ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F7P1	Vegetative incompatibility protein HET-E-1	Low	6.5	1	26-46	ASLNSRQKKSFRRSRLAASSS	mito(14),cyto(8),nucl(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FEQ5	ATP-dependent helicase HRQ1	Low	8.6	1	973-994	ALKEFARKETQRKRPGRLTFYD	nucl(13.5),cyto_nucl(11.5),cyto(8.5),pero(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FPE5	Protein sel-1-like protein 1	Low	7.7	2	64-83, 775-795	EQLARLPSRNYPRRERRYTL, MLLYYRQQRQQQHRRDEEART	extr(11),mito(6),cyto(3),E.R.(3),nucl(2),cyto_pero(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G632	Uncharacterized protein	Low	6.8	1	5-24	TPQPRSPPPHPPPQPRTTNH	mito(16),nucl(5.5),cyto_nucl(5),cyto(3.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UR35	Vacuolar membrane protein	Low	5	1	106-125	ALVYKRWKERPQRPVKIWFF	plas(23),E.R.(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VI19	Glutathione transporter 1	Low	7	2	70-95, 910-929	AADPYNATHRRPRRHQQRSNTSTLRS, LWLYARKKKHSIVRKINLPV	plas(26)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VNH6	Putative oxidoreductase	Low	9.3	1	398-432	IQKSEAKKKNQANKGEAKTKTEQKPQGKKKSKKAT	plas(9),pero(4),nucl(3.5),mito(3),cyto_nucl(3),E.R.(3),vacu(2)	AKKKNQANKGEAKTKTEQKPQGKKKSKKAT (403-432, prob:0.982)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F7K9	PNP_UDP_1 domain-containing protein	Low	7.5	1	168-189	VETITNRNRRLRKYRRPDLATD	cyto_nucl(11.5),cyto(10),nucl(9),cysk(5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FCV6	Uncharacterized protein	Low	6.4	1	55-79	DATTTKSPIRKSRSPRRPWNGDGKG	mito(12.5),cyto_mito(9.5),cyto(5.5),nucl(5),cysk(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FIQ7	Ribosome maturation protein sdo1	Low	5	1	17-36	VSMVRLKKGKKRFEIACYKN	mito(23.5),cyto_mito(14)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FMY8	Putative transporter SEO1	Low	7	2	3-24, 547-575	EANTVPRKKWWKIQWYSDDDTP, KTNECNFTASRKKRSVKCPSLPNKTCTKD	plas(25)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FV34	Polynucleotide adenylyltransferase	Low	7.7	1	437-460	VFELGEKKPQKPQKRQLNANGATT	cyto(14),nucl(8.5),cyto_pero(8.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FZ61	General transcription and DNA repair factor IIH helicase subunit XPD	Low	8.4	1	678-698	LADRRFQKKRVQLPKWINQGL	nucl(11.5),cyto_nucl(9.5),cyto(6.5),cysk(6)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2D3	Uncharacterized protein	Low	6.6	1	6-27	LEYPKRPYGTVKRYSQRRPMLS	mito(12),cyto(9.5),cyto_nucl(8),nucl(5.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VTH9	Biotin carboxylase	Low	8.2	2	437-461, 2150-2172	KQEGSEKTQRRPRPKGHTTACRITS, VWSNSRRYFYWRLRRRLNEEYLL	cyto(15.5),cyto_nucl(10.5),pero(6),nucl(4.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FB81	Phosphomevalonate kinase	Low	5	1	889-910	HHQCEHSTWRTRKGPNRCEECH	cyto(11.5),mito(9),cyto_nucl(7),extr(2),pero(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FST3	ABC transporter G family member 14	Low	5	1	380-408	ASITRIARACERCRRRKIRCEGTQPCSGC	plas(23),E.R.(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FZT8	Autophagy-related protein 37	Low	5.9	1	253-273	LVLLWMRKRKDRRLEDIVRAG	mito(10),cyto_mito(10),cyto(8),nucl(3),pero(2),E.R.(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G1T4	RNA-binding protein rnc1	Low	8.9	1	90-114	CLFQHPPREKKNTRSNHRDRTRFHS	nucl(15),cyto_nucl(12),cyto(7),mito(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G4Y9	Putative copper-transporting ATPase HMA5	Low	5	1	426-447	EERSRRITQKHQRKLLRRVYLT	plas(14),extr(6),E.R.(4),mito(1),cyto(1),golg(1),cyto_mito(1)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V2I6	Uncharacterized protein	Low	5	1	19-39	VLPSRNPRRCSKKPIHVSNME	mito(22),cyto(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VBE6	Peroxisomal abc transporter	Low	8	1	51-78	ILGAAGGRRWWRRRREEKEQGRKLVRTN	E.R.(6),mito(5),plas(4),golg(4),cyto_mito(4),cyto(3),mito_nucl(3)	GRRWWRRRREEKEQGRK (57-73, prob:0.844)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VVJ9	Dihydroorotate dehydrogenase	Low	5	1	393-415	YGRTLQLVKKYRKKLDNQTLQSG	mito(26)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W1Y1	Carboxylic ester hydrolase	Low	5	1	470-497	EAGVDFTRRHCRWPRRNVFRGGNYKDEN	extr(24),mito(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FBY6	Uncharacterized protein	Low	5	1	77-98	SKHPSFCRSYPRHPNCRHRSST	extr(18),mito(7)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G4A8	Hybrid signal transduction histidine kinase L	Low	7.3	1	526-548	APESTHKSRQRRRNTYSRKNEGN	mito(12),cyto(8),nucl(6)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UN27	Putative tape measure protein	Low	7.2	1	102-122	SASHKTSSSSRKPVKQPPQGT	mito(13),nucl(6),cyto(5),pero(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UYF0	MFS transporter	Low	5	1	59-81	TTTRTTTRKIKYGRGKHSKTELS	plas(24),E.R.(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V4M7	Cell division control protein 48	Low	8.6	1	29-51	DDTATAILKKKKKPNQLMVTDAV	nucl(14),cyto_nucl(13.5),cyto(11)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VEI0	Cortical patch protein	Low	5	1	215-234	RSGGNRFRRNRSVHSRRSVD	plas(21),mito(3),extr(1),E.R.(1),vacu(1)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VT21	Major facilitator superfamily transporter	Low	5	1	468-493	ATVAYMYKRDKKKTTTKRDEEGRDAT	plas(26)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FW07	Uncharacterized protein	Low	9	1	90-110	YRQRQNQSRAKERKQRRGPTS	nucl(15),cyto_nucl(11.5),cyto(6),mito(5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FY84	DUF2415 domain-containing protein	Low	9	1	10-37	YPTSGLISKKSRKHYRIPVRSQHWQLRS	mito(15),nucl(10)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G1R6	Uncharacterized protein	Low	7.5	1	48-68	CKNETRSRRDRWKVERTVRDS	cyto(12),cyto_nucl(11.833),nucl(10.5),cyto_mito(8.333)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G5G1	CFEM domain-containing protein	Low	5	1	390-409	WDAHRRPPPPPPPPPRQHDF	plas(23),E.R.(2),vacu(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484GAV8	Putative Rho-type GTPase-activating protein 2	Low	9.2	1	674-697	ANIEATKDRRIKKKPLQLSESNGS	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VDD5	Phosphoribosylaminoimidazole-succinocarboxamide synthase	Low	5	1	847-879	WPGRDERRLGVRRQKRYTERKSFHERNPSHRSL	plas(26)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VIT1	tRNA wybutosine-synthesizing protein 2	Low	8.7	1	1-25	MMAAHSKKPRSKKPKPENPISAAAR	mito(19.5),mito_nucl(11.5),cyto(3),nucl(2.5)	SKKPRSKKPKPE (6-17, prob:0.91)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VNT9	Endothelin-converting enzyme	Low	7.8	2	15-35, 672-691	GETPRCPYARRGRGRCSIAKV, ASFQAWKRRAQEKPNKSLPG	mito(8),cyto(6.5),cyto_nucl(5),E.R.(3),nucl(2.5),plas(2),golg(2),vacu(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VUP0	Uncharacterized protein	Low	5	1	23-45	LTVWEAMKQTKRNRNPLRSSYVY	plas(17),mito(3),E.R.(3),golg(2),vacu(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FAS4	Putative beta-glucosidase J	Low	5	1	231-252	YQIGYRWYKHQQKKQPQWWFGD	extr(11),mito(7.5),cyto_mito(7.333),cyto(6),cyto_nucl(3.833)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FI35	Biogenesis of lysosome-related organelles complex 1 subunit KXD1	Low	8.1	1	104-132	WTQKKVTSLKSKTSRKHNKEYNKARARYP	nucl(10.5),mito(9),cyto_nucl(8.5),cyto(5.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FNR6	Acetylcholinesterase	Low	5	1	578-600	EDYCGQKAQKQPKPKPIQKVMTA	extr(26)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G0P4	Flap endonuclease 1-A	Low	6.2	1	129-148	FDGPHKPAFKRNRRSGRGDG	cyto(12),mito(9),nucl(3),pero(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V2Q5	Kelch repeat protein	Low	8	1	478-502	GALVWFLLRRRRKRQPAPAVNTPAT	extr(27)	RRK (488-490, prob:0.629)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VBN3	Acriflavine sensitivity control protein acr-2	Low	9.8	1	5-36	DMLNAPTKPCHNCRRRRLRCDRSYPHCHKCTA	nucl(12),mito(7),cyto(3),plas(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VEG5	Citrinin biosynthesis cluster MFS transporter mrr1	Low	5	1	572-596	IPFIFLKWGKRIRQRSKLIRTLEEQ	plas(27)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VJS3	Beta-d-glucuronidase	Low	5.8	1	576-595	FTRDRKPKSAVQVLKRRWTS	extr(9),cyto(6),mito(5),pero(3),nucl(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VLU7	E3 ubiquitin-protein ligase listerin	Low	6.2	1	1575-1599	SIISTDKKMPDKRCQTCKNLFHRTC	mito(23),nucl(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W2K1	Cytochrome p450	Low	8.8	1	228-247	ISTRNPWKKRKAEKGLQALR	mito(9),cyto(4),plas(4),extr(4),nucl(2),pero(2)	KKRKAEK (235-241, prob:0.725)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W4K9	Pentatricopeptide repeat protein	Low	7.3	1	696-716	FDTPTTRQKLRLTKRKIDGFV	cyto(8),pero(8),cyto_pero(8),nucl(7)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FG87	Thiosulfate sulfurtransferase RDL2	Low	5	1	8-33	IEAWPYRYQKNKCLKTHRRRSEMMLA	mito(18.5),cyto_mito(12.5),cyto(5.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FX56	Arginyltransferase	Low	7.2	1	66-87	GSLKNLPKQPLRRKASHTRQTT	cyto(8.5),cyto_nucl(8.5),nucl(7.5),mito(3),plas(2),pero(2),E.R.(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FZK7	Uncharacterized protein	Low	7	1	47-70	KYFSRPSRIPRLPQWRKRLRALCP	mito(18),nucl(5),cyto(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G7P5	Putative transcriptional regulatory protein	Low	9.1	1	191-214	STPPRKRSKVSRACDECRRKKVKC	nucl(14),cyto_nucl(10.5),mito(5),cyto(5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G884	SUMO-conjugating enzyme ubc9	Low	9.2	1	3-23	LCQNRLQEERKQWRKDHPFGF	nucl(16),cyto_nucl(12.5),cyto(7),mito(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484GAD5	Uncharacterized protein	Low	9.1	1	1-31	MCSEKIQFRLRMKQKSRREPKPQFKNTLIKF	nucl(15.5),cyto_nucl(10.5),mito(7),cyto(4.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484GBB2	Uncharacterized protein	Low	8	1	64-86	STSWPVARYRRHHHDRPKDASVS	mito(9),nucl(8),cyto(6),plas(2),extr(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VK24	Uncharacterized protein	Low	8	1	56-82	QPQPSQAKPLFRRQPRKRSAVPRYPAP	plas(11),extr(6),mito(5),golg(3)	R (71-71, prob:0.6)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FFG3	Beauvericin cluster-specific repressor BEA4	Low	5.8	1	7-31	ASCFACKARKVKCDLQKPYCNRCTS	mito(14),extr(5),cyto(4),nucl(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G7H1	Cleft lip and palate transmembrane protein 1-like protein	Low	8	1	192-211	PLTQYIPKKKEKKTRSLLDG	plas(16),E.R.(6),vacu(3)	GKAKKRK (640-646, prob:0.865)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UL78	Myo-inositol transporter	Low	5	1	514-533	AEEWRKQRKLEMRERREEGG	plas(26)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UU54	Acetolactate synthase	Low	5	1	670-692	LAWDGEKDKKRRELMRQRTCGLH	mito(23.5),cyto_mito(14)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V720	Calcium-transporting ATPase	Low	5.4	1	1151-1170	HSPFRQKMHNAKVKAKEKAH	plas(22),nucl(1),pero(1),E.R.(1),golg(1),vacu(1)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V7F4	Duf500 and uba ts-n domain protein	Low	8	1	24-44	LSSLHKPSAPKPPKPPNRGIG	mito(25)	KPPKP (34-38, prob:0.641)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VBG0	Cell division control protein 1	Low	8	1	626-651	SALPMPPPKSKHKKQGWGHKTPRIEI	plas(21),mito(2),cyto(1),extr(1),E.R.(1),vacu(1),mito_nucl(1)	KSKHKK (634-639, prob:0.68)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VDU5	Allergen Asp f 7-like protein	Low	5	1	18-40	QPHQHGNNKRRHVHGKHQKRALV	extr(22),cyto(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F8N8	2-oxo-Delta(3)-4,5, 5-trimethylcyclopentenylacetyl-CoA monooxygenase	Low	7.2	1	755-774	NKNLAHKQKRSMTRYNGPAP	cyto(12),nucl(6),mito(3),plas(3),pero(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F9N2	Multifunctional cytochrome P450 monooxygenase	Low	8	1	18-42	FVTDWFLRARKKSNRPPLPPGPKGL	cyto(8),extr(5),E.R.(5),cyto_mito(5),golg(4)	RKKSNRP (27-33, prob:0.644)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F9Y0	Cytochrome P450 monooxygenase patI	Low	5.4	1	492-512	NTLPKPFKVRFVPRSQKRMEL	extr(12),mito(7),cyto(3),pero(2),nucl(1),plas(1),golg(1)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FEW8	Uncharacterized protein	Low	7.1	1	19-49	PLKRKQVSQACEPCRKKKKRCVHADQVQTEA	mito(9),cyto_nucl(8),nucl(7),cyto(7),E.R.(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FG30	Putative transcriptional regulatory protein	Low	8	1	3-26	HGLCRLPVLRRRPQTRPRVPAPDA	mito(16),nucl(8),cyto(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FJ72	Uncharacterized protein	Low	5.9	1	42-64	AKTMGRKNKEYYRQRARLRRLTL	cysk(22),nucl(2.5),cyto_nucl(2.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FX06	Uncharacterized protein	Low	8	1	78-97	QVDSCRGRRRNPTNQSHRMF	nucl(10.5),cyto_nucl(10.5),cyto(7.5),mito(6)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FYN5	MFS transporter prlL	Low	5	1	305-324	QKVARLRLRRDKPQNNHESK	plas(22),E.R.(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V0A8	Catabolite repression protein crec	Low	8.9	1	170-192	ANTKDAAKKKIPKPKNNMTKSNS	cyto(11.5),extr(11),cyto_mito(7),nucl(3)	KKKIPKP (177-183, prob:0.69)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V0L5	Moz protein represents a chromatin-associated acetyltransferase	Low	7.8	1	15-38	FRALRASRSPCRRRPVPQHTAATS	mito(12),nucl(7),cyto(4),extr(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VHK4	RNase z	Low	5.8	1	268-289	AEKTKHTKWKDLEKVVRKWPET	mito(12),cyto(10),nucl(2),pero(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VPF8	GTPase-activating protein	Low	7.6	1	636-656	SQSEGTRRKQQKQQVLGPYKF	mito(13.5),mito_nucl(13.333),nucl(12),cyto_nucl(7.333)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FMJ8	Uncharacterized protein	Low	7.9	1	106-129	SPSFSTRTSKRCRCLQQRMILGEK	nucl(10.5),mito(10),cyto_nucl(9),cyto(6.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FN63	FAD-linked oxidoreductase chyH	Low	5	1	477-502	DGWRLEKLRGLKKKWDPENRMRFYNP	extr(12),cyto(7.5),mito(5),cyto_nucl(4.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2N6	Hemerythrin domain-containing protein	Low	9.6	1	115-135	LESCRSRKKQFDPSTLKRKMD	nucl(12),cyto(10),mito(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G4R8	Uncharacterized protein	Low	8	1	7-31	SVSLCPVARPRRPRRGRDDARFARL	mito(23),cyto(3)	RPRRPRRGRDDARFARLAKSPRR (15-37, prob:0.918)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VJW2	Glycoside hydrolase family 74 protein	Low	8	1	741-760	YPAVRARKTLRGRTLRLGRA	extr(26)	KTLRGRTLRLGRAAHK (748-763, prob:0.655)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VL52	Uncharacterized protein	Low	5.8	1	124-144	ATGDRKKDEEARKERNRWGGE	mito(12),cyto(6.5),cyto_nucl(5),nucl(2.5),plas(2),extr(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FHI1	Uncharacterized protein	Low	6.6	1	147-169	YVRPCPTCKGSHHPRFCKKSIHI	cyto(15),mito(6),nucl(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FK71	Uncharacterized protein	Low	7.2	1	33-55	LLPHIFRRHRHGRSQWKNAKWVL	plas(12),nucl(6),golg(3),mito(2),cyto(2),cyto_mito(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FL56	Putative transcriptional regulatory protein	Low	8.3	1	18-41	KSSCDACRARKIRCDRENPCAHCQ	nucl(11.5),cyto_nucl(9),cyto(5.5),plas(5),mito(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FVP6	Uncharacterized protein	Low	8.2	1	244-267	SRPAHEPSKPCRRQREFSFNPGED	nucl(11.5),mito_nucl(9.5),cyto(8),mito(6.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FYU9	Vegetative incompatibility protein HET-E-1	Low	8.8	1	26-46	DDDLRRHDPKRQRAGRDITED	nucl(13),cyto_nucl(9.5),cyto(4),mito(3),plas(3),pero(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G574	Uncharacterized protein	Low	6.8	1	1-21	MRDAKVQRRWRARPPAPRVAP	mito(17.5),mito_nucl(12.5),nucl(6.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G5A3	DnaJ-related protein spj1	Low	7	2	38-63, 414-433	REIKSAYRKLSKRYHPDKNPNDETAK, RDTSVFVRKKRNARKSSSFA	extr(20),plas(3),cyto(1),pero(1),E.R.(1),vacu(1),cyto_pero(1)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G963	Uncharacterized protein	Low	9.3	2	30-51, 313-358	LNPSASLQRKRREYKGKSFFDG, QPITAWNEKEQKKRQRHFDDWKAQATTRRQGWKKARGSRQQPTTMT	cysk(8),nucl(6),cyto(6),cyto_nucl(6)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V9V0	Uncharacterized protein	Low	7.1	1	27-49	VVAPQRHQRLREKRRQQGRGDVS	mito(8),nucl(6.5),cyto_nucl(6.5),cyto(5.5),extr(2),pero(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VH41	Ubiquitin carboxyl-terminal hydrolase	Low	9.5	1	573-602	STPMPVAPRPPVRSNRKKPPADRWWRISDE	extr(10),nucl(4),E.R.(3),golg(3),cyto(2),plas(2),mito(1),pero(1),vacu(1)	PPVRSNRKKPP (582-592, prob:0.731)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VMR3	Cell wall glycosyl hydrolase	Low	5	1	374-399	TYNQTKTAGRRSPKPRQWNRRLKSYY	extr(19),mito(4),vacu(2),mito_nucl(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F933	Zinc finger protein MSN2	Low	8.1	1	12-40	KFECAYCRRNFTKKEHLKRHERGHTGSKP	nucl(8),plas(7),mito(4),cyto(3),pero(2),E.R.(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FFY6	Uncharacterized protein	Low	7.7	1	1-21	MEVQKSRRLRRQWFEHQDWNG	cyto_nucl(11),nucl(10),mito(8),cyto(8)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FLJ0	Uncharacterized protein	Low	8	1	58-85	LICLCFPRRQEKRQNRVTHKSPRPHLRC	nucl(10.5),mito(9),cyto_nucl(9),cyto(6.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FUN2	Putative GTPase-activating protein	Low	9.1	1	168-189	KDSTTDKDKKDKREQRITIHLA	nucl(14.5),cyto_nucl(11),cyto(6.5),pero(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G636	Histidine--tRNA ligase	Low	8	1	361-384	SDDTTVKSKKKSKSKDKDDEDRSD	mito(23),cyto_mito(14)	KKS (370-372, prob:0.625)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G6E8	Uncharacterized protein	Low	8	1	169-188	CMSTRVKKAMRKRKNSDAGT	plas(24),mito(1),E.R.(1),vacu(1)	RK (179-180, prob:0.611)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UMM7	Membrane protein	Low	9.4	1	230-251	FSDRGSWQRASKRRKLTDPNDV	nucl(17),cyto_nucl(13.5),cyto(8)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UYA2	Alpha beta hydrolase family	Low	5	1	39-58	APAHDRRKTARSPKRTLIPH	extr(13),cyto(7),mito(2),pero(2),E.R.(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V2T2	Uncharacterized protein	Low	5	1	757-779	AAEPYEKKPYQPRAARHHARAHG	extr(26)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VIJ8	40S ribosomal protein S24	Low	9.8	1	99-129	LANKIEKASRQQRKQRKNRQKTLRGTAKVKG	cyto(10.5),mito(10),cyto_nucl(9),nucl(6.5)	IEKASRQQRKQRKNRQKTLRGTAKVKGAKKKKE (103-135, prob:0.993)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VJR4	UbiD family decarboxylase	Low	5	1	398-417	RSSSQTSKDKHKKEDALVKW	cysk(17),cyto(7.5),cyto_nucl(5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W744	Laminin-like protein epi-1	Low	6.5	1	696-720	REQQQRKSDELKKKMQKLKEEQENM	extr(7),nucl(4.5),cyto_nucl(4),E.R.(4),golg(3),cyto(2.5),mito(2),pero(2),vacu(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FCC0	Uncharacterized protein	Low	9.5	1	762-793	DEHKTRTRTPLPSSRRRSKRPRTEPKSYAVDP	mito(14),cyto(5.5),cyto_nucl(5.5),nucl(4.5)	SSRRRSKRPR (774-783, prob:0.835)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FJ11	ATP citrate synthase	Low	8	1	748-783	HERTIAQEKPDPKRNRRKRKDARTRTKKNMSFFRIT	mito(11),cyto(4),plas(4),extr(4),pero(3)	KPDPKRNRRKRKDARTRTKK (756-775, prob:0.989)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FKI5	Aspercryptin biosynthesis cluster-specific transcription regulator atnN	Low	7.7	1	10-33	RTGCLTCKSRKVKCDEAKPACVRC	mito(12),nucl(7),cyto_mito(7)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FKU3	Uncharacterized protein	Low	7.8	1	46-65	SSSPSFFHHRRRHPSPSRVE	mito(13),nucl(9.5),cyto_nucl(7.5),cyto(4.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FLJ1	Uncharacterized protein	Low	5.7	1	24-56	PVGKRSTRVRAVRCKCQKKRTSRARQNLTRDST	mito(19),nucl(2),cyto(2),cyto_nucl(2),pero(2),cyto_pero(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FMN4	Uncharacterized protein	Low	9.2	1	18-42	HRTSWAVIARRPRRNPNYRHFPEPA	mito(12),nucl(11),cyto(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FP13	Poly [ADP-ribose] polymerase	Low	5.7	1	115-134	VSGLSKPQPPPKQQKAPASA	mito(20.5),mito_nucl(12.666),cyto_mito(11.833),nucl(3.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FVD3	Uncharacterized protein	Low	6.5	1	220-242	GFLLWFWRKRWLRKRRSTLLTPL	plas(10),nucl(4),extr(4),cyto(3),E.R.(3),mito_nucl(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G5N4	ERF-3	Low	6.9	1	1105-1130	ALLHKLQKGTNRKSKLPPSHAKKGDS	cyto(10.5),cyto_nucl(9),mito(8),nucl(6.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G666	ATP synthase subunit beta	Low	6.3	1	103-144	TIFNHYQGVRRRRHQDHEERNSREKAQRQRYARDRDLHDRRD	mito(13),cyto(7),cyto_nucl(6.5),nucl(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V4J8	Endoplasmic oxidoreductin-1	Low	5	1	120-141	GPLAKHPPRRVQHERPERPLQG	mito(12.5),cyto_mito(9.5),cyto(5.5),extr(4),pero(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V4R0	DnaJ domain-containing protein	Low	5	1	22-44	IKKGYRKAALKWHPDKNKDNPDA	mito(9),cyto(9),cyto_mito(9)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VK01	Cytochrome p450	Low	5.7	1	21-40	YSDCRYRRFKQYAQWPQMPP	cyto(8),E.R.(5),mito(4),pero(3),mito_nucl(3),nucl(2),plas(2),extr(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FCT4	Putative methyltransferase	Low	8	1	429-451	LGWKDFSRRSRWRPRKRPEDYGW	plas(21),extr(3),E.R.(2)	RRSRWRPRKRP (436-446, prob:0.803)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FD48	L-pipecolate oxidase	Low	5	1	411-430	STSFMRPHWRWRDNIRRGNG	extr(10),E.R.(5),cyto(4),plas(3),cyto_pero(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FIJ0	Methyltransferase ustM	Low	6.2	1	130-150	LSLPRRAYRGQRRLMRNTSCC	cyto(9),cyto_nucl(8.5),cysk(7),nucl(4),mito(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FKX3	Global transcription regulator sge1	Low	8.7	1	184-210	DRPFPPGEKKRAMKRTKKPTGVTKPND	mito(20),cyto(3),nucl(2),plas(2)	PGEKKRAMKRTKKP (189-202, prob:0.884)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FMB7	Uncharacterized protein	Low	6.5	1	269-290	YEPSKCIRLPDKKTRNNAQNYM	mito(7),extr(7),cyto(5.5),cyto_nucl(5.5),nucl(4.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FMI1	Mitochondrial translation optimization protein 1	Low	6.5	1	1082-1105	LERITLKPDRWRPLRQPKVSVDFP	cyto(18.5),cyto_nucl(12.5),nucl(5.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FTQ4	Putative rhamnogalacturonate lyase C	Low	7.5	1	6-26	EPSTSRCRHETQRPMFRRTRF	cyto(13.5),cyto_nucl(12),nucl(9.5),mito(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G176	Uncharacterized protein	Low	9.2	1	400-430	VLPFKTVRGLLKRKKKQLPERRSSRNGKAMG	plas(18),nucl(3),E.R.(3),cyto(2)	LLKRKKKQLPERRSSRNGKAMGHGRMATDRPPSRVSKR (409-446, prob:0.978)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G587	Uncharacterized protein	Low	6.1	1	260-281	VVPNENSRWRKKPYIRFWPGYE	cyto(13),cyto_mito(11),mito(7),nucl(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UT90	2-(3-amino-3-carboxypropyl)histidine synthase subunit 1	Low	5	1	26-46	EAEPALKQPKKRFVGRRTAAE	cysk(19),cyto(6)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VDR7	Uncharacterized protein	Low	8	1	279-299	LVSRKPLARGRSKRKTIMEFI	plas(16),E.R.(5),mito(3),extr(2)	ARGRSKR (286-292, prob:0.671)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VFY0	F-box domain-containing protein	Low	9.2	1	443-463	VQALRRADKKIQNMRIIRKDY	nucl(15),cyto_nucl(11),cyto(5),pero(5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W4E0	Hypercellular protein	Low	7	1	1028-1048	ILMKRQALRRLNKKEPEKRYI	cyto(12),mito(8),nucl(5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FM50	Uncharacterized protein	Low	8.7	1	103-134	LLQAHWRPQLRHQRPRRPPRRPSRTLALPHRS	mito(20),cyto(3),nucl(2),cyto_pero(2)	RHQRPRRPPRRPSR (113-126, prob:0.873)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FU56	Transcription factor BOA15	Low	8.6	1	16-45	ATGRAAQSCRQCRRLKRRCPRELPSCSLCV	mito(11),nucl(9),cyto(5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FV17	Putative branched-chain-amino-acid aminotransferase TOXF	Low	6.9	1	28-48	FSSINKQVHARKRRILRQGFS	mito(12),cyto(6),nucl(5),plas(2),pero(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FZ25	Uncharacterized protein	Low	9	1	447-468	GDKSKRDWFKRTFFRKNSKSSA	nucl(12),cyto(6),cysk(6),mito(3),cyto_pero(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G4N1	Uncharacterized protein	Low	8.3	1	5-25	HIQRRKQESRLQCTPRRGVKS	nucl(9),mito(9),mito_nucl(9)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UW23	C6 finger domain-containing protein	Low	7.3	1	8-36	VVEGSCWPCKKRRIKCDLTKPRCERCAKV	mito(8),nucl(6),cyto(5),plas(5),E.R.(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V212	Tyrosine--tRNA ligase	Low	8	1	344-375	TAKAYPPVEDEKKKKKKQPKDKGSRYPGGAKK	cyto(21.5),cyto_nucl(13.166),cyto_mito(11.999),cyto_pero(11.999)	KKKKKKQPKDKGSRYPGGAKK (355-375, prob:0.99)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V6I8	ABC transporter	Low	9.2	1	1094-1122	VNVARGKGKFRGRYRGRGRNNQGRQSHTQ	plas(15),nucl(3),mito(2),cyto_nucl(2),E.R.(2),vacu(2)	RGKGKFRGRYRGRGR (1098-1112, prob:0.813)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V7F2	U3 small nucleolar RNA-associated protein 10	Low	7.6	1	624-643	LPPQSKKSKKPIWGDKKLYD	nucl(9.5),cyto_nucl(8.333),cyto(6),plas(5),cyto_mito(4.833),E.R.(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VD70	Uncharacterized protein	Low	8.6	1	5-24	KEEKPRPKSLQSSKTPEPRL	nucl(12.5),cyto_nucl(10),cyto(6.5),mito(4),pero(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VI39	Duf1620 domain-containing protein	Low	5	1	264-287	IFLILRKKKQNPQQQQQQQQQPPQ	extr(27)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VIS1	Flavin carrier protein 2	Low	8	1	615-641	AINACIKENPHRKRRKELEKMQRDMDT	plas(16),E.R.(6),extr(2),mito(1),golg(1),vacu(1)	RKRR (626-629, prob:0.641)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VNW0	Terpene cyclase/mutase family member	Low	6.4	1	32-57	AEQQWPKKPRITAKTDRTKWRMKDED	cysk(10),cyto(8),nucl(4),pero(3),mito_nucl(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VPV1	Major facilitator superfamily transporter	Low	5	1	514-538	YPLVKAYYVRRNKSRDNKWNAMSEE	plas(23),vacu(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VXR0	Uncharacterized protein	Low	7.3	1	223-254	SSSYPRKQTSSKRRFAPQPRRRQQPTTPTRSN	mito(18),nucl(6),cyto(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W493	Cell division control protein 12	Low	7.5	1	52-76	FSTTIKNYADHKRRHQKQVDKTVEI	nucl(11.5),cyto_nucl(11.333),cyto(10),cyto_mito(7.833),mito(4.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDH9	Subtilisin-like protease 3	Low	5	1	479-499	AQPPQPPKPQWSKNPKGFRGA	extr(21),mito(3),cyto(3),cyto_mito(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FWK8	Uncharacterized protein	Low	9.6	1	51-74	VSSLYRYRTQQKRWQLPRDKEMSK	nucl(12),mito(10),cyto(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V0J2	PEX11 domain protein	Low	8	1	245-273	RARLRAIVMKRREHRKRWRRNIAVTVRTL	plas(22),pero(2),mito(1),E.R.(1),vacu(1),cyto_pero(1)	LRAIVMKRREHRKRWRR (248-264, prob:0.921)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V6I6	Bikaverin cluster transcription factor bik5	Low	9.4	1	61-88	RMITSCLECRRRKLKCNKSQPCINCMKF	mito(14),nucl(11)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VA59	Uncharacterized protein	Low	5	1	10-44	LTIPPQPQSRTRVRRQRRPNYRQARQFKRWMLRAQ	plas(18),mito(7)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VBV3	Dimethylaniline monooxygenase	Low	8	1	446-465	MAGHEKRKGMWRRLNAQARE	mito(13),cyto(6),extr(5),pero(2)	RKGMWRR (452-458, prob:0.635)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VZX5	Origin recognition complex subunit 6	Low	6	1	335-359	YDYLSEKRRREYKIWKERILRRIDA	mito(10),cyto(9.5),cyto_nucl(7),pero(4),nucl(3.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F7X3	Uncharacterized protein	Low	9.5	1	255-278	IVRTNRREKRLNPKNPKPKPKLSF	mito(11),extr(7),nucl(4),pero(2),cyto(1),E.R.(1),golg(1)	RREKRLNPKNPKPKPK (260-275, prob:0.873)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F9A0	Uncharacterized protein	Low	6.8	1	54-77	QARCHQPKCLQLQDKRKNKQKQVL	mito(15),cyto_nucl(6.5),nucl(6),cyto(5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FM59	Salicylate hydroxylase	Low	5	1	359-378	WDSVRRPRASQVQQNSRHVT	extr(17),mito(3),E.R.(3),plas(2),cyto_mito(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FPJ6	Pre-mRNA-splicing factor prp46	Low	9.5	1	69-93	LAAKQPPPMKSRRRLKPQAAPQQLA	mito(14),cyto(5.5),cyto_nucl(5.5),nucl(4.5)	PMKSRRRLKP (76-85, prob:0.73)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FS47	F-box protein pof7	Low	9.1	1	313-333	YSSSWQKLWRHRPRIRFNGCY	nucl(15),cyto_nucl(12),cyto(7),pero(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FVS8	Putative ethanolamine kinase	Low	7.1	1	30-70	SLSSTARRPKFPQRDTPRNQLTLRLGHRRRQDRIRWSKEDV	mito(10.5),nucl(9.5),cyto_mito(9.333),cyto_nucl(8.833),cyto(7)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G724	DNA-(apurinic or apyrimidinic site) lyase	Low	9	1	312-332	PDVAVESSPKRRRTRSQAKHL	cyto(11),nucl(10),pero(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V1B0	Mediator of RNA polymerase II transcription subunit 1	Low	6.1	1	639-660	DVPEADKGKKKRFTPRDLGRLL	mito(17),cyto(4),nucl(3),pero(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V226	Stromal membrane-associated protein	Low	6.9	1	27-49	EANKVCADCKRNKHPRWASWNLG	mito(10),extr(10),nucl(5.5),cyto_nucl(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VGN9	Cytochrome p450 oxidoreductase	Low	8	1	21-45	LLTYERYSKKKKGYRLPPGPKPLPL	plas(15),E.R.(4),vacu(3),pero(2),mito(1),cyto(1),extr(1),cyto_mito(1)	KKKKGY (29-34, prob:0.674)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VPJ4	Uncharacterized protein	Low	8	1	470-501	FRFRILTKSAKPRRRNHQSRSRRSRNDTAALK	extr(13),mito(3),cyto(2),pero(2),E.R.(2),vacu(2),mito_nucl(2),cyto_pero(2)	SAKPRRRNHQSRSRRS (478-493, prob:0.84)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G949	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	46-77	DAPPRAHRACEKCTRTKKKCDKGLPACSRCTR	nucl(12),mito(9),cyto(3),pero(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UXW3	Mitochondrial import receptor subunit	Low	9.1	1	30-54	RRTRAEFRRELRRNERRQHKAEKEE	cyto(6.5),cyto_nucl(5.5),mito(5),extr(5),nucl(3.5),E.R.(3),pero(2)	RRNERR (41-46, prob:0.624)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V8T1	Transmembrane protein	Low	8	1	2-24	GNGAKAQQKRERNQKDAKNKGSQ	mito(17),nucl(9.5),cyto_nucl(5.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V8U6	Sphingolipid long chain base-responsive protein PIL1	Low	9.1	1	272-292	LSTRARTLSTRRKNNIKARAE	nucl(14.5),cyto_nucl(9.5),mito(8),cyto(3.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VPV3	NPP1 domain-containing protein	Low	5	1	290-311	IPDDPPKKEEPKKEEPKPEEPT	extr(20),mito(2),vacu(2),cyto(1),pero(1),E.R.(1),mito_nucl(1),cyto_pero(1)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W452	Uncharacterized protein	Low	5	1	3-24	KQPTTFQKPRMRHFAQRFPSLR	plas(14),mito(8),E.R.(2),extr(1),pero(1),vacu(1)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F6M0	Putative transcription factor TDA9	Low	9.6	1	1-57	MPESRQYKCRYCPKTFKRSEHCIRHERAHTNEKPYVCKYCKKCYSRKDLVTRHERTL	nucl(16.5),cyto_nucl(10.5),mito(5),cyto(3.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F9C1	Aurofusarin cluster transcription factor aurR2	Low	9.1	1	16-35	PKSCRLCASRKVKCDKSVPC	nucl(11),mito(7),cyto(5),plas(2),pero(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FHZ5	Uncharacterized protein	Low	7.3	1	95-119	WLSFSPSRTHHRKRNSRFPGRLIGH	mito(16),nucl(6),cyto(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FWV7	Putative dehydratase NIT22	Low	5	1	16-35	GGRWLKLRRGQYKTVCNNFT	cyto(12.5),cyto_nucl(8.5),mito(6),pero(5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FXB0	Sterol uptake control protein 2	Low	9.4	1	1-38	MQSNLSRRSHPKTRTGCKTCKARKIKCDEQRPACKNCI	nucl(11),mito(4),plas(4),pero(3),cyto_mito(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FYM9	Ankyrin repeat protein nuc-2	Low	8.6	1	185-204	FSKILKKWDKTSKSKTKELY	nucl(13.5),cyto_nucl(13.5),cyto(10.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V1A7	Ph domain-containing protein	Low	8.8	1	35-60	TRLDGRPTGKVKKRRKALPPGISAKD	mito(9),plas(5),cyto(3.5),cyto_nucl(3.5),pero(3),nucl(2.5),E.R.(2),vacu(2)	RPTGKVKKRRKALPPG (40-55, prob:0.935)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VNI4	GATA zinc finger domain-containing protein 7	Low	9.4	1	162-181	ASPPGRNRNRRKVEYSCHKC	nucl(17),cyto_nucl(12),mito(5),cyto(5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VNX6	Glutamate carboxypeptidase	Low	5.8	1	124-145	LSLSRWRSWRWRLPSLRPTIRL	plas(8),cyto(7),mito(6),nucl(2),golg(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W0V3	Calnexin	Low	5	1	65-84	DWEARWKPSHAKKDSKDDEE	cyto(11.5),cyto_nucl(6.5),E.R.(5),mito(3),extr(3),golg(2),vacu(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FM55	Uncharacterized protein	Low	9.9	1	406-427	DATSVPRRRQRGLTRKRDDFGA	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FQA8	Uncharacterized protein	Low	8	1	100-130	RPSLNEKREKDDKKKNSKKKKPKADELGGGG	extr(19),cyto(3),vacu(3)	KREKDDKKKNSKKKKPKA (106-123, prob:0.99)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FQY1	Zn(2)-C6 fungal-type domain-containing protein	Low	9.7	1	14-43	EPGPSKARKACVNCRRQKMKCRIDNGSSCR	nucl(17.5),cyto_nucl(11),mito(5),cyto(3.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FX80	Uncharacterized protein	Low	8	1	1-31	MVSHRILKVKKNKKKKRKKKKISIFVVAYSS	plas(12),mito(10),cyto(3)	LKVKKNKKKKRKKKK (7-21, prob:0.999)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FXL8	Uncharacterized protein	Low	8	1	394-419	LPEVQHNSRRSRRGHKPGLNRRFDNY	mito(10.5),extr(10),cyto_mito(8),cyto(4.5)	RRG (405-407, prob:0.615)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G3C9	Tyrosinase	Low	9.2	1	536-559	GTSNSRKLKARHAHRNHRRSGCSK	plas(15),mito(6),nucl(3),E.R.(2)	RKLKARHAHRNHRR (541-554, prob:0.727)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G410	Superoxide dismutase	Low	6.1	1	25-46	SERSERSPSLRHRNTQKCRPLS	mito(14),cyto_mito(10.833),cyto_nucl(5.666),cyto(5.5),nucl(4.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G480	Uncharacterized protein	Low	5.7	1	37-57	DDDVKQSPSRRPHNNHTWGRI	cyto(15),cysk(5),pero(3),nucl(2),mito(2),mito_nucl(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UNY0	Endoglucanase-4	Low	8	1	309-339	TSGATKPSCEEKRRRRLARRMARQHARDVVR	extr(23),cyto(2)	KRRRRLARRMAR (320-331, prob:0.841)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V9D7	C6 zinc finger domain-containing protein	Low	5	1	49-86	LNPRQAKRTSTKKVKTGCITCKRRRVKCDETRPFCLKC	plas(9),mito(8),cyto(5),extr(4),mito_nucl(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VK23	3-phytase	Low	8.6	1	25-48	QQQQRPRRSGSSGRRKKPLPSEKP	plas(18),mito(3),pero(2),nucl(1.5),cyto_nucl(1.5)	PRRSGSSGRRKKPLPS (30-45, prob:0.879)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VM01	ABC multidrug transporter	Low	8	1	1463-1490	YYLFRVKKWDSGQKSKSKKEAKGKGASQ	plas(25)	QKSKSKKEAKGKG (1475-1487, prob:0.856)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FRS1	Mitochondrial carrier protein MTM1	Low	9.4	1	317-337	IRGSRTQSRRRSQSRENHTET	nucl(11),cyto(7),mito_nucl(7)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FUB7	Phospholipid-transporting ATPase	Low	8	1	21-60	RTRWATRKMTIKSSNNKRLSLMNRAHKKKNSEKSRSSGGG	plas(25)	AHKKKN (45-50, prob:0.68)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FZU6	SEH-associated protein 4	Low	9.4	1	896-918	EVESTKKSKRGGRPTIKPPSRQI	cyto(10),cyto_nucl(8.5),pero(6),nucl(5),mito(5)	KKSKRGGRPTI (901-911, prob:0.754)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G3Z6	Uncharacterized protein	Low	8.3	1	47-72	VVQWQAKQKHTRTRMRFKQRSNFSEA	nucl(11),mito(11),mito_nucl(11)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G9H9	Heterokaryon incompatibility protein 6, OR allele	Low	7.4	2	500-520, 901-925	VDRHHRQRKKLMRPLDRKPDE, FTALKKCRDESSRKRHPPHAADVLD	plas(16),extr(5),E.R.(3),nucl(1),cyto(1),cyto_nucl(1),vacu(1)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VAQ5	Alpha-actinin-like protein 1	Low	9.5	1	113-132	SITHTRKESIAKKNRFRSAT	nucl(16.5),cyto_nucl(11),mito(5),cyto(4.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VED5	S-adenosyl-methionine-sterol-c-methyltransferase	Low	9.4	1	45-72	PAPPQPPSSSSRKKKQQQQQHNHGQLNR	nucl(14),cyto(9),mito_nucl(9)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VI65	Extracellular metalloprotease	Low	5	1	294-317	RLDRCRRLLRQLARGERWKRHFRI	mito(21),cyto(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VIE6	Fungal specific transcription factor	Low	7.7	1	15-69	QLSCTTCRTRKVKCDHKKPVCSGCEKYGVDCVWPERRKNTTRKEKRLYENIVARL	plas(13),nucl(7),mito(4),cyto(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VLQ3	Homoserine O-acetyltransferase	Low	6.5	1	6-27	LQNGSQPKYERKQTQPENPFAA	mito(7),pero(7),cyto(6.5),cyto_nucl(6),nucl(4.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VNR7	Efflux pump aflT	Low	5	1	544-571	AGMEWKSVKKQQHHHHRHHDAKKNAAED	plas(27)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F6J5	Rhamnogalacturonan acetylesterase	Low	8.6	1	452-471	AERLSCPYRKRNPLRFNVRD	nucl(11.5),mito(9),cyto_nucl(8),cyto(3.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FBS2	Putative xanthine/uracil permease	Low	5	1	544-563	LPPWVRRLAKGKKDFWRPYG	plas(24),mito(1),pero(1),vacu(1)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FYY2	SWI/SNF and RSC complexes subunit ssr3	Low	9.3	1	60-80	ASELVKRRSRKPTDKALPDGV	nucl(15.5),cyto_nucl(10),mito(7),cyto(3.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G5J4	Uncharacterized protein	Low	9.7	1	30-51	DREGTKRRWLWVKKDNSWEKQY	nucl(14),mito(5.5),cyto_mito(5.5),cyto(4.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484GA85	Geranylgeranyl pyrophosphate synthase	Low	7.7	1	1-22	MVHSRPKRPSHLHSHLRHFHHP	mito(15),nucl(8.5),cyto_nucl(6),cyto(2.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V3S2	Glycosylphosphatidylinositol anchor biosynthesis protein 11	Low	8	1	92-111	QTSKTVRKPRPGEKKKAENT	plas(21),E.R.(3),cyto(1),extr(1),vacu(1)	RKPRPGEKKK (98-107, prob:0.778)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VAZ8	Serine threonine protein	Low	9.7	1	580-618	GNHTNPQKSPKDKIKECPWNKGRDWNYWRREKRNGFADI	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(2),plas(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VFE7	Uncharacterized protein	Low	9.8	1	125-151	EDEPVQKPKTSRRKKKSKKHVVVSSDE	cyto(11.5),cyto_nucl(10.833),cyto_mito(9.166),nucl(8),mito(5.5)	KPKTSRRKKKSKK (131-143, prob:0.965)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VGQ4	Uncharacterized protein	Low	9.9	1	857-878	MTAIRERRPLKRHVLPRLPPPS	nucl(18),cyto_nucl(13),cyto(6)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VH22	Uncharacterized protein	Low	8	1	78-103	GLAGVLLWRRRRRRRRERIEDILPMP	mito(8),cyto(6),extr(6),mito_nucl(6)	RRRRRRRRER (86-95, prob:0.931)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VZG8	Duf726 domain containing protein	Low	9.9	1	133-157	QKEARFGHKKRPKRSRDAEPDPETV	mito(21),nucl(5)	RFGHKKRPKRSR (137-148, prob:0.87)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FQZ9	Uncharacterized protein	Low	5	1	119-139	EPPSTTLSMRRKKRWDTQDGV	extr(12),plas(9),golg(3),E.R.(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FVS3	Uncharacterized protein	Low	9.9	1	577-597	HLPPANKKRLKRKLELLVFSK	mito(15.5),cyto_mito(10),nucl(7),cyto(3.5)	KRLKR (584-588, prob:0.634)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G0P7	Amidase	Low	6.2	1	56-77	PDYQPRPDTKKYPRENVRLPAA	cyto(10.5),cyto_nucl(8.833),cyto_mito(8.166),nucl(5),mito(4.5),pero(4)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V5A2	Oxidase ustYa	Low	8	1	41-63	GGDKKPKKSLWKRCKAMLKKYRW	plas(21),mito(3),E.R.(3)	KPKK (45-48, prob:0.636)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V8Z9	Uncharacterized protein	Low	8.3	1	33-56	DVATWKKKVRSHAARNPSARRQRV	nucl(9),plas(8),cyto(4),pero(3),cyto_mito(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VFN5	ADP-ribosylation factor family protein	Low	7.3	1	192-212	AIEWVRSRVKWNKESRPPVMR	cyto_nucl(10.833),nucl(10.5),cyto_mito(8.499),cyto(8),mito(7.5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VHT9	Mitochondrial metalloendopeptidase	Low	5.4	1	97-116	LFSHTRRHPLPPNNPRHRYE	plas(20),E.R.(3),nucl(1),mito(1),golg(1),vacu(1),mito_nucl(1)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W223	Nacht and ankyrin domain protein	Low	7	1	19-40	IVRARGIKRALRLRRVNRSWDH	cysk(9),cyto(6),nucl(5),cyto_mito(5)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W5D8	U3 small nucleolar RNA-associated protein 12	Low	8.5	1	307-334	SEAEVKKSLARKRRRRREKAGKEGKADA	cyto(13.5),mito(9),cyto_nucl(8),nucl(1.5)	KKSLARKRRRRREKAGKEGK (312-331, prob:0.996)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FA90	Uncharacterized protein	Low	7	2	30-53, 217-240	SGLPKWYKSTPRSKRDKLRLALWY, DDPAKSRSKLTPKNKFDKRAHGFR	plas(18),E.R.(3),mito(2),pero(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FYC0	3-phytase	Low	7	2	38-57, 548-567	IITYKPTKYYWPERRRLCTL, QVSPRLRKTQKTPENDNWTK	plas(23),E.R.(2)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FZJ2	Serine/threonine-protein phosphatase	Low	7.9	1	78-100	GSTISHFPRQRRRRDPTPGSPNG	nucl(9.5),cyto_nucl(9),cyto(7.5),extr(4),mito(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FZP9	DUF4203 domain-containing protein	Low	6.3	1	988-1010	QKEAEAKRREKERVDKERANQAF	plas(6),E.R.(6),nucl(4),mito(4),mito_nucl(4),cyto(3),vacu(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FZU5	Glycerophosphocholine phosphodiesterase GDE1	Low	7.2	1	123-144	FVKITKKLDKKVPKTASRDRYI	cyto(10.5),cyto_nucl(9.5),nucl(7.5),mito(6)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G288	Uncharacterized protein	Low	8	1	91-111	RTNSGKLTRSHRGRRRYSGFN	extr(14),plas(7),mito(2),cyto(2),cyto_mito(2)	SGKLTRSHRGRR (94-105, prob:0.672)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V244	Abhydrolase domain-containing protein mpaH	Low	9.7	1	402-422	TLTEKWFKRIGRPERPAKAKM	cyto(11.5),cyto_nucl(9),pero(7),nucl(5.5)	KRIGRPERPAKAK (409-421, prob:0.739)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V6G4	Uncharacterized protein	Low	8	1	73-100	VPKAWDGQKRNRPKASWRPKWLRPLVLA	plas(19),mito(3),E.R.(3)	RPK (84-86, prob:0.61)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V909	tRNA(Ile)-2-lysyl-cytidine synthase	Low	8.8	1	30-49	SAPPRFPHARHSHPRRVGLA	cyto(11.5),cyto_mito(10.5),mito(8.5),nucl(3),pero(3)	PRRRRLDSGKRREARLAHRR (409-428, prob:0.892)
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VSC3	Uncharacterized protein	Low	8	1	122-144	IAACCIYNKRKDRKRQHDLEMKK	nucl(10),cyto_nucl(9.5),cyto(7),mito(4),extr(3)	
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VZP8	Uncharacterized protein	Low	8.4	1	47-69	IHFATLKPEQKKKKETKGKGGKK	E.R.(7),cyto(6),plas(6),mito(5),nucl(1),extr(1),golg(1)	EQKKKKETKGKGGKK (55-69, prob:0.982)