRDRPVSLH	E.R.(10),nucl(5),cyto_nucl(5),pero(5),cyto(3),golg(2)	EKIKEKTQDKFKQNRNKVKRETMKR (244-268, prob:0.767)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M2E4	Sec61beta	Low	8.1	1	3-26	KVPNNEVKQKQLRQRQKHLNELLY	plas(14),nucl(8),mito(2),E.R.(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M410	Exosome complex exonuclease rrp4 (Fragment)	Low	5.9	1	189-208	ETIKRVMKVVKKLKNNVEKM	cyto(21.5),cyto_nucl(13),nucl(3.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MCD4	DNA primase large subunit	Low	8	1	37-65	YLPSTYTSPTPKKKMKRLKSEKLLLPNFY	E.R.(7),mito(3),cyto(3),plas(3),pero(3),golg(3),cyto_mito(3),cyto_pero(3)	KKKMKRL (48-54, prob:0.692)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MFA0	Vacuolar sorting protein 9	Low	8.9	1	1-25	MKPSLPRCRQENKKLLKTIKSFKKD	nucl(14.5),cyto_nucl(11.5),mito(6),cyto(5.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MID0	Uncharacterized protein	Low	9	1	1-21	MRLNKKPTKRFIRDIQEKSIK	nucl(14.5),cyto_nucl(10.5),mito(6),cyto(5.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MKQ0	Exosome complex exonuclease rrp4	Low	5.6	1	204-223	ETVKRVMKVVKKLKNNVEKM	cyto(15),cyto_nucl(9.5),mito(8),nucl(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MMH2	Serine/threonine-protein kinase/endoribonuclease IRE1	Low	7.4	1	62-88	LYMHKRVLIKWYKKRKPEITKEIQILQ	nucl(7.5),cyto_nucl(7),cyto(5.5),E.R.(4),pero(3),extr(2),vacu(2)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MNP8	ATPases involved in chromosome partitioning	Low	7.3	1	1-20	MKGFKCSKCKTTNKIFNDCN	mito(10),cyto_nucl(9),nucl(8),cyto(8)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MNT4	Putative spore wall protein 4 (Fragment)	Low	8	1	342-361	LNLFLKYVMKKKLKKSARKK	E.R.(12),mito(5),plas(3),pero(3),cyto(2)	KKKLKKSARKK (351-361, prob:0.968)
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KLJ5	WD-repeat protein	Low	7.6	1	532-551	NPYIHNKKFKKSYFKYHNFL	mito(12),cyto(8),nucl(7)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KQ91	Protein disulfide isomerase	Low	7	1	284-307	VIYNPKDKKFYHKKNNLNEFNFKE	cyto(14),cyto_nucl(11.5),nucl(7),mito(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KTY1	Uncharacterized protein	Low	7.5	1	505-530	GFIVNTTIRKRYRKQNRRYLICQDEV	nucl(8.5),cyto_nucl(7.333),E.R.(7),cyto(5),cyto_mito(3.833),pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KUY1	Uncharacterized protein	Low	9.3	1	274-296	PDNEKENIKKRFKHKYEHFLLFY	nucl(16.5),cyto_nucl(13),cyto(8.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KVX8	Uncharacterized protein	Low	9.8	1	2-27	GNDIPKQQPSPKPKPKPTKETEKENS	nucl(18),cyto_nucl(11.333),mito(6),cyto(2.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0KXP9	Transcription initiation factor IIA subunit 1	Low	7.4	1	99-119	LYVKVHRTRTKYKCSFKQGFI	cyto(13),cyto_nucl(13),nucl(9),pero(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0M7Z3	Histidine--tRNA ligase	Low	7.8	1	83-104	MAMNKLKKIKRYQIGKVFRRDQ	cyto(13.5),cyto_nucl(13.5),nucl(10.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MCZ1	Zinc finger, C2H2-type (Fragment)	Low	8.8	1	401-420	INCLTVRKIQKTNKHRNYLL	nucl(14.5),cyto_nucl(13),cyto(10.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MF42	Uncharacterized protein	Low	8.8	1	31-55	LVLFNSKNQRHFKKLQRSKNDSLEE	nucl(14.5),cyto_nucl(13),cyto(10.5)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MHQ6	Palmitoyltransferase	Low	5	1	115-134	KCNTYKPPRAHHCKVCNRCF	plas(11),mito(7),E.R.(7)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MJZ1	Uncharacterized protein	Low	8.5	2	11-30, 44-65	MIVSAFKTNKPRKRPYDFTN, ERSLDFCLKKKNKKPKDTFLVS	mito(19),nucl(4),cyto(3)	
UP000016927	Nosema bombycis (strain CQ1 / CVCC 102059)	R0MNS9	26S proteasome non-ATPase regulatory subunit 12	Low	9.1	1	244-263	IREERKERLKKLKEDKNNEE	nucl(15),cyto_nucl(13),cyto(9)