ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7L8U1	NACHT domain-containing protein	Low	7.4	1	981-1009	YARVRNIVLHRKKDPRTRCYRIVNQEPYL	cyto_nucl(9),nucl(8),cyto(8),E.R.(4),plas(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LU76	Uncharacterized protein	Low	5	1	104-125	ADNFAFKTTKKPHYKSWKCGPP	extr(19),mito(2),cyto(2),vacu(2),cyto_mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LWU6	DNA-directed RNA polymerases I and III subunit RPAC1	Low	5	1	359-381	LESVKHLKLKCKKLEQQVINMAR	cyto(15.5),cyto_mito(11),mito(5.5),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZ19	Uncharacterized protein	Low	5	1	485-508	LLVCCLLRRRRKRQTYLSSKFRHK	plas(13),extr(8),E.R.(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2C0	RXT2_N domain-containing protein	Low	8.2	1	34-53	SYSNRGNKLKKQARFARQGQ	mito(9),nucl(8),cyto_mito(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3E6	Uncharacterized protein	Low	8	1	24-50	TSPRLSRAPSPIKRKHGPNKVEARKAG	mito(23.5),mito_nucl(13)	RLSRAPSPIKRKHGPNKVEARKAGEKKS (27-54, prob:0.955)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5Q0	Uncharacterized protein	Low	6.6	1	1-27	MNRPNRPRNRQPRPPRQQQNNQRGGSS	mito(18),nucl(4),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M796	Uncharacterized protein	Low	8.7	1	60-80	KMQTHCDHNKRQKQLQSPSSR	mito(14),nucl(10),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MII4	Uncharacterized protein	Low	7	1	377-400	STSTVSTSKKRRKQSTQVRLQQPL	plas(17),nucl(5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKR9	HET domain-containing protein	Low	7.3	1	84-104	VENALRRLRFRNKPRWLWVDQ	cyto(9.5),cyto_nucl(9),nucl(7.5),pero(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSQ9	Uncharacterized protein	Low	5	1	244-264	LFFLRRRQQAKRNSRIARMED	extr(22),cyto(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N160	Uncharacterized protein	Low	7.7	1	1-21	MSPPLKSPKRRSNTYGVTRSK	nucl(11),mito_nucl(10.833),mito(9.5),cyto_nucl(7.333),cyto(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NGH7	Uncharacterized protein	Low	8.7	1	266-285	RFTDIKYKRRVQKDPWPTID	nucl(10),cyto(5),mito(4),plas(4),cyto_pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LRL2	Uncharacterized protein	Low	5.4	1	85-110	DPAGGRCVRMKKKKTLLKKDDLNHGL	extr(19),mito(2),plas(2),nucl(1),E.R.(1),golg(1),vacu(1),cyto_mito(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDA9	Zn(2)-C6 fungal-type domain-containing protein	Low	9.3	1	8-52	GHITKFRVSQTPRIKRNRPAVSCSTCRARKQKCDRQQPCGPCLKR	nucl(12),mito(8),cyto_nucl(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MG45	Uncharacterized protein	Low	8.4	1	435-460	VFCIRCVIKIQRRKEKHCPLCRADVV	nucl(16),cyto_nucl(13.333),cyto(9.5),mito_nucl(8.833)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPB6	Uncharacterized protein	Low	9.5	1	96-115	ASQYCRYPTQQQDQRQQQPQ	nucl(15.5),cyto_nucl(10.5),cyto(4.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MS89	Uncharacterized protein	Low	5	1	83-107	PILPKQKITPPPSKKQEPKKSTLFI	plas(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTP1	FAD-binding PCMH-type domain-containing protein	Low	5	1	499-526	QSSYGKKNERFLKRVQKRYDPNGLWRKN	extr(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVC6	Uncharacterized protein	Low	8.5	1	166-191	NIDKALRKYKRLAKKYKKPAVSTDRL	cyto(10.5),cyto_nucl(6.5),extr(5),mito(3),E.R.(3),golg(2),nucl(1.5)	RKYKRLAKKYKK (172-183, prob:0.787)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N1Y2	Serine/threonine protein kinase	Low	8.7	1	13-37	IRSQFTIKFKKAKTKDKFATRGMVR	nucl(13.5),cyto_nucl(9.5),mito(5),cyto(4.5),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LLV3	GPI-anchored wall transfer protein	Low	8	1	148-167	QSADRKKKLKVPPNARSKEN	plas(18),E.R.(6),vacu(2)	KKKLK (153-157, prob:0.64)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZ92	Uncharacterized protein	Low	9.7	1	14-34	TRYHGPKKKGETQEARRHQSV	nucl(16),mito(9),cyto_nucl(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1P4	GMC_OxRdtase_N domain-containing protein	Low	8	1	768-797	PTPVPTPGSKCKRGLRRRAARVPMDFRRRS	extr(13),mito(10),cyto(2)	LRRR (782-785, prob:0.642)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKQ2	DUF2415 domain-containing protein	Low	9.1	1	15-35	VSKHARKHYRIPVRSQHWQLR	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(3),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRZ1	Aa_trans domain-containing protein	Low	5	1	439-460	YFRMRNADRKFGRKRNPVLDAL	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWS5	Uncharacterized protein	Low	9.2	1	186-209	LWRLETAKRPETRRKRIEQFVELL	nucl(13),mito(9),cyto_nucl(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5N4	Zn(2)-C6 fungal-type domain-containing protein	Low	7.1	1	3-37	LPNPRHHVKTGCRTCKARKIKCDEAKPSCKRCFSS	plas(12),nucl(6),mito(4),golg(2),cyto(1),pero(1),E.R.(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LK56	PhoD domain-containing protein	Low	5	1	57-78	ELVLLKCRKLRVRRRLVSAPLL	plas(15),extr(7),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LNE6	Uncharacterized protein	Low	8.1	1	278-298	VELWLRKRWRWQRDGIPCIKF	nucl(10),mito(8),cyto_pero(5),cyto(4.5),pero(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LPR1	BZIP domain-containing protein	Low	8.7	1	276-301	LERNRVAALKCRQRKKQWLANLQTKV	extr(19),nucl(2),mito(2),plas(2),mito_nucl(2)	TRGRGKKNPPATNGRRKADEPPSKAPANKKSK (206-237, prob:0.956)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LW44	Uncharacterized protein	Low	6.6	1	264-287	QNKEDQSTRPWRRSKTKEPQELGG	extr(8),mito(5),nucl(4),cyto(4),cyto_nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYQ8	Uncharacterized protein	Low	9.9	1	124-146	VSADTRDKERPQRKQSTLRGALG	nucl(16.5),cyto_nucl(10.5),mito(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M0V0	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	1	2-34	SAYVRKRQKVSSACERCRKRKLGCDAERPCVHC	plas(10),nucl(9),mito(4),cyto(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2G2	RNase H domain-containing protein	Low	8	1	48-74	TEALVRTKGTKKGKKKEPKINSFCHQL	cyto(11),cysk(10),mito(3),pero(2),mito_nucl(2)	KGTKKGKKKEPK (55-66, prob:0.893)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCF5	Ysc84 domain-containing protein	Low	9.4	1	405-426	TSEPRSPKRVTKKIPKRIIQNA	extr(12),cyto_nucl(5),nucl(4.5),cyto(4.5),vacu(2),mito(1),pero(1),E.R.(1),golg(1)	KK (416-417, prob:0.614)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MG90	ELMO domain-containing protein	Low	9.4	1	288-309	HEVPGKKGSRRHNPEKWRRLGF	cyto(12),cyto_nucl(9.5),nucl(5),mito(4),pero(2),E.R.(2)	KKGSRRHNPEK (293-303, prob:0.703)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MN83	Uncharacterized protein	Low	7.4	1	19-46	QMSQKRLADRVKHRENRQEHKQRMERME	mito(17),nucl(6),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUB1	Uncharacterized protein	Low	5	1	16-39	SFLLVKHTLRPKKPPLPPGPKGLP	plas(7),mito(5),extr(4),E.R.(4),cyto_mito(4),mito_nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MV14	Cytochrome P450, family 17, subfamily A (Steroid 17alpha-monooxygenase)	Low	5	1	495-515	MTEPKPFKFKLKPRGPWVLKV	plas(23),cyto(1),pero(1),E.R.(1),vacu(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N555	Uncharacterized protein	Low	6.8	1	249-274	LVGMCLRDKKREKKWQSIQRVRTLKQ	plas(9),nucl(5),extr(4),pero(3),mito_nucl(3),cyto(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NDQ8	MFS domain-containing protein	Low	5	1	1-20	MAPKPSSRPRSPRNSESDEA	plas(22),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NFZ8	Zn(2)-C6 fungal-type domain-containing protein	Low	8.1	1	9-50	APYPRRKRSIISCRECQRRKQKCDRRQPCSHCTKRGKADACL	mito(9),nucl(8),plas(7),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LGA1	Uncharacterized protein	Low	5	1	26-47	SALRARRSSRTSQSRHLKRDVV	extr(22),mito(1),plas(1),pero(1),E.R.(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LIP4	Cytoplasmic tRNA 2-thiolation protein 1	Low	8.5	2	4-33, 334-358	TPCFRCQSNRAVVKRPKNHHKLCRDCFIRV, DAVPLPVRTKKQKETPAPKQNLGKC	mito(20),nucl(4),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LQ78	Zn(2)-C6 fungal-type domain-containing protein	Low	9.3	1	120-145	GRNCVVTMPTRKRQKKTDSRVAELEK	nucl(12),plas(11),cyto(1),pero(1),E.R.(1),golg(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTH2	Carrier domain-containing protein	Low	5	1	533-553	DESLFKRTSKNKKPNICFVFC	cysk(22),cyto(3.5),cyto_nucl(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6K7	Uncharacterized protein	Low	5	1	234-256	AAMSCCCRPNRDKPQSPQPEMRA	plas(20),E.R.(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAP2	Uncharacterized protein	Low	9.2	1	79-101	LKREVWRKPKSQAKDRNPKSNFC	nucl(11),extr(8),mito(4),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJF9	Sterol regulatory element-binding protein cleavage-activating protein	Low	8	1	1010-1033	ETNGRRKADGLRHRSPRKEPGRDL	plas(20),E.R.(4),vacu(2)	RKADGLRHRSPRKE (1015-1028, prob:0.717)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MN71	Dicer-like protein 1	Low	9.1	1	19-39	IVNPSKPRKLTEKKLRDQAAL	nucl(15.5),cyto_nucl(12),cyto(5.5),mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQW3	Uncharacterized protein	Low	5.7	1	166-188	EVCKSKLEERKARKDTRKMVDKI	plas(16),cyto(4),nucl(2),mito(1),pero(1),E.R.(1),golg(1),cysk(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUP7	STAS domain-containing protein	Low	5	1	147-168	HEDWKRWLKKRMRTKTMGHSSM	plas(24),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NFV1	ANK_REP_REGION domain-containing protein	Low	7.3	1	44-65	IEQTTKKQKDFEKSNHKFRKYF	nucl(9.5),cyto_nucl(9.333),cyto(8),cyto_mito(6.833),mito(4.5),plas(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LII4	Clr5 domain-containing protein	Low	9.8	1	50-76	TWGVGKYTCKKREERRRRSVNKSLSLS	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LK77	Uncharacterized protein	Low	5	1	24-46	SYSYNNRRGWRRWRIFHPGRGMY	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LR64	NADH dehydrogenase (Ubiquinone) Fe-S protein 7	Low	8	1	200-221	GILQLKRKIKSQRPSRMWYRKK	mito(24.5),cyto_mito(13.5)	KRKIKSQRPSRMWYRKK (205-221, prob:0.753)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LUT8	Uncharacterized protein	Low	7.8	1	59-78	EAPEAHPSKRQKRSHSDDIA	mito(14),nucl(9.5),cyto_nucl(7),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M9T3	zf-Mss51 domain-containing protein	Low	5	1	39-58	HHIRRHSTTKDQRRATPTPK	mito(22),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ME28	HET domain-containing protein	Low	5.6	1	159-178	YDKFRSLYRKAPRPNRHEAD	cysk(13),cyto(6.5),cyto_pero(5.5),pero(3.5),nucl(2),mito(2),mito_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHD5	Fungal_trans domain-containing protein	Low	9.6	1	1-27	MQCDGRRPCTYCRKRRVECEYRSRTDS	nucl(12),plas(12),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N2U5	Uncharacterized protein	Low	9.6	1	479-502	EILRTLSIKVKKKRQSPQDDESSS	nucl(13),cyto(7),mito(4),cyto_pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N7A5	Uncharacterized protein	Low	8	1	81-101	HTPPKPHKPDHPGKPNHPDKP	extr(13),mito(8),cyto(5)	GKAKPHKPEPWHPKPQPHYPLKPHHTPPKPHKPDHPGKPNHPDKPDYPQPGKPDGPGKPTGPGKP (57-121, prob:0.949)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NHK1	Carboxylic ester hydrolase	Low	5	1	538-559	TQMLCQWPKRPLWKNDKSFECV	extr(24),mito(1),cyto(1),pero(1),cyto_mito(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LQR0	Zn(2)-C6 fungal-type domain-containing protein	Low	6.4	1	17-49	ASRQKSCNACVRGKRKCDKKTPRCTRCAAKGLD	mito(12),nucl(5),cyto(5),cyto_nucl(5),pero(5),cyto_pero(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZG0	Ras-GAP domain-containing protein	Low	9.2	1	208-233	ESLVPTKDKKSRRLMKRQSSRPTSPL	nucl(15.5),cyto_nucl(10.5),cyto(4.5),mito(2),plas(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M0H9	CBM1 domain-containing protein	Low	5	1	37-56	PLKSRSWTSIPRNRPTKRQS	extr(23),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M243	Uncharacterized protein	Low	6.1	1	199-218	PPMPRPDRRTPGPQMRRPNF	mito(20.5),cyto_mito(11.5),nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3D1	Uncharacterized protein	Low	5	1	59-79	QYLAHRQQKKEQNKEARIRGI	plas(13),E.R.(7),mito(3),extr(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M4J0	Uncharacterized protein	Low	5.9	1	529-549	TYGKWYRRHFTSKKYLKSQTT	mito(8),plas(8),cyto(3.5),cyto_nucl(3.5),nucl(2.5),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7U7	Uncharacterized protein	Low	8.4	1	274-298	GLGAFYLVRRRKKNKHQKDMTTSGQ	extr(19),mito(4),nucl(1),plas(1),E.R.(1),golg(1)	RRKKN (283-287, prob:0.658)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFL2	Protein phosphatase	Low	5	1	78-97	SPYNRIQPTRNRRPSARPES	mito(21),cyto(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ML23	Uncharacterized protein	Low	5	1	321-343	LGSALRRHSRPRHNDQPVWRRDV	plas(24),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSJ0	Uncharacterized protein	Low	9.4	1	43-68	FQPGTSRPSRPPKQVQDQQPPHQREK	nucl(17.5),cyto_nucl(15),cyto(7.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MU98	TLC domain-containing protein	Low	5	1	1-21	MAAKLRSKRCQEQTSVKQRLI	plas(18),mito(3),E.R.(3),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWA9	FAD-binding PCMH-type domain-containing protein	Low	5	1	407-432	YESWRLARLRKLKAKYDPNNRFRFYV	cyto(11),cyto_pero(9.499),cyto_nucl(8.833),pero(6.5),cysk(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M257	Uncharacterized protein	Low	5	1	239-263	GETFRRNSKVMKKKTLQRANQNLLA	mito(17.5),cyto_mito(10),pero(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3W9	Plasma membrane ATPase	Low	5	1	964-990	KLSWLDNLGRKDRKKKDTKLENILGHL	plas(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDX1	EngB-type G domain-containing protein	Low	8.4	1	95-115	ESTSKPRKAKPRGPLPKGIKP	mito(24),nucl(1),cyto(1),plas(1),cyto_nucl(1)	KPRKAKPRGPLPKG (99-112, prob:0.885)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTQ6	Uncharacterized protein	Low	8	1	645-671	EENYQKACKRAEKKGRKLPPKDQYYDH	cyto(10),cyto_pero(9.333),pero(7.5),cyto_nucl(6.833),mito(6)	RAEKKGRKL (654-662, prob:0.735)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LI03	Uncharacterized protein	Low	8	1	15-57	RSPEEQFRVVRKRNRVPLSCYPCRTRKKCDRSHPCSNCTKREG	plas(11),nucl(8),mito(2),cyto(2),golg(2),cyto_mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LJ35	Glycerol kinase	Low	9.9	1	570-596	FYPETDKKTVRRSRKRWERAVEMSRGW	cyto(17.5),cyto_nucl(14),nucl(7.5)	KKTVRRSRKR (576-585, prob:0.732)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LNF0	Proteasome endopeptidase complex	Low	5	1	208-228	TKDKTTLKRNYIKPNEKDPKL	cyto(21.5),cyto_nucl(11.5),mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5X4	Uncharacterized protein	Low	7.8	1	1806-1832	DSSTSQSQKRLPRKLVKNRRNSESNSE	cyto(12.5),nucl(9),cyto_mito(8),mito(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M795	Uncharacterized protein	Low	9.3	1	435-457	EEWCILGHKKRGQRRQPFSEDGD	nucl(12),cysk(10),cyto(2),pero(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M851	Nucleosome assembly protein 1-like 1	Low	8.8	1	265-292	KDLTVRVESKKQRNKNTKQTRIVKKTVP	nucl(15.5),cyto_nucl(14),cyto(11.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MXL6	Uncharacterized protein	Low	7.6	1	280-301	TQRVFKWPQNRWPREQKYKELG	cyto(11.5),cyto_nucl(11),nucl(9.5),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N4G9	Uncharacterized protein	Low	5	1	453-478	DLTKTYKPSLWRRCCRRARPTIAVNS	plas(19),E.R.(4),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N9W6	Uncharacterized protein	Low	6.6	1	57-82	DLIEYQKKNGQQRKWFRLQNQKLNSA	cyto(11),E.R.(5),nucl(4),extr(3),plas(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LDX2	FAD-binding PCMH-type domain-containing protein	Low	5	1	444-465	FGSNSKRLRGLKKQYDPDNVFD	extr(14),mito(6),cyto(4),plas(1),E.R.(1),golg(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M4C3	Uncharacterized protein	Low	8	1	285-308	YWVMHLCLMRRERKRQWKPRKGSY	extr(12),plas(7),E.R.(6)	RERKRQWKPRKG (295-306, prob:0.824)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M546	Uncharacterized protein	Low	5	1	324-343	DTRQALEKWHHFKRRNTMGI	cyto(15.5),cyto_nucl(9),mito(6),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MA39	ARID domain-containing protein	Low	5	1	1655-1676	EETTYIKRIPKKKTPLSPGSID	plas(6),E.R.(6),cyto(5),mito(3),cyto_nucl(3),golg(3),cyto_pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAF6	2-isopropylmalate synthase	Low	7.5	1	1-28	MTMLKEPWKKYKPFNPPKLPNRTWPDKT	cyto_nucl(9.5),nucl(9),cyto(8),mito(5),pero(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBR1	TPR_REGION domain-containing protein	Low	8.9	1	168-188	LKDPNSKWSKFKSNVKKALLD	nucl(13.5),cyto_nucl(10),cyto(5.5),mito(2),plas(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKX7	Uncharacterized protein	Low	9.3	1	189-218	LQMAQKQCDRNQKRKERKIELHRQKQRVLM	nucl(12),mito(8),cyto_nucl(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMN1	Uncharacterized protein	Low	5	1	1-26	MEAKQYSRPSQKQKPQRPTNLVLALR	plas(20),mito(3),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQ26	3-phytase	Low	6.8	1	495-514	VDKFTPKNWKQQCRANHMGD	mito(11),cyto(7.5),cyto_nucl(7),nucl(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LMI4	WD_REPEATS_REGION domain-containing protein	Low	7.7	1	811-831	PTSGRRSPPRTLQRRTSRFNL	mito(10),nucl(7),cyto(3),plas(2),extr(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M0W8	DAO domain-containing protein	Low	5	1	385-405	CFENKASKELRHKWRLRAPTG	extr(23),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2J9	Uncharacterized protein	Low	5	1	255-278	FYVQDKRPQTRVRYQKKTDKVDGW	mito(18),plas(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MK74	Uncharacterized protein	Low	7.8	1	1-29	MADYDRRPGGYRKRRYRDDDDHYDRRNQR	nucl(9.5),cyto_nucl(9.5),cyto(8.5),mito(5),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPI7	Zn(2)-C6 fungal-type domain-containing protein	Low	9.2	1	14-43	SNLKIWSCVTCRRRKIRCDRKDPCNNCTKS	nucl(11),cyto(7),mito(4),cyto_pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTD6	alpha-1,2-Mannosidase	Low	5	1	32-54	SEQKLRGLRYPKQRGKHYDYTGF	plas(12),extr(11),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NAF4	Uncharacterized protein	Low	6.8	1	86-106	YHTAIGPRREQQKRRAQKMNV	plas(13),nucl(5.5),cyto_nucl(5),pero(4),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NGZ2	Zn(2)-C6 fungal-type domain-containing protein	Low	9.2	1	1-28	MRSEQACKARKKQKRRCDKALPECSLCK	nucl(15.5),cyto_nucl(10.5),mito(6),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LEQ0	Uncharacterized protein	Low	7.7	1	43-64	MSSTNTRKSRKEKSRWFTQVKD	mito(15),nucl(8.5),cyto_nucl(6),cyto(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LSV2	Mitochondrial import inner membrane translocase subunit TIM50	Low	5	1	42-69	LRTYAKKSSSQQNKDSKQKPPQAQNDAE	mito(25.5),cyto_mito(13.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M171	Zn(2)-C6 fungal-type domain-containing protein	Low	6	1	1-24	MTYKKTRTGCLQCKTRKVKCDEAI	mito(20),nucl(3),cyto(3),cyto_nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ME84	Uncharacterized protein	Low	5	1	566-587	GDASTRYPCRRQRQTTLFVYKQ	plas(21),mito(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MF01	Uncharacterized protein	Low	5	1	547-568	TLDSRFAKKRRQQEQADWEMDR	plas(19),E.R.(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MF64	Uncharacterized protein	Low	6.9	1	453-477	VDDCIKERWQAKKPSHRAIRRDTGD	mito(8),nucl(5),plas(4),cyto_nucl(4),cyto(3),golg(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MLK9	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	7-47	QEEAGSRPTKRKRVALACDTCRERKIKCDGSKPVCNPCRKR	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNQ7	DUF2263 domain-containing protein	Low	5	1	32-51	SLNQHPYPRRSRQDDPYRRG	mito(21),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPF3	Cell division control protein 48	Low	6.8	1	15-36	DVATAILKKKKKPNQLMVTDAV	cyto(14.5),cyto_nucl(11),nucl(6.5),cysk(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQU4	ATPase	Low	8	1	1486-1505	AFYWLVRVPKNKKGEKEKKE	plas(25)	PKNKKGEKEKKE (1494-1505, prob:0.822)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MV36	DUF1691 domain-containing protein	Low	8	1	292-319	WGTSTAPAEKRARKQRRRRWLALHGASV	plas(21),mito(3),E.R.(2)	KRARKQRRRR (301-310, prob:0.888)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NEU9	Uncharacterized protein	Low	7.8	1	26-54	CPKAPANGSKCKKNHHKKGKYPGDPVVNC	cyto(13),nucl(8),cyto_pero(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YBU0	Subtilisin	Low	5	1	111-132	EPNRVWKLNRIKSKRSLEKRDE	extr(24),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LM03	Zn(2)-C6 fungal-type domain-containing protein	Low	7.7	1	77-102	IAPACDRCRSFKKKCSRTFPVCSLCA	mito(14),nucl(7),cyto(3),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LWC5	Uncharacterized protein	Low	9.4	1	48-74	IINGRRVEDNQKRRKKVLPKRLYDPGN	mito(19.5),cyto_mito(11.5),nucl(5)	KRRKKV (59-64, prob:0.705)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZ07	BTB domain-containing protein	Low	9.5	1	171-195	SSGSSGTSWRRRRRARQTRHAEAEE	cysk(20),nucl(4),cyto(3)	RRRRA (181-185, prob:0.67)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEM1	H+/K+-exchanging ATPase	Low	8	1	22-52	DEAGRVSRHGERRSRRRSRSRSRDSLSIHRA	plas(27)	RHGERRSRRRSRSRSR (29-44, prob:0.935)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJY0	Succinate-semialdehyde dehydrogenase (NADP+)	Low	6.3	1	358-402	LQGSQDRHWRQHPRQPRIFPSAHRPHWRHTRNGRRQGRDIRSPCP	mito(10),cyto(6),cyto_nucl(6),pero(5),nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNU7	Tr-type G domain-containing protein	Low	9.4	1	487-506	SASFALKKVKRKDVRKGMVL	cyto(14),cyto_nucl(10.5),nucl(5),mito(5)	KKVKRK (493-498, prob:0.675)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQZ0	WD_REPEATS_REGION domain-containing protein	Low	6.8	1	437-461	VYGANDKFRQNRKKSYRGHNNAGLG	cyto(14.5),cyto_nucl(11),nucl(6.5),pero(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0I4	Uncharacterized protein	Low	7	1	206-226	RTGSKIKRALKQKFKAQVLRI	nucl(7.5),cyto_nucl(7.333),pero(7),cyto(6),cyto_mito(5.833),mito(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N7N5	Uncharacterized protein	Low	8	1	62-108	TTNVKVKRSSKVTPKKKKTSNKAPAKKTKSSKKPKTTHSKRLLKSSS	extr(22),vacu(2),mito(1),E.R.(1),golg(1)	VKRSSKVTPKKKKTSNKAPAKKTKSSKKPKTTHSKR (67-102, prob:0.996)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YC10	Uncharacterized protein	Low	6.2	1	11-34	MSIKIECQRKRPWQRHDVTRKGLP	mito(21),nucl(3),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LFT6	HET domain-containing protein	Low	5.8	1	660-680	KLYAASCRKNKENKKIVHEVP	cyto(12.5),cyto_nucl(8),plas(4),mito(3),pero(3),nucl(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LLI5	Uncharacterized protein	Low	8	1	79-99	EAKRRLRKAKWILFRYRLRRA	mito(14),plas(7),mito_nucl(7)	KRRLRKAK (81-88, prob:0.675)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LQA8	Acyl-CoA dehydrogenase	Low	5.7	1	108-130	PFRSPYYKDSHRRLQRKLREFVD	cysk(15),cyto(5),pero(3),nucl(2),mito(2),mito_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1V7	Zn(2)-C6 fungal-type domain-containing protein	Low	8.5	1	6-33	QRPKLRAKTGCLPCRQHRIKCDERTPIC	nucl(9),mito(7),plas(5),cyto_mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBS9	Zn(2)-C6 fungal-type domain-containing protein	Low	9.2	1	29-51	VLACNHCQHRKVKCNRVFPCNNC	nucl(15.5),cyto_nucl(11.5),cyto(6.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDL3	Molecular chaperone DnaJ	Low	5	1	40-62	GSQNRSSLRKRTRAPSAKRLFHA	mito(18.5),mito_nucl(10.5),cyto(3),extr(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MER6	AGC/PKA protein kinase	Low	8.7	1	209-234	AIKVILDKRPRLKKRYEKPDLSSDRL	nucl(12.5),cyto_nucl(9.5),pero(6),cyto(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJQ0	RF_PROK_I domain-containing protein	Low	9.2	1	118-146	KVKQKKAASASKKSRRKYKKLEEEKKIAT	mito(22),nucl(3.5),cyto_nucl(3)	KVKQKKAASASKKSRRKYKKLEE (118-140, prob:0.982)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTU3	Uncharacterized protein	Low	5.8	1	419-441	QEETEWKKKQEADKKKPNWFAWK	cyto(11.5),cyto_nucl(7.5),mito(7),nucl(2.5),pero(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVU7	ZT_dimer domain-containing protein	Low	5	1	48-68	GANTSRKRHLGLKKNHPLQEF	plas(22),golg(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MYE5	Uncharacterized protein	Low	8.9	1	159-179	LVPGVRKRRIPDQKQTPNAES	nucl(13.5),cyto_nucl(10),mito(6),cyto(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N1U5	Uncharacterized protein	Low	6.4	1	121-142	FQPYNEQLRRHRRKAHLCLKSE	cyto(11),nucl(4),plas(3),extr(3),mito_nucl(3),mito(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N4S5	SRR1 domain-containing protein	Low	8.6	1	5-31	QDSSDWTRVVRKGRKNRRNNTVSHSSR	nucl(13.5),cyto_nucl(11.5),cyto(8.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LY27	P-type phospholipid transporter	Low	8	1	21-43	VSTVRSRLKKYHGRKRRGLTLAI	plas(17),mito(4),E.R.(2),vacu(2),mito_nucl(2)	LKKYHGRKRR (28-37, prob:0.722)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYN5	Lysine-specific histone demethylase 1	Low	8.6	1	1064-1085	TEVPHESSSKHRRTRHISYAED	nucl(12.5),cyto_nucl(10.5),cyto(7.5),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEG5	Uncharacterized protein	Low	6.4	1	1-22	MTNRPLRKRTHHRPSLHFNIIT	mito(16.5),mito_nucl(12.166),cyto_mito(10.833),nucl(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPJ5	tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA	Low	5	1	661-681	LEKDASRGRRTQRTNKNRGSV	mito(24),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MS75	Uncharacterized protein	Low	5	1	55-85	HDSGKVYTKKHHKCKCPKGEKWHHIEKKCKK	cyto(18),extr(5),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSV3	Zn(2)-C6 fungal-type domain-containing protein	Low	7.8	1	42-64	IIRLRWSQKHQARPDNRIQKRTT	nucl(9),cyto_mito(7),mito(6.5),cyto(6.5),plas(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LMB5	Peptidase A1 domain-containing protein	Low	5	1	34-55	HVGTVERNKNKQHDKRQDGDAI	extr(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M538	50S ribosomal protein L18e	Low	9.5	1	153-184	FGPHSHKKPYVESKGRKFERARGRRRSRGFKV	cyto(12),mito(11),nucl(4)	PHSHKKPYVESKGRKFERARGRRRSRGFKV (155-184, prob:0.987)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M709	Guanosine-diphosphatase	Low	5	1	14-40	VFDPHEKPDRYKFKPKRQGIIGRMKES	plas(12),mito(4),cyto(3),pero(3),mito_nucl(3),cyto_pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7V3	DNA polymerase iota subunit	Low	9.8	1	1-22	MEPPRKKRPKRNDARIILQFDY	cyto(12),cyto_nucl(10.833),cyto_mito(9.333),nucl(8.5),mito(5.5)	PRKKRPKR (4-11, prob:0.824)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJM4	F-box domain-containing protein	Low	6.6	1	1-21	MRNPFRRRNKKDKAGSGGQSS	mito(19),nucl(4),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSL6	Cyclin H	Low	8.1	1	276-298	EIVKAMKPLRKKLQKCRDPDRAN	cyto_nucl(12.5),nucl(12),cyto(11),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LKI5	Uncharacterized protein	Low	9.5	1	597-622	GPPPCGPSRRFYKPPKPERLRGQSVT	nucl(14.5),mito(9),cyto_nucl(8.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LNJ7	Uncharacterized protein	Low	8	1	1705-1724	NKSSALAFLKKHKRRHAKGF	extr(27)	KKHKRRHAKG (1714-1723, prob:0.838)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2Z5	Uncharacterized protein	Low	7.5	1	22-45	LENQIRTKSRKVRQPVQKAHNELS	nucl(7.5),cyto_nucl(6.5),mito(5),cyto(4.5),extr(4),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M876	Uncharacterized protein	Low	9.9	1	522-543	GGVPLGTKTRSRKNRRDYPSSW	nucl(21),cyto_nucl(13.833),cyto(4.5),cyto_mito(3.666)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MB64	Uncharacterized protein	Low	5	1	30-51	VVTTTAKRWMRHRRQHLQAAEA	mito(6),cyto(5),E.R.(5),golg(4),mito_nucl(4),plas(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJ81	Uncharacterized protein	Low	9.8	1	574-597	RHGGAKKRWHHKKLQRRDRPTLSF	mito(14),cyto_nucl(6),nucl(5.5),cyto(5.5)	RRHPGSPRFRHGGAKKRWHHKKLQRRD (565-591, prob:0.984)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZW4	Translation factor GUF1, mitochondrial	Low	8	1	610-636	AADVSRRRKLLEKQKEGRKRLRAVGNV	mito(19),cyto(6.5),cyto_nucl(4)	SRRRKLLEKQKEGRKRLR (614-631, prob:0.885)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0B0	Zn(2)-C6 fungal-type domain-containing protein	Low	9.1	1	414-434	NITFIRREKCQPKDRHRCLGF	nucl(14.5),cyto_nucl(9.5),mito(8),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0Z5	Uncharacterized protein	Low	9	1	153-173	VLLGLLKKIRRKRPELRIIIS	cysk(20),nucl(3),cyto(3),cyto_nucl(3)	KIRRKR (160-165, prob:0.681)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N194	Uncharacterized protein	Low	8	1	5-24	LNYIPFFKKEKQRPLPDIVE	nucl(10.5),cyto_nucl(9),cyto(6.5),pero(6),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5Z1	Uncharacterized protein	Low	9.2	1	365-385	ITDPRKDKKRIQSQKGDPLKD	nucl(14.5),cyto_nucl(9.5),mito(5),cyto(3.5),plas(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YBC7	Uncharacterized protein	Low	7.7	1	237-263	DWKNYKCPSCGQRCKRNKGCKVTGEDW	mito_nucl(12.333),nucl(12),mito(11.5),cyto_nucl(7.833)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LX78	Uncharacterized protein	Low	7.3	1	1-21	MLSQPRPRKIKRRYVDTLQIW	mito(16.5),cyto_mito(10),nucl(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M988	Uncharacterized protein	Low	5	1	125-144	GVQYRKYNKTSKQTRLKFVT	cyto(12.5),cyto_nucl(8.5),mito(7),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBX9	Uncharacterized protein	Low	9.6	1	171-195	VSPLRVFPRKVKPKDKPKALKDPCT	mito(14),nucl(4),extr(4),cyto(3)	RKVKPKDKPK (179-188, prob:0.764)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MK57	NACHT domain-containing protein	Low	9.2	1	1721-1740	ACSRRTCKPDCTHLEQRLPR	nucl(15.5),cyto_nucl(12.5),cyto(8.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSH9	Uncharacterized protein	Low	7.3	1	154-173	TLPTRYRRWKIQKHIQPLYE	cyto_nucl(9.333),nucl(9),pero(8),cyto(7.5),cyto_mito(5.166)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MT16	Uncharacterized protein	Low	5.5	1	367-390	VYIANFRREIRDRKNHPYIRLRTV	mito(17),cyto(5.5),cyto_nucl(4),nucl(1.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUW4	Uncharacterized protein	Low	8	1	40-88	APPAIKSRRDLPQKVKKSYKKRANVTPVRKPQPGERKAFRKRIQLSNNS	mito(21.5),cyto_mito(13),cyto(3.5)	KSRRDLPQKVKKSYKKRANVTPVRKPQPGERKAFRKR (45-81, prob:0.958)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0A6	Uncharacterized protein	Low	8	1	316-343	SSRSHRSPSSRSRRSPAGRYEPRREPSD	plas(24),E.R.(2)	RSRRGHSSRSHRSPSSRSRRSPAGRYE (310-336, prob:0.864)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7L8N4	Uncharacterized protein	Low	9	1	906-930	VLEREVQRQHRSRNRGRPQYFECPH	nucl(14.5),cyto_nucl(11.5),cyto(7.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LE07	Serine/threonine-protein phosphatase 2A activator	Low	9.7	1	19-45	IPNLKDRLPKLEPRKRRSATSNPTPIP	nucl(17.5),cyto_nucl(12),cyto(5.5),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LM32	T5orf172 domain-containing protein	Low	8.6	1	382-404	RGINVRVKKCRKCGKGHKDWFEG	nucl(18.5),cyto_nucl(14.333),mito_nucl(10.166),cyto(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LRF3	MFS domain-containing protein	Low	5	1	655-678	TIEEKWDAIKRRKRGSMRSDPSVP	plas(23),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M379	Uncharacterized protein	Low	6.1	1	40-59	CYYKYFSSKNSRVNERQRFH	cyto(13),cyto_nucl(10.333),cyto_pero(8.999),mito(5),nucl(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MD14	Uncharacterized protein	Low	9.7	2	3-25, 92-112	YIPSIRRWSRRGKPVTYRKKSAT, PTSWQRFRKHHQDEHKKPSWL	mito(12.5),mito_nucl(12),nucl(10.5),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ME13	acidPPc domain-containing protein	Low	5	1	44-64	SLDHYKRALPKWRYNLRQQML	plas(22),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFJ8	Kinetochore protein SPC25	Low	8.5	1	212-233	DYDVKHCRPKIEREKVERVLDK	nucl(12),cyto_nucl(10.5),cyto(7),mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MGF2	Zn(2)-C6 fungal-type domain-containing protein	Low	7.9	1	40-61	YNTSCRTSIIRRKPNSARVRAG	nucl(10.5),cyto_nucl(10),cyto(8.5),mito(4),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKV0	MFS domain-containing protein	Low	5	1	14-38	DDETLRQKTPESKPRHRPLVKLLFD	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MR52	Fe2OG dioxygenase domain-containing protein	Low	7	1	291-311	LSNNRFKSTVHRVYNRQKTSR	cyto(10),cyto_nucl(9.5),nucl(7),pero(5),cysk(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVM5	Uncharacterized protein	Low	9.3	1	26-45	EDYMRRYRARNPNSNWEPKT	nucl(16.5),cyto_nucl(13),cyto(6.5),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LAI3	Diphthamide biosynthesis protein 1	Low	6.7	1	32-56	NEPKTATPLKQPKKRFIGRRAAVEA	cyto(12),cysk(6),cyto_mito(6),nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LRW6	Zn(2)-C6 fungal-type domain-containing protein	Low	9.9	1	6-38	KTPHSKSRNGCIRCKARKVKCDERKPACMRCED	nucl(17),mito(9),cyto_nucl(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LSD2	Uncharacterized protein	Low	8	1	118-141	LEGPRAKHPGKKAQRQHPQRPLGG	mito(9.5),extr(8),cyto_mito(7.833),cyto(5),cyto_nucl(3.333),vacu(2)	GPRAKHPGKKAQR (120-132, prob:0.816)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVD5	Beta-glucuronidase	Low	6.9	1	575-594	FTRDRRPKSAVQALRKRWTE	cyto(8),nucl(5),extr(5),mito(4),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYV9	Uncharacterized protein	Low	5	1	270-292	GSRSHSTQKKSSKQTGKSRVPSA	plas(10),mito(9),E.R.(4),golg(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1Z7	Zn(2)-C6 fungal-type domain-containing protein	Low	7	1	16-37	ASLSCTRCINRKQTCDRVLPNC	mito(10),cyto(7),nucl(5),plas(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMH8	Oxoglutarate dehydrogenase (Succinyl-transferring), E1 component	Low	5.8	1	856-875	LFHILRRQLHRQYRKPLVIF	mito(17.5),cyto_mito(11.5),cyto(4.5),nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N1P0	Uncharacterized protein	Low	9.7	1	360-385	AVNKHRSTPLHEGRRRRRSRRTESVA	cysk(16),nucl(5),cyto(3),pero(3),cyto_pero(3)	EGRRRRRSRR (371-380, prob:0.865)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N983	Uncharacterized protein	Low	8	1	28-49	SMTRRGCLKGHRQYQKRKKDGI	mito(15),nucl(8),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NGJ8	FAD_binding_3 domain-containing protein	Low	8	1	1-25	MRASRSSAQLRPRKKKLRNAFLGVY	mito(14),cyto(5),plas(3),cyto_nucl(3),cyto_pero(3)	PRKKK (12-16, prob:0.692)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YBG3	CDH-cyt domain-containing protein	Low	5	1	358-378	GAVRKMLRGAKKQQHEPLKYN	plas(19),mito(3),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZQ5	Uncharacterized protein	Low	5	1	208-230	LFAWWFVRRRRQQKTQYPHTTQP	plas(16),extr(7),mito(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBX5	Uncharacterized protein	Low	8.5	1	42-62	PSLFHSKKSHLRKMSPPRRAL	nucl(13),cyto_nucl(11.5),cyto(8),pero(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFT6	Acyl-CoA-dependent ceramide synthase	Low	9.2	1	82-107	NGHSDGRKRLSKRRRARGLIGRAKQT	plas(16),nucl(3),mito(3),mito_nucl(3)	GRKRLSKRRRARGLIGRA (87-104, prob:0.957)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNW3	Trehalase	Low	8	1	658-683	RDAARVKKFGNRKRAAEKAAHKRSSR	extr(17),cyto(3.5),cyto_mito(3.5),vacu(3),mito(2.5)	ARVKKFGNRKRAAEKAAHKRSSR (661-683, prob:0.952)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWR7	Uncharacterized protein	Low	6.3	1	1-20	MPALPRPSRGRPRAFSKQDE	mito(11.5),cyto_mito(9.666),cyto_nucl(6.833),cyto(6.5),nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LRM2	Delta(24)-sterol reductase	Low	9.5	1	489-516	KVDVEARKEERQKWKRSLKSKPPLGGLY	cyto(13.5),cyto_nucl(10),nucl(5.5),pero(3),mito(2),extr(2)	KEERQKWKRSLKSK (496-509, prob:0.734)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MB28	Translation initiation factor RLI1	Low	7	1	7-36	RIAIVNSDKCRPRKCRQECKKSCPVVRSGK	mito(11.5),cyto_mito(8.333),nucl(7.5),cyto_nucl(6.333),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MGC9	Uncharacterized protein	Low	9.3	1	389-412	DTQGKPSASTRKRRGPPPQPELDL	nucl(16.5),cyto_nucl(13),cyto(8.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUZ6	Uncharacterized protein	Low	9.5	1	2-25	PSNSSRSSTHRGKHRKSSSSSSSS	mito(15.5),mito_nucl(11),nucl(5.5),cyto(4)	DKVKKKK (91-97, prob:0.754)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N6J9	HET domain-containing protein	Low	5	1	487-509	KSFTDRYTRLSKRQRRDEQLSIY	plas(10),extr(5),E.R.(3),golg(3),mito(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7L970	DUF2235 domain-containing protein	Low	5.8	1	5-27	SHLPGQQARQRKEKQSSPKLLFV	mito(18),cyto(5.5),cyto_nucl(4.5),nucl(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LCJ5	STE protein kinase	Low	9.4	1	525-544	RKITYPDSRAHRRHPRPLYW	nucl(17.5),cyto_nucl(13.5),cyto(8.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LIY8	Palmitoyltransferase	Low	6.1	1	635-655	GDQRLGIRRGKRPRLSSQGLE	plas(19),nucl(3),cyto(3),cyto_nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LS77	Aa_trans domain-containing protein	Low	5	1	467-497	ASNASTRSNRNSWRWRRKWRWDLEHIEHHHL	plas(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2Y3	Uncharacterized protein	Low	6.1	1	21-42	AIIFAKKKPKFPIINKYPKDFF	cyto(11.5),cyto_nucl(8),E.R.(5),nucl(3.5),plas(3),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M732	Uncharacterized protein	Low	7.3	1	22-72	ASLAPERKYKCQFCNRAFSRSEHRSRHERSHTKERPFKCMKCRSTFVRRDL	mito(12.5),cyto_mito(9.5),nucl(8),cyto(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7U4	Uncharacterized protein	Low	8.6	1	390-409	AIFWLIRRRRQQRRRSTLLT	nucl(9),mito(8),cyto(4),extr(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBJ8	Uncharacterized protein	Low	8.4	1	34-58	VSDQHVLLRRRRARNKRRGAFDIVR	plas(24),nucl(1),mito(1),pero(1),mito_nucl(1)	RRRRARNKRR (42-51, prob:0.859)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MLI0	CMGC/SRPK protein kinase	Low	6.3	1	20-44	TFTSYNPLYKRRRHQSQMAAQKYKC	mito(15.5),cyto_mito(10.833),cyto_nucl(5.833),nucl(5.5),cyto(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N246	Uncharacterized protein	Low	5.4	1	372-391	KWPDYMKKSLHKNVKIYKAL	plas(19),E.R.(3),vacu(2),nucl(1),cyto(1),cyto_nucl(1),golg(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N6L2	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	Low	9.2	1	10-57	CYACTNGKRKCDKAQPICGRCNDRDVECRYPPTKRKRLHSSAPRAENG	nucl(14.5),cyto_nucl(9.5),mito(5),cyto(3.5),plas(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N7K9	Lactamase_B domain-containing protein	Low	5.8	1	328-353	DMFPKQANDWKKKGWKEKTFWKFLNN	cyto(10.5),mito(8),cyto_nucl(7),extr(4),nucl(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7L8L3	Zn(2)-C6 fungal-type domain-containing protein	Low	6.9	1	9-33	KTGCLTCKIRRVKCDETKPACHRCT	mito(14),nucl(5),cyto(3),plas(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LD91	Uncharacterized protein	Low	9.2	1	357-376	LCMYDKVQRVKNKWKCTLKD	nucl(14.5),cyto_nucl(10.5),cyto(5.5),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LPE0	Uncharacterized protein	Low	6.1	1	565-586	VEICHKWRECIDRNQNTKRFGK	cyto(17),cyto_nucl(11.5),cysk(5),nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVW4	Uncharacterized protein	Low	5	1	2-28	ELSVPPRDANRTLRKKRSNRSSALTLS	plas(19),mito(3),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M4B2	Uncharacterized protein	Low	8.5	1	115-138	STKIGSRRNLKKPSLWQKLKNSKN	nucl(12),cyto_nucl(10),mito(6),cyto(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6L8	60S ribosomal protein L44	Low	9.2	1	31-55	KTRNTYCKGKECRKHTQHKVTQYKA	nucl(13),mito(9),cyto_nucl(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAE6	Uncharacterized protein	Low	9.9	1	360-383	VEVERKSHYSEPKKRKRMGSTTDE	cyto(14),cyto_nucl(11.5),nucl(7),cysk(4)	KRK (373-375, prob:0.619)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHJ0	Acetolactate synthase	Low	5	1	663-682	FDGAKDKKRRELMRERTCGL	mito(22.5),cyto_mito(14),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKE7	Elongation factor 2	Low	5	1	229-249	NRVGYRWKSEREKKRYNTEEL	mito(24),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKL0	Uncharacterized protein	Low	7.2	1	18-40	LAVAYRQRRPKHRSQPQPGFSYT	mito(13),nucl(6.5),cyto_nucl(6),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MM54	F-box domain-containing protein	Low	9.4	1	287-316	HCLGCARSSRPPFHKRRKFVRSSFHDHIRE	nucl(17.5),cyto_nucl(13.5),cyto(8.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MN94	Zn(2)-C6 fungal-type domain-containing protein	Low	6.9	1	1-21	MTRHGRRIKRCGTCVERKVKC	mito(13),nucl(5),plas(4),cyto_nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MV92	Zn(2)-C6 fungal-type domain-containing protein	Low	7.9	1	18-41	VSACDTCRRRKLKCSGEQPCQRCH	nucl(9.5),cyto_nucl(7.5),mito(6),cyto(4.5),extr(3),plas(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZI5	Zn(2)-C6 fungal-type domain-containing protein	Low	8.9	1	4-32	RNWHPKSRLGCTQCKKRHIKCDLKQAGCD	nucl(11),plas(8),cyto(3),pero(3),cyto_pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N1Y6	Zn(2)-C6 fungal-type domain-containing protein	Low	7.8	1	2-29	TSQAPRVCRICKAKKKACGKELPTCSYC	mito(12),nucl(7),cyto(4),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N6V2	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	1-47	MSSPLVTRRNGKKQACEPCRRRKVACDHGYPICRRCRKQPNGASACY	mito(12),nucl(11),plas(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVN6	Zn(2)-C6 fungal-type domain-containing protein	Low	9.2	1	20-50	PIIRSRTGCFTCRKRKKKCDESKPICSGCKR	plas(15),nucl(11)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LWC2	VanZ domain-containing protein	Low	8.3	1	199-223	LCSWYHKRMLERKRRRRYSAVPGEE	plas(15),mito(8),nucl(1),cyto(1),cyto_nucl(1),pero(1),E.R.(1),cyto_pero(1)	RKRRR (210-214, prob:0.696)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7H6	MYND-type zinc finger protein samB	Low	7.4	1	1155-1189	QAIVTLKKCSRCQRVKYCSGECQKRDWKKHRAECD	mito(10),cyto(7),nucl(6),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M8C3	Zn(2)-C6 fungal-type domain-containing protein	Low	7.7	1	11-54	RARVSCFHCRDSKRRCDKSLPTCQLCRRKEVECRYPQRRGQKAA	mito(10.5),nucl(9),cyto_mito(8.5),cyto(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M983	Pheromone a factor receptor	Low	8	1	471-495	RSLSSFRFGKKKDKRPPLDRGLPLD	plas(20),mito(3),E.R.(3)	KKKDKR (480-485, prob:0.69)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDD9	Uncharacterized protein	Low	5	1	40-61	LNSQNRPSFVRRKTNRLGRFSN	mito(24),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMD1	Uncharacterized protein	Low	8.7	1	68-92	NLIDRDPPKSRQRRTVNLRRQQHLL	nucl(11),mito(10),cyto(3),pero(3),cyto_pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUJ4	Uncharacterized protein	Low	9	1	17-43	PQPIRTPSPSRDRDRERDRRDRAFDRG	nucl(10),cyto(5),mito(3),pero(3),plas(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N172	Uncharacterized protein	Low	5	1	677-699	EEMLKFRASKRNNRRDKEDENYQ	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N7S2	Uncharacterized protein	Low	5	1	4-26	NLPMRPSTSSQRNRDSRNNYFNS	mito(20),cyto(3),pero(3),cyto_pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LL90	Uncharacterized protein	Low	8	1	618-651	QAPTKVNKPSGRRTRTRTRTHARRPSSPFSKKEC	extr(22),cyto(4)	PSGRRTRTRTRTHARR (626-641, prob:0.722)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTF9	Protein farnesyltransferase subunit beta	Low	5	1	1-21	MRARSRLTRPRPRVLFPRSNN	mito(19),pero(4),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LV75	Uncharacterized protein	Low	5	1	397-417	AGLFLCIRRKRQRQAKGEELS	extr(24),mito(1),E.R.(1),golg(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZZ0	AB hydrolase-1 domain-containing protein	Low	5	1	9-31	ATPLIRGRLQQRPRKSHHSTILG	plas(12),mito(5),E.R.(3),cyto_mito(3),pero(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3J3	Uncharacterized protein	Low	7.5	1	57-78	EAPMRAKSCKRQLKDPQRKSAY	nucl(8.5),cyto_nucl(8),cyto(6.5),pero(4),cysk(4),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M4C4	tRNA (uracil-O(2)-)-methyltransferase	Low	7.4	1	417-437	TGDRWRAPPPRDKTKPKSMFA	cyto_nucl(10.5),cyto(9.5),nucl(8.5),pero(5),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M4D7	Large conductance mechanosensitive channel	Low	5.3	1	142-168	SSEPIIKHTKKCKYCRQRINEKSIRCI	plas(20),mito(2),nucl(1),cyto(1),cyto_nucl(1),pero(1),E.R.(1),vacu(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBJ7	L-ornithine N(5)-monooxygenase	Low	5	1	142-165	GKEVSKHGRKKSGQRACGRRQEAR	cyto(7.5),cyto_nucl(5),E.R.(5),mito(3),plas(3),pero(3),cysk(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBX3	Uncharacterized protein	Low	9.2	1	64-91	TTAHQEIVLRRQRRRRRRSLALAPTFSL	extr(11),mito(6),nucl(3),cyto(3),cyto_nucl(3)	RRQRRRRRR (73-81, prob:0.819)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MD51	Matrin-type domain-containing protein	Low	8.3	1	455-478	AMQLWEKIQKEKKRTKVDEGSVVQ	nucl(11.5),cyto_nucl(11),cyto(9.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJ68	Phosphoglycerate kinase	Low	8	1	29-64	SRASSSHHLRVQPRKPRQRQQRQRHRVEKIDPHLEL	mito(15.5),cyto_mito(13.166),cyto(9.5),cyto_nucl(6.333)	KPR (43-45, prob:0.605)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJR5	tRNA pseudouridine55 synthase	Low	9.3	1	412-457	GNKSNKKKTESKGNSSPKWKQDKQQTPSKGEKRRRSNSPDEKESPP	mito(18),mito_nucl(12.833),cyto_mito(10.833),nucl(6.5)	PQAPAGNKSNKKKTESKGNSSPKWKQDKQQTPSKGEKRRRSNSPDEKESPPR (407-458, prob:0.941)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRU6	Inheritance of peroxisomes protein 1	Low	9.8	1	655-681	EHDGSHKQGKREHRHSRHRSNAQDMAV	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWW5	Uncharacterized protein	Low	5	1	13-37	AVSAGASRHRRVRRQKGPTDPGIPS	extr(16),mito(6),cyto(3),mito_nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0B7	Sulfite oxidase	Low	6	1	437-461	YTVPLEKLSKKRKWTWRTWEFELPC	cyto(16.5),cyto_nucl(11.666),cyto_mito(10.166),cyto_pero(10.166),nucl(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N6H3	Uncharacterized protein	Low	8.2	1	36-60	YEEPRYSKIDEKRPKRHIPEDSIMS	nucl(11.5),cyto_nucl(11.5),cyto(10.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LEM5	NADH-ubiquinone oxidoreductase 49 kDa subunit, mitochondrial	Low	5	1	61-82	LSKPRKAGTRKSRENSVQDRKV	mito(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LKT3	AhpC-TSA domain-containing protein	Low	5	1	20-42	VFDFSEKKREPNKLRKNPPADLD	cyto(15),cyto_mito(12.833),mito(9.5),cyto_pero(8.833)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1W3	Malate synthase	Low	5	1	38-57	RSFNERRKNLLERRKARQAE	pero(11),cyto_mito(5.833),mito(5.5),cyto(5),cyto_nucl(4.333),cysk(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ME98	Uncharacterized protein	Low	8	1	163-186	HLFHDCTKKRIRSRRQKKDFEFGP	plas(18),E.R.(3),mito(2),golg(2)	KRIRSRRQ (171-178, prob:0.668)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEI7	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	38-63	KPLLSCTFCRNRKVRCDRQLPCKTCT	nucl(15.5),cyto_nucl(10),plas(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEJ6	Uncharacterized protein	Low	5	1	242-262	VRFGKSWKKATSKSKKPSLFL	plas(21),mito(2),E.R.(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWN4	Uncharacterized protein	Low	7	1	281-302	SLSMCSCKRRSVRQRKRFALGP	cyto(10.5),cyto_nucl(9),nucl(6.5),E.R.(3),mito(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWU9	PPPDE domain-containing protein	Low	6.8	1	16-36	VYQNISKKWGDRKRRQAEEAW	cyto(12.5),cyto_mito(9.333),nucl(7.5),mito_nucl(6.833),mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5W7	GH16 domain-containing protein	Low	9.8	1	302-325	DTSDKRKRDDKGPKGRFLRKRGDE	nucl(8),cyto(8),cyto_nucl(8),plas(5),cyto_mito(5),mito_nucl(5),cyto_pero(5)	KRKRDDKGPKGRFLRKR (306-322, prob:0.876)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M461	Uncharacterized protein	Low	8.1	1	55-74	QPMATSRKRVAKKSTSSRTA	mito(10),nucl(8),cyto_mito(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5N8	Zn(2)-C6 fungal-type domain-containing protein	Low	7.1	1	23-54	RNRKPVSCMACQKRKSKCDRGKPTCGACHKRG	mito(9),plas(9),nucl(6),cyto(1),pero(1),golg(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MGX1	Uncharacterized protein	Low	6.3	1	90-111	ETKNCGCPRKCPKPDKVKCIDG	mito(11),cyto(9),cyto_nucl(7.5),nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHB6	Uncharacterized protein	Low	5.8	1	379-398	DWKALLRKKDGQPRPRSWEV	mito(15),cyto(8),nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNC0	Uncharacterized protein	Low	5.9	1	1133-1155	ASSSSKNPIKKIKSYRSDSRDMH	plas(19),nucl(2.5),cyto_nucl(2.5),pero(2),cyto(1.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSA8	MFS domain-containing protein	Low	5	1	466-488	SGYFWMKWDNNRRDKKNVEQELA	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVS2	MFS domain-containing protein	Low	8	1	237-260	HNKMVKAHIKRREKQNKKNKTVST	plas(26)	HIKRREKQNKK (244-254, prob:0.758)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MXB2	Ysc84 domain-containing protein	Low	7.3	1	84-103	QAGPKQKQRVLKKIPQKVIQ	mito(7),nucl(6),pero(5),plas(4),cyto_nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MXV9	Uncharacterized protein	Low	5	1	16-35	GPLPKGYTKRPKVINSNPIP	cysk(14),cyto(11)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5G1	Uncharacterized protein	Low	7.8	1	468-489	LPDPRLNKLRQRKRPMGPITNH	nucl(11.5),cyto_nucl(9.333),cyto(6),cyto_mito(5.833),mito(4.5),extr(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5V1	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	18-38	LECRTKHVKCDAKQPRCSRCT	nucl(11),mito(10),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LWL8	Uncharacterized protein	Low	5	1	603-628	EKQGCSVRYRCKCSKKDLENANLNEK	plas(22),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M160	Uncharacterized protein	Low	8	1	415-443	MRGEDKKEEDKGKKHKGKKEKEKEKEAQD	mito(13),cyto(4),E.R.(3),cyto_pero(3),extr(2),pero(2)	DKKEEDKGKKHKGKKEKEKEK (419-439, prob:0.992)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1P7	Uncharacterized protein	Low	9.6	1	199-222	VKRFAVLKKRCKPQIKSRIVRDIS	nucl(19),cyto_nucl(15),cyto(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M207	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	3-34	GTPSSRGCDGCRRQKKKCDQVKPTCGRCKRVG	nucl(12),plas(7),cyto(4),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3Y5	Exocyst complex component SEC5	Low	9.6	1	1008-1033	ASKNEFACFKKPKRPGHGPSRNNSGL	nucl(17.5),cyto_nucl(13),cyto(7.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBM3	Zn(2)-C6 fungal-type domain-containing protein	Low	9.8	1	19-42	ACEACRQRKSRCDGEKPSCQRCSS	nucl(17),cyto_nucl(10.5),mito(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDA4	Uncharacterized protein	Low	5	1	396-416	VLAWLWMKRRRERAHQEKVSG	extr(14),cyto(4.5),E.R.(4),cyto_nucl(3),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJ84	Uncharacterized protein	Low	9.6	1	1119-1142	GYEDEALKRRKRLQRLHHKVIFPV	mito(12),cyto(9),nucl(4)	RRKR (1127-1130, prob:0.634)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MN89	Alginate_lyase domain-containing protein	Low	8	1	463-490	TEEPGKGCRARRPKTHKHKGRKHHSVMN	extr(25)	RARRPKTHKHKGRKH (471-485, prob:0.947)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MT65	Zn(2)-C6 fungal-type domain-containing protein	Low	8.8	1	54-84	KQEKQRIKLAVKKNFRQQKRLQGRRLRGVNQ	plas(12),mito(9),nucl(2),E.R.(2)	VKKNFRQQKR (64-73, prob:0.642)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N698	Uncharacterized protein	Low	5	1	27-52	SSSDRLPPTTKEKQKLRKIAGRIPWV	plas(24),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LPJ1	Uncharacterized protein	Low	7.1	1	421-442	LLLLRRRKKTRQPSPENTQPRH	cyto(7.5),cyto_nucl(7.5),nucl(6.5),extr(5),mito(3),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LQ56	Uncharacterized protein	Low	7.5	1	106-130	WEWVDERMDRRKKQREAREQAEKDE	nucl(10.5),mito_nucl(9.333),cyto_mito(7.833),cyto(7.5),mito(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LXK0	Asparagine synthase (glutamine-hydrolyzing)	Low	6	1	77-96	IYNHRHIRKNLKEQYHFKTT	cyto(13.5),cyto_nucl(9),pero(6),nucl(3.5),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M285	Uncharacterized protein	Low	5	1	404-423	GFKGCCKKDACSQKKPVCPK	extr(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7H4	Uncharacterized protein	Low	9.2	1	48-91	VSASRQKQSKRDEAIRKKLENDLSKKKHLTSRARHSRKAPPGTV	mito(12),cyto(5.5),cyto_nucl(5),nucl(3.5),plas(3)	KRDEAIRKKLENDLSKKKHLTSRARHSRKAP (57-87, prob:0.873)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M8G3	Uncharacterized protein	Low	5	1	24-47	ISTIRNRYYTYKNRAPPQRPPLLL	plas(19),E.R.(4),mito(2),extr(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIP2	FAD_binding_3 domain-containing protein	Low	5.8	1	312-331	RASTKLPKNWRERLQAQNGN	extr(15),mito(4.5),cyto_mito(4.333),cyto_nucl(3.333),cyto(3),nucl(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ML70	WD_REPEATS_REGION domain-containing protein	Low	9.1	1	308-335	SEAEIKKALVRKRRRRREKAKDGKVVEE	cyto(10.5),cyto_nucl(7.5),mito(7),nucl(3.5),E.R.(3)	IKKALVRKRRRRREKAKD (312-329, prob:0.992)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPX4	Uncharacterized protein	Low	8.1	1	1-20	MERRRFDRRPSPSSNRQTFS	mito(11),nucl(8),extr(3),cyto(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MT75	PKS_ER domain-containing protein	Low	6.2	1	329-354	LADAKEAYRRLKKQKHFAKVVIRIDH	cyto(11.5),cyto_pero(9.666),cyto_nucl(9.333),pero(6.5),nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVR0	Zn(2)-C6 fungal-type domain-containing protein	Low	7.3	1	10-49	AMSQPVTARRKMRKGTHSCSECRRRKIKCKFHPGTSSPCI	mito(12),nucl(6),plas(6),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N4A1	Uncharacterized protein	Low	8.2	2	33-63, 404-425	RPEVTHRIRTRFRSHRKYDRHQNRHRVTAVN, DVDSKGKKPNPPSRSQRAPYSQ	mito(23),nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N6Q6	Apple domain-containing protein	Low	8.7	1	1-20	MQKLPPPPRRLRAPAKPTAY	nucl(10),mito(7),cyto(6),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N865	Elongation of fatty acids protein	Low	8	1	453-472	DEASRSSTPKKANGKPRRKA	plas(25)	PKKANGKPRRKA (461-472, prob:0.924)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YAY8	Zn(2)-C6 fungal-type domain-containing protein	Low	7.5	1	9-36	SSSQLRACLNCQKRKSRCQPSVNGPGPC	mito(17),nucl(7.5),cyto_nucl(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7L922	Zn(2)-C6 fungal-type domain-containing protein	Low	7.5	1	40-67	GAQCVPAIQPRQRRRRFPERELLDRLRR	mito(12.5),cyto_mito(8.5),nucl(8),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LCX2	alpha-1,2-Mannosidase	Low	8	1	589-612	HPLIIPKRSRQKPARRHSLSKRVV	extr(12),mito(7),cyto(3),plas(3)	KRSRQKPARRHSLSK (595-609, prob:0.804)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LS35	Uncharacterized protein	Low	7.8	1	207-229	STSNDDSPRPRRKERYIERNEAI	cyto_nucl(14.5),cyto(14),nucl(11)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M081	Fe2OG dioxygenase domain-containing protein	Low	6.4	1	304-323	EKGKRWKSIDWHMRKYKSYR	mito(9),cyto_pero(6.833),pero(6.5),cyto_nucl(6.333),cyto(6),nucl(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M477	Uncharacterized protein	Low	8	1	549-576	PKSPSGKILRRLLRDKEKQARKDKGAKL	cyto(24),cysk(2)	KSPSGKILRRLLRDKEKQARKDKGAKL (550-576, prob:0.926)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M835	DNA polymerase	Low	8.1	1	514-536	TTFQRDVRRYCKKAKGYKFDSSG	cyto_nucl(12),nucl(11),cyto(9),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKG1	Rap-GAP domain-containing protein	Low	9	1	1489-1513	HVSSWRSRLRAIKRLREKYTPSKSG	plas(12),nucl(3),cyto(3),cyto_nucl(3),E.R.(3),mito(2),pero(2),vacu(2)	RRKASRSSKGAA (207-218, prob:0.737)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N9A9	6-O-methylguanine-DNA methyltransferase	Low	6.1	1	15-34	QEDRKVKVTKTKKQSSPAAP	mito(17),cyto(5),nucl(3),cyto_pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LT20	Uncharacterized protein	Low	8.2	1	18-37	IKEPCHSRRQQKTANCNQIQ	mito(10),nucl(8),cyto(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZ48	Glycosylphosphatidylinositol anchor biosynthesis protein 11	Low	8	1	94-114	SSGSSKKPRPGEKKKSDGREA	plas(15),E.R.(5),extr(4),vacu(3)	SKKPRPGEKKKSDGRE (98-113, prob:0.916)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1M1	alpha-1,2-Mannosidase	Low	5	1	88-110	TADQRRKDIKQAFKKTWRSYEKY	extr(8),plas(6),E.R.(4),golg(4),vacu(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M293	Uncharacterized protein	Low	8.7	1	720-740	ALDYRSKWEKHRLNRFIKIGQ	nucl(13),cyto_nucl(8.5),plas(8),cyto(2),mito(1),pero(1),E.R.(1),golg(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5E2	ATPase synthesis protein 25	Low	8	1	194-216	GPGELRTKLRRLRKKAKLMGTNT	mito(25)	RTKLRRLRKKAK (199-210, prob:0.823)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6R5	ANK_REP_REGION domain-containing protein	Low	5	1	82-101	AFTHRPKPRISPQHKWYNYH	cyto(10),cysk(8),mito(4),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAD6	Translocation protein SEC63	Low	6.2	1	61-80	SLKSAQKRSQWRVKRVIFVI	plas(9),E.R.(5),nucl(3.5),cyto_nucl(3.5),golg(3),cyto(2.5),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MG22	Uncharacterized protein	Low	9.8	1	107-131	KAPGFLCKCCPKRRKRFSTLKELIT	nucl(12),mito(11),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPQ7	Uncharacterized protein	Low	8.7	1	61-85	FFRSWERALKWRKRLIKRKGKGIMI	cysk(23),nucl(2),cyto(2),cyto_nucl(2)	ALKWRKRLIKRKGK (68-81, prob:0.917)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQC5	Uncharacterized protein	Low	7.7	1	785-805	GHVQQCPRKNFSKNRRWWGWG	nucl(8),cyto(8),cyto_nucl(8),pero(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LER6	Uncharacterized protein	Low	9.3	1	6-33	NSRLETDRARPNQRRPCPQKHREAHGGP	nucl(16),cyto_nucl(12),cyto(6),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LJN5	Uncharacterized protein	Low	8.8	1	295-316	REEALKKKKDGKKTPGKHGLKE	mito(17.5),cyto_mito(11.5),cyto(4.5),nucl(3)	ALKKKKDGKKTPGKHGLKEKQQAP (298-321, prob:0.975)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LMQ5	Uncharacterized protein	Low	5.7	1	415-439	EFSSFDRSQRRERRRWGFPRTESMK	plas(18),E.R.(3),nucl(2),mito(2),mito_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVE0	Palmitoyl-CoA hydrolase	Low	9.1	1	132-154	QDPNCKPQDRKSRQWMRSRQKIS	nucl(14.5),cyto_nucl(9.5),cysk(5),cyto(3.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LY11	AGC/PKA protein kinase	Low	9.3	1	1-22	MPSLGFLKKKRTREGNSDPSAS	nucl(15.5),cyto_nucl(12),cyto(5.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MN86	Uncharacterized protein	Low	5	1	310-330	LIWFCLRKRRNAKNKAEYDDV	extr(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPB0	Amidohydro-rel domain-containing protein	Low	5	1	19-42	VGLHPGQQRNRRLLRRSRGIRLFA	cyto(14.5),cyto_nucl(8),mito(5),extr(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LHR2	Uncharacterized protein	Low	9.4	1	709-731	MEVAPPRNGKMQKNPKDDKDCIV	nucl(17),cyto_nucl(13.5),cyto(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LNN6	Uncharacterized protein	Low	9.6	1	321-341	TIPTIEKKRPQQKIHHQESDS	nucl(12),cysk(8),cyto(4),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LWH2	Uncharacterized protein	Low	9.9	1	614-635	DEQGTRKKKAKSCLIRRRHLSE	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LX33	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	28-75	AAQACETCRNRKQRCDEQRPKCGTCQRFKLDCRYREPQPTKKDKTLVE	nucl(11),plas(7),cyto_nucl(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAD5	Uncharacterized protein	Low	5.4	1	192-214	VYEPAKKWYHARRREKHGIEREH	mito(10),cyto(8),cysk(4),plas(2),nucl(1),extr(1),pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAM9	Uncharacterized protein	Low	7.8	1	86-112	GSCEACKRAKGRCDKVRPTCSRCLQKG	extr(10),nucl(7),mito(4),cyto_nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDK7	Uncharacterized protein	Low	8	1	390-415	DDSHGPHKIKRRTRWRRWLAQGRWNE	plas(24),E.R.(2)	KIKRRTRWR (397-405, prob:0.729)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEY9	FHA domain-containing protein	Low	9.8	1	495-521	VDGLRKPSLRACRKQHKQYYWKRPKTP	nucl(19),cyto_nucl(14),cyto(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJT5	ANK_REP_REGION domain-containing protein	Low	7.1	1	108-131	SSIHKWSYPFKKKSINRLEERLKS	plas(11),nucl(6),cyto(6),cyto_nucl(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKU4	HET domain-containing protein	Low	8.7	1	73-97	DNAAAALRRLRWKRKNRILWIDAIC	nucl(10),cyto(7),mito(6),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LGT2	Uncharacterized protein	Low	5	1	28-47	FCSFCLVRRKRDPARTAFTY	plas(17),E.R.(5),vacu(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LMK6	Uncharacterized protein	Low	5	1	317-336	VYNHKDKHRKSSFGDQRPSR	extr(13),mito(10),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LP06	Protein phosphatase	Low	6.2	1	20-47	LPVRRLACTAWRPCRKRRFASTTTRLLH	mito(16),cyto(6),nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTK3	Uncharacterized protein	Low	6.2	1	1-22	MRTGPRRQNKTVKQQGSRSEVG	plas(11),mito(6),nucl(3),pero(3),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M280	Uncharacterized protein	Low	8.9	1	14-41	WPTTNFQAQKYQRQKPQRPYYPHYNSIY	nucl(14.5),cyto_nucl(11),mito(7),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M284	Vacuolar membrane-associated protein IML1	Low	7.3	1	41-64	VSTHSTIKEEKRTRIERRCTVTVN	mito(15),nucl(7.5),cyto_nucl(6),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6P7	DnaJ like subfamily B member 4	Low	8.5	1	21-41	EIKKGYKKAALKWHPDKNKDS	nucl(11),cyto(10),mito(5),cyto_pero(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MED5	Uncharacterized protein	Low	9.1	1	6-30	HEDNRNHRADRDRSRSRSRTSRAQA	nucl(14.5),cyto_nucl(11),cyto(6.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTF5	Fe2OG dioxygenase domain-containing protein	Low	7.7	1	1-23	MAKTKSKKRKQAQAQAQSDNPRK	cyto(10),mito(9),nucl(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5J5	ATPase	Low	8	1	142-162	IGEHLKSGKKEPKRILHQFDG	plas(25)	KWNLGKKKKA (1458-1467, prob:0.83)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NGB1	MFS domain-containing protein	Low	5	1	454-476	AWGMRFWLKQENKKIRQSENEST	plas(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LAF0	30S ribosomal protein S5	Low	5	1	28-55	VPCSQFHSTPTRSKRKSRFRNVTAQELG	mito(22.5),cyto_mito(13.833),mito_nucl(12.666)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M0B7	Fido domain-containing protein	Low	6.1	1	343-363	DLPEGFKPKHHKKLATFTLKH	cyto(20),cyto_nucl(14),nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1J0	Rab-GAP TBC domain-containing protein	Low	9.1	1	155-174	ADTPKDKDLKDKKDLREQRI	nucl(15),cyto_nucl(12),cyto(7),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M209	Zn(2)-C6 fungal-type domain-containing protein	Low	9.3	2	8-38, 45-69	DSERRRCANACYTCKRRKERCDGRQPCGRCV, ECSFIPSPTTKRRVRNARPPSSGAG	plas(20),nucl(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3P2	HET domain-containing protein	Low	8.4	2	19-39, 52-71	GGGVERRRSRNPLKNMMQHLT, RRASLIRRISWRKSRSPSAH	cyto(9.5),cyto_nucl(7.5),mito(7),nucl(4.5),pero(2),cysk(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MA53	Methionyl aminopeptidase	Low	9.9	1	378-405	LEQPLARNTGKKKSKPKKKTAKKEDDEE	cyto(17),cyto_nucl(13.833),nucl(8.5),mito_nucl(5.166)	TGKKKSKPKKKTAKK (386-400, prob:0.986)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDQ0	Carboxylic ester hydrolase	Low	8.6	1	475-506	SLDPNSKKGKLPKWPKYSKSKPKNMVLNATKN	extr(18),mito(3),vacu(2),nucl(1.5),cyto_nucl(1.5)	KKGKLPKWPKYSKSKP (481-496, prob:0.79)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEP4	Uncharacterized protein	Low	5	1	49-68	SSGKDERKKECPSRRLTLTF	plas(15),E.R.(5),mito(4),vacu(2),cyto_mito(2),mito_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEQ0	tRNA dimethylallyltransferase	Low	8.9	1	404-429	AWKQHLKSSTHRRVVRKKARTSLVPV	nucl(13.5),cyto_nucl(9.5),mito(7),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRP7	Zn(2)-C6 fungal-type domain-containing protein	Low	9.5	2	3-30, 62-85	GVAGRSKACHTCRQRRIRCGAERPSCGN, TLDAPPSQSRHKRQQHINRQHMIA	mito(14),nucl(7),cyto(3),plas(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MU06	Uncharacterized protein	Low	6.9	1	21-49	FYSCYRPCDHYKQRYCNRYRNPRQCCTCA	mito(12),cyto(7),nucl(5),extr(1),pero(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MYQ7	Uncharacterized protein	Low	8	1	69-94	SRAVALEKLRNRPKKLRKALIANILR	plas(25)	HRRPSRAVALEKLRNRPKKLRK (65-86, prob:0.905)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N678	Glyco_hydro_30C domain-containing protein	Low	8	1	515-564	VASKGSSKSAPKKGTKKTTTKKGSHQSHKAHSATHRRCRHGSYRRGHCTN	extr(22),cyto(3)	KGSSKSAPKKGTKKTTTKKGSHQSH (518-542, prob:0.906)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7L8M4	Zn(2)-C6 fungal-type domain-containing protein	Low	6.8	1	5-33	LQPSVSKACSRCRSRKVKCDLRVPQCTAC	mito(14),nucl(5),plas(4),cyto(1),extr(1),pero(1),golg(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LCZ2	Uncharacterized protein	Low	9.5	1	2-24	SESDKPRQSVKRQLKPAPQRPGQ	nucl(16.5),cyto_nucl(11.5),cyto(5.5),plas(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LP52	Uncharacterized protein	Low	7.3	2	72-94, 513-534	ATRSCPTVKKPLRRCKVWTCVPG, DMPCSKKETKVYKKSGLQKSFS	extr(15),plas(4),E.R.(3),cyto_mito(1),vacu(1),golg(1),cyto_nucl(1),cyto(1),mito(1),nucl(1),mito_nucl(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTT3	Uncharacterized protein	Low	5	1	216-240	SSGGYSGRSWRRRRSVRSSHGPGYE	plas(22),mito(2),extr(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKZ5	Uncharacterized protein	Low	8.5	1	194-217	QLRHLRSESSRWRKVRKIYREVVH	nucl(13.5),cyto_nucl(10.333),cyto(6),cyto_pero(4.333),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPV6	Expansin-like EG45 domain-containing protein	Low	8	1	59-93	VKTTASKPKTTKPKKVSKPKASKPKTTKPSTPKTS	extr(13),cyto(7.5),cyto_mito(7.5),mito(6.5)	KPKTTKPKKVSKPKASKPKTTKP (65-87, prob:0.976)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUG0	Uncharacterized protein	Low	6.6	1	559-579	PELFKITKKSQHQRVKGVCCS	cysk(13),cyto(7),cyto_nucl(7),nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUJ5	G_PROTEIN_RECEP_F2_4 domain-containing protein	Low	5	1	311-332	ADEERGRRRSRLKTMMNSRTED	plas(23),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MV13	Ribose-phosphate diphosphokinase	Low	5	1	88-111	VLPYFPYSRQSKKKSHRGAITARM	cyto(10.5),cyto_mito(10),mito(8.5),extr(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVF8	AA_TRNA_LIGASE_II_ALA domain-containing protein	Low	8	1	31-55	VISCEKAPKQAHKSKKSNGHSHSHD	nucl(11),cyto_nucl(10.5),cyto(8),pero(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWB6	HET domain-containing protein	Low	9	1	40-65	VENLECLGRRQSKKRKLTEEENEKFE	nucl(17.5),cyto_nucl(13.333),cyto(8),cyto_mito(4.833)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NHM6	Uncharacterized protein	Low	5	1	37-58	AGHNKWSKTKHIKAVTDKKKMT	mito(22),cyto_mito(14),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YBX2	Apple domain-containing protein	Low	5	1	232-255	SAIGLCKWRRNYKHRCYKRGATVT	extr(21),E.R.(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LAP5	Uncharacterized protein	Low	7.7	1	281-300	LEQLRKQPENKDKGRFRILK	cyto_nucl(11.5),nucl(10.5),cyto(9.5),mito(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LCK5	Uncharacterized protein	Low	5.3	1	23-44	GSSLSRPQKKSWKERLQHDVSC	plas(22),cyto(2),nucl(1),mito(1),E.R.(1),mito_nucl(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LSF7	MFS domain-containing protein	Low	5	1	444-466	AFWAWFRRQNKRKVEGKEDYRIQ	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LUL4	Cysteinyl-tRNA synthetase	Low	8	1	810-836	DVPKSQLKGLKKQWDRQKKAHDDLKAK	mito(24),cyto_mito(13.166),mito_nucl(13.166)	EKARKKEEARLAREKADQEAREKA (756-779, prob:0.843)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LY57	Mediator of RNA polymerase II transcription subunit 16	Low	6.1	1	890-917	VDVFKRMQIRPSPNKQWRRCSRCTAVME	cyto(8.5),plas(7),cyto_nucl(6.5),mito(5),nucl(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6V0	Kinesin motor domain-containing protein	Low	6.3	1	452-471	SQRASNKPKTSQKDAKPEKE	cyto(11),cyto_nucl(9.833),cyto_mito(8.499),pero(6),nucl(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTF6	AAT family amino acid transporter	Low	5	1	563-582	QEREERHGWPRWKKVYRFLC	plas(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWC7	Uncharacterized protein	Low	8	1	420-444	MTVDQLTKMKKQRKSPKSKMFLLSW	extr(9),E.R.(6),plas(4),golg(4),mito(2)	QRK (431-433, prob:0.614)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5A5	AA_permease domain-containing protein	Low	8	1	59-81	WLDGFRRADRRKLKKGWDKGGYH	plas(27)	DRRKLKK (67-73, prob:0.715)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LWC8	SURF1-like protein	Low	7.3	2	14-35, 170-191	SKQIPRCKRFTNAPPRRQFTSS, LVNRGWIDKKHRDKRTRPDGLP	plas(16),mito(7),nucl(1),cyto(1),cyto_nucl(1),pero(1),golg(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZM2	Uncharacterized protein	Low	5	1	13-33	LSSGLKCRTYRLQRRQYATSL	mito(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M0Z8	Zn(2)-C6 fungal-type domain-containing protein	Low	8.8	1	36-59	LACSACRIRKSRCNGVRPRCDTCD	nucl(11),cyto(6),plas(6),mito(3),cyto_pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M265	Amidophosphoribosyltransferase	Low	9.3	1	55-77	REEVPVKKMKTGRKTKHQVEDEY	mito(18),cyto_mito(11.5),nucl(5),cyto(3)	RKRKDVGREEVPVKKMKTGRK (48-68, prob:0.761)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMM5	SWIB domain-containing protein	Low	9.2	1	54-77	AHASELAKRRSRKPTDKNIPDGVE	nucl(13.5),mito(10),cyto_nucl(8.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMV1	MFS domain-containing protein	Low	5	1	542-561	LTKTVTNESRRGRRGRNSLS	plas(21),mito(3),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N560	Uncharacterized protein	Low	9.3	1	1-21	MSSPKSQKSRSPTKSPPGPES	nucl(13),mito(5),cyto(4),pero(4),cyto_pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVA8	Phosphatidylinositol glycan, class C	Low	8.4	1	103-133	FVSPPRGPRGRSRRRKRPWKKLMWVKQSYPD	plas(22),E.R.(2),nucl(1),mito(1),vacu(1),mito_nucl(1)	PRGPRGRSRRRKRPWKK (107-123, prob:0.992)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LWR5	MFS domain-containing protein	Low	5	1	481-505	FFVLRYAFKWENKRKEQNREALRVA	plas(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LY47	Dolichyl-phosphate-mannose--protein mannosyltransferase	Low	5	1	523-542	LPADHPRRQKPERKVKSLPF	plas(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBW9	Uncharacterized protein	Low	5	1	36-56	RTPQMSRGSKQKRYRFFVNLC	plas(9),mito(8),golg(3),pero(2),E.R.(2),cyto(1),extr(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MP19	Uncharacterized protein	Low	5	1	5-30	ILRPAFKHPLRHIQRRFQSSPPKKDP	mito(23),cyto(2),pero(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTW2	Zn(2)-C6 fungal-type domain-containing protein	Low	6.2	1	47-67	VDEGPKVRRSRRKAQASVTPS	plas(13),mito(6),nucl(3),cyto(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5R2	Uncharacterized protein	Low	8	1	45-68	VGELTPEKKKKLKRKIYIHVLLLV	plas(24),pero(2)	KKKKLKRK (52-59, prob:0.849)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NDU3	Uncharacterized protein	Low	5	1	182-205	GGIGWLVWRRRTRRKNNAAPAELP	extr(17),mito(3),golg(3),cyto(2),mito_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LB56	Uncharacterized protein	Low	8	1	402-421	IKDWRVQKKQQLKKPRVGAW	nucl(11),cyto_nucl(11),cyto(9),pero(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LWZ0	tRNA-dihydrouridine synthase 3	Low	6.1	1	280-299	VENRDQRSPARQRVRCGRCD	cyto(11.5),cysk(9),cyto_nucl(8),nucl(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3T3	Probable electron transfer flavoprotein subunit beta	Low	8	1	196-219	ASLPNIMKAKKKKLEKTKLEDFGV	cyto(14.5),cyto_mito(13.5),mito(11.5)	AKKKKL (204-209, prob:0.733)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3Z4	Cell division control protein 45	Low	9.2	1	729-769	LDREAAKKRKAEREEKLKKKEESRLAKQKIREDKRAARRDA	mito(10),cyto(6.5),cyto_nucl(5.5),nucl(3.5),plas(2),extr(2)	AAKKRKAEREEKLKKKEESRLAKQKIREDKRAARR (733-767, prob:0.995)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRW6	Uncharacterized protein	Low	8.2	1	330-352	VFAARYRREIRSKKVHGYFRGKV	nucl(12.5),cyto_nucl(12.5),cyto(9.5),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTB5	MFS domain-containing protein	Low	5	1	14-34	GEPVTQPTKRRKWYSLFGKDV	plas(23),mito(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVB5	Uncharacterized protein	Low	7	1	114-135	HGETRACKRSQAKRKRILELIT	cyto(8.5),cyto_nucl(8),mito(7),nucl(6.5),plas(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M932	Uncharacterized protein	Low	8.4	1	269-290	MQRLRECRFKSRQKYDTKLFLD	nucl(12),cyto_nucl(9),mito(4),cyto(4),plas(2),pero(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MGZ5	MFS domain-containing protein	Low	5	1	582-607	VWLPYFFKRHILRKKNVVKPPPIIER	plas(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHY6	C2 domain-containing protein	Low	9.2	1	696-722	TTATKVSAAKRQQQRQKLERQQSDDGQ	nucl(14.5),cyto_nucl(10.5),cyto(5.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWD2	Uncharacterized protein	Low	6.3	1	115-135	GAERRLWNKRCDRHRKVSSAL	cyto(8.5),cyto_nucl(7),mito(6),nucl(4.5),plas(4),extr(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZ33	Uncharacterized protein	Low	5	1	53-74	LELKRQRMSRKQRQKSNEWELR	mito(21),cyto_nucl(3.5),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZV7	DNA-directed RNA polymerase subunit beta	Low	8.6	1	1219-1242	LSKQSFECRPCKNKTKIAQIHIPY	nucl(14),cyto_nucl(13.5),cyto(11)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LEF4	Uncharacterized protein	Low	8	1	710-735	ISCCCFSCIKRRIARRRAAKQPAMGS	extr(24),golg(2)	RRIARRRAA (720-728, prob:0.7)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LJH1	Cytochrome P450 oxidoreductase	Low	8	1	22-49	LYLLGKKSPKPTRNGKPLRKPPNSLPLV	extr(10),plas(4),E.R.(4),mito(3),cyto(2),pero(2),mito_nucl(2),cyto_pero(2)	KKSPKPTRNGKPLRKP (27-42, prob:0.79)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTD8	Uncharacterized protein	Low	6.9	1	9-28	SSNSRHSSTRRSRSLRLSTG	plas(13),nucl(5),golg(3),E.R.(2),cyto(1),extr(1),cysk(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTR6	Zn(2)-C6 fungal-type domain-containing protein	Low	9.8	1	27-52	RKASLACLTCRKKKVRCSGTTPCQYC	plas(13),nucl(12)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LV44	Uncharacterized protein	Low	5	1	1224-1248	GPQTDYLKFLRRRKGNTNQPKDSET	plas(24),mito(1),cyto(1),E.R.(1),cyto_mito(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LCW5	RING-type domain-containing protein	Low	6.7	1	509-533	RPPAPAQIPKTRRPRPRLLNMLPTQ	extr(7),nucl(5),mito(4),cyto_nucl(4),cyto(3),plas(3),golg(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LMR1	Uncharacterized protein	Low	5	1	1-39	MKFPTFKRSQQKHTDKPSRAKNYRVLFRKWPRVSRKGTW	plas(20),mito(4),cyto(1),pero(1),E.R.(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M4Y3	FAD_binding_3 domain-containing protein	Low	8	1	648-668	KDTPRSKPSKEDPGRRKQKAE	cyto(10),plas(6),extr(6),mito(4)	PRAKDTPRSKPSKEDPGRRKQK (645-666, prob:0.851)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7Y5	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	17-59	CLTCRARKVKCDEAKPVCNNCTRLQRQCTYKPRRVFRQTASAD	nucl(15.5),cyto_nucl(10),mito(6),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCB4	Uncharacterized protein	Low	8.6	1	93-117	AWPMTRPPKKNNNSGCQCRRKSRLI	nucl(9),mito(8),extr(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMG7	ATP-dependent Clp protease ATP-binding subunit ClpX	Low	5.7	1	119-141	NHYQNLRRRHQHEHEDRNRRDKV	mito(9),cyto(6),extr(3),vacu(3),cyto_pero(3),nucl(2),plas(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQ90	Zn(2)-C6 fungal-type domain-containing protein	Low	7	1	3-22	SSRQKSCSACVRGKRRCDLG	mito(20),nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRV9	ANK_REP_REGION domain-containing protein	Low	9.5	1	548-569	NGAPIDRRRRRDKTVKNSDSCT	nucl(13),mito(8),cyto_nucl(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N1S0	Uncharacterized protein	Low	9.3	1	65-112	DKETWQYIDRKIRKRKDEGKDSEVIHCGKRLKKLKVTKETNRHRETNI	plas(19),nucl(4),cyto(2),pero(2),mito_nucl(2),cyto_pero(2)	IRKRK (76-80, prob:0.664)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N666	Uncharacterized protein	Low	6.4	1	1270-1297	QDGTIRCTRCRTRSDRWKYPNRYVCRTC	cyto(10.5),cyto_nucl(8),nucl(4.5),mito(3),pero(2),E.R.(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFS5	GPI ethanolamine phosphate transferase 3	Low	5	1	1-22	MPQKPKAKPKAQQQPPQTEHQK	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MH73	AAA domain-containing protein	Low	9.3	1	20-43	DSICEPKVYHHTKNKEGRDQCKEQ	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MLU2	Protein OS-9 homolog	Low	8.8	1	470-492	DELAKNKAKLKKEKEALDKAKAE	mito(16.5),mito_nucl(10.999),cyto_mito(10.666),nucl(4),cyto_nucl(3.999),cyto(2.5)	KNKAKLKKEKEALDKAKAEKKKA (474-496, prob:0.939)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMY3	Uncharacterized protein	Low	5	1	3-25	INRSNMRRIRNLGRRSQPRPNFA	mito(16),plas(7),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N4C1	Uncharacterized protein	Low	8.2	1	766-785	QKKQWLLQNRPERVKKPKTI	cyto(10),nucl(8),pero(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N776	GH16 domain-containing protein	Low	5	1	35-61	STESSLKKRFPQRPYFHSRRVKKGTVE	plas(17),mito(4),extr(2),golg(2),cyto_mito(2),mito_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NES5	Uncharacterized protein	Low	6.7	1	25-49	THSHAVRQRHAKERRLRMQKHQEDM	mito(15),nucl(5),cyto(5),cyto_nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NGD2	Zn(2)-C6 fungal-type domain-containing protein	Low	8.5	1	7-32	ARKACDVCYRKRIRCDGQKPRCSHCI	nucl(11.5),mito(11),cyto_nucl(7.5),cyto(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHB0	Uncharacterized protein	Low	5.8	1	21-41	QMQRVSRRYRMPPEWQKHSQT	mito(16),cyto(5),pero(3),nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIK5	Uncharacterized protein	Low	8.5	1	523-545	SALPKETLCRKRKRQTQPSDLVH	cyto(12),nucl(9),mito(3),plas(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNU3	Uncharacterized protein	Low	8.6	1	953-977	AAMFLVARRYKRKKQQGHRRASSIG	extr(15),mito(3),E.R.(3),golg(3),nucl(1.5),cyto_nucl(1.5)	RYKRKKQQGH (961-970, prob:0.735)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MP31	DUF155 domain-containing protein	Low	8.8	1	67-91	KEEKGPASSKRKPTRSNTAKNSLRR	mito(13),cyto(7.5),cyto_nucl(5.5),nucl(2.5),golg(2)	SKRKP (75-79, prob:0.669)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSF5	Uncharacterized protein	Low	7.4	1	517-539	NYEVRPCARRRFAQECHHRRLRD	cyto(9.5),nucl(8),cyto_mito(8),mito(5.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZ83	ATPase	Low	8	1	1300-1322	WGLLKIARTHWKGRKKSDESVKR	plas(23),E.R.(3)	KGRKK (1311-1315, prob:0.666)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YBM3	ANK_REP_REGION domain-containing protein	Low	8	1	93-118	DARHDNIKKAHRKTCKWIIKRAEYLD	cyto_nucl(13.5),cyto(12),nucl(11)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M006	Uncharacterized protein	Low	7.5	1	43-64	AILFLFRRARRQKQQTIQSEED	nucl(8.5),cyto_nucl(8.5),mito(8),cyto(5.5),extr(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6L0	Zn(2)-C6 fungal-type domain-containing protein	Low	8.6	1	388-412	YTRQKRGCLTCRQRKKKCDQLYPIC	mito(13),nucl(9),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCH1	Uncharacterized protein	Low	6.1	1	18-37	PGPGSHKKIAKRDGNRGVHE	mito(11.5),cyto_mito(8.166),extr(8),cyto_nucl(4.833),nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCH2	Peptidase_M14 domain-containing protein	Low	8.4	1	231-252	ITDDRLWRKNRQKRAGKKCIGT	extr(13),cyto(7),E.R.(4),nucl(1),golg(1),vacu(1)	K (243-243, prob:0.603)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEX9	Uncharacterized protein	Low	7.9	1	88-107	RTRPRSTRSHSRTTRKDSTR	nucl(12.5),cyto_nucl(12.333),cyto(9),cyto_pero(5.499),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFD2	Zn(2)-C6 fungal-type domain-containing protein	Low	5.8	1	28-56	ARPGKARSLACRQCRDRKIRCDGARPVCD	mito(16),plas(5),nucl(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKW4	Carboxylic ester hydrolase	Low	5	1	527-547	EVERRHCRYPYRNVYQKGDYK	extr(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPR9	FAD_binding_3 domain-containing protein	Low	5	1	101-120	IPPGDRRRVNREKLRKVLLK	extr(8),E.R.(6),plas(4),cyto(3),pero(2),golg(2),cyto_mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MV63	Uncharacterized protein	Low	6.5	1	380-399	SVIRWFKYPAKQRKGCQPEL	cyto(13.5),cyto_nucl(12),nucl(5.5),mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVT5	Uncharacterized protein	Low	7.4	1	245-269	VNIVKRKWPLNRWPKDPKHKQIGTW	cyto(13),cyto_nucl(12),nucl(9),pero(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LAV8	Fungal_trans domain-containing protein	Low	6.8	1	2-22	STKPLTKTPTLKRPRVQAEDQ	nucl(7),cyto(7),cyto_nucl(7),plas(6),cyto_mito(6),mito_nucl(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LWS7	Conserved oligomeric Golgi complex subunit 6	Low	7.5	1	551-570	EFTQRRTKRLRAKSDDAAKG	cyto_nucl(10),nucl(8.5),cyto(8.5),mito(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M8W7	CAP-Gly domain-containing protein	Low	9.3	2	9-36, 287-307	STVPHRPTTPKLRPRSSSRAIRRPNSAA, GDPSKRPQRMDRKPSHGPRSA	mito(17),nucl(7),cyto_nucl(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDW3	Serine/threonine protein kinase	Low	7.8	1	625-647	KKTLKMITRPRAHSNRSNRQLEA	nucl(7),mito(5),cyto_nucl(5),extr(4),cyto_mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHL0	BTB domain-containing protein	Low	9.3	1	29-49	SKDSGITKRRHESRHRRPTMT	nucl(17),cyto_nucl(12.5),cyto(6),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ML87	Adenosine kinase	Low	5	1	335-357	MHLANLPKKNTKRKRIAIVTQGT	mito(14.5),cyto_mito(11.333),cyto(7),cyto_nucl(4.333),extr(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MLX0	Uncharacterized protein	Low	5.7	1	34-56	FDPRWMTRESRKRKAQRNETAEP	mito(18),plas(4),nucl(2),cyto(2),cyto_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MLX8	Uncharacterized protein	Low	8	1	252-274	RQYLEHKEKDKRQRIRKKAAILE	plas(14),E.R.(6),vacu(3),golg(2)	KDKRQRIRKK (260-269, prob:0.752)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MX15	Zn(2)-C6 fungal-type domain-containing protein	Low	6.2	1	1-22	MPVGPFDRRKRRSRCLACAASH	mito(18),cyto(4),nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LA21	DNA repair protein RAD50	Low	9.4	1	1012-1033	IDNGDRKKKNIKDNLNYRKNLR	nucl(16),cyto_nucl(12),cyto(6),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LBN7	Ribosomal_L16 domain-containing protein	Low	8	1	62-81	EPNLNRKKKMAKGRPRVATG	mito(25)	RKKKMAKGRPR (67-77, prob:0.827)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LS93	CCT-epsilon	Low	5	1	20-43	RPFIVVRDQGKKKRQFGNEAVKSH	cyto(24.5),cyto_nucl(13.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LU03	Uncharacterized protein	Low	9.8	1	134-160	GNVKRYPVCAPRQKRKHMRPLDYKEGT	nucl(16.5),cyto_nucl(10),mito(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LY73	Uncharacterized protein	Low	9.3	1	425-444	KQSTTRKKFGIRLRERRTRG	nucl(16),cyto_nucl(11),mito(6),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7M6	HNHc domain-containing protein	Low	7.1	1	16-39	AISPSCKYYLRHLRKRYRETFVSG	cyto_nucl(9.833),nucl(8.5),cyto(8),cyto_pero(5.499),cysk(5),mito(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBR2	Uncharacterized protein	Low	5	1	727-751	TNAFTKPRPKVQEKGFQVKRPPRPS	plas(20),E.R.(4),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCA8	Uncharacterized protein	Low	9.4	1	33-54	GDNPQRPKRTVLPKKNTSPLSA	nucl(11),mito(8),cyto(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MF42	Uncharacterized protein	Low	8.6	1	10-29	YDNEKKKYFKIEKTHTAPSS	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MI81	Ima1_N domain-containing protein	Low	8.4	1	341-361	FSPPKQPKITRQKREEPKTFS	plas(17),mito(7),nucl(1),cyto(1),cyto_nucl(1),E.R.(1)	KSRGRKIS (158-165, prob:0.67)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMQ8	Zn(2)-C6 fungal-type domain-containing protein	Low	9	1	25-64	RDTDRIKSPRRGLKRISAACQRCRRRKQKCDGRHPVCGAC	nucl(14.5),cyto_nucl(11),cyto(6.5),mito(2),plas(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRY9	Uncharacterized protein	Low	6.4	1	303-326	WLNLMRGRRYVKKTQSRRRGYGAM	cyto(9.5),cyto_nucl(7.5),mito(6),nucl(4.5),pero(3),plas(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LJJ9	Glycine cleavage system H protein	Low	5	1	1-20	MGSRSPKINHHQHHHRHSYS	extr(12),mito(9),cyto(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2I4	Zn(2)-C6 fungal-type domain-containing protein	Low	9.1	1	104-123	CDETRPICERCKKGNRECVY	nucl(14.5),cyto_nucl(10),cyto(4.5),plas(4),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRN1	Zn(2)-C6 fungal-type domain-containing protein	Low	6.1	1	15-36	CLICKARKIKCDEGKPTCQRCI	plas(16),mito(5),nucl(3),extr(1),E.R.(1),golg(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NCG4	HET domain-containing protein	Low	7.7	1	27-54	HNGPSSKPGTWEKRKDPKQPSQAQWLMK	nucl(10),cyto_nucl(10),cyto(8),pero(5),mito(1),extr(1),golg(1),cysk(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LDY8	Uncharacterized protein	Low	8	1	73-97	IELTKAPQPLHRRKRRPSGLVGTAL	extr(15),mito(5),cyto(3),pero(1),E.R.(1),golg(1),vacu(1)	RRKRR (84-88, prob:0.679)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LHS4	Uncharacterized protein	Low	8.8	1	412-431	KFTHVKTKCRFNPCLNPNCA	nucl(15),cyto_nucl(11.333),cyto(5.5),cyto_mito(4.666),mito(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LNV3	Zn(2)-C6 fungal-type domain-containing protein	Low	9.9	2	2-28, 46-65	RTTIACERCRRSKVKCRHNDQPPCAGC, QSSGSKRPAKRQRLSVDLRQ	mito(12),nucl(8),cyto_mito(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCI2	MFS domain-containing protein	Low	5	1	478-497	LVYIRYQNHRRGRREVQEIC	plas(22),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIH8	Elongator complex protein 3	Low	5	1	55-76	LNSLRNKLAKKHKLQNIPPLTA	cysk(13),cyto(7),mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIK3	Zn(2)-C6 fungal-type domain-containing protein	Low	8.9	1	36-65	QIRSREGCLTCKRRKVKCDEQRPRCSHCER	mito(13),nucl(11),cyto(1),plas(1),pero(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMM1	Uncharacterized protein	Low	6.1	1	998-1019	GSKWSNKLSSWKLSRKSKTLKQ	mito(7),cyto(6.5),cyto_nucl(5.5),extr(4),golg(4),nucl(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MR60	Carnitine O-acetyltransferase	Low	7.3	1	145-167	VSYFYSHRDDRRRRDPAKRAAAI	mito(20),nucl(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N4I6	Galacturan 1,4-alpha-galacturonidase	Low	5	1	40-59	YELPVKRSHRKVYTIRHSKN	extr(20),vacu(3),mito(2),cyto(2),cyto_mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N7Q9	Zn(2)-C6 fungal-type domain-containing protein	Low	6.5	1	3-32	GVPGRSKACVTCRRRKKGCDKKVPFCGQCL	mito(12),cyto(5),nucl(4),plas(3),cyto_pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NEQ3	Uncharacterized protein	Low	5	1	6-25	IDRLRSKKSARSLNDKDKVL	mito(22),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7L8I6	Zn(2)-C6 fungal-type domain-containing protein	Low	7.5	1	10-53	LDSSSAPPTKKRTKKPFTRQQHGCLTCRQRRKKCDTRMPVCGDC	plas(11),nucl(7),mito(5),cyto(1),extr(1),pero(1),E.R.(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LK58	Uncharacterized protein	Low	6.8	1	54-76	EDEREQSRSICRRQCPKRTISSP	nucl(7),cyto(7),cyto_nucl(7),plas(6),cyto_mito(6),mito_nucl(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M398	Uncharacterized protein	Low	8	1	275-298	LIDHHVRKRRRARNPDWPRDRTRT	plas(24),E.R.(1),golg(1),vacu(1)	RKRRRARNPDWP (281-292, prob:0.821)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6D2	Uncharacterized protein	Low	5	1	246-267	GLTWMCLRKRRQRTASRPSASG	extr(23),mito(1),pero(1),E.R.(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKT0	54S ribosomal protein L4, mitochondrial	Low	5.8	1	33-56	YFSTTAPQCKRKTKDNNPKRGVSS	mito(21.5),cyto_mito(12.5),nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSQ7	Clr5 domain-containing protein	Low	9.4	1	62-82	FSKATKRWGFYKQPRQVKPDV	nucl(12),cyto(4),mito(3),pero(3),plas(2),golg(1),cysk(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVZ0	Uncharacterized protein	Low	5	1	23-47	SPAPGRHVSRSIKKRQVPQEHSHDI	extr(23),mito(2),cyto(2),cyto_mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N000	Zn(2)-C6 fungal-type domain-containing protein	Low	7.5	1	7-54	CFATLSSQSRRQPRRSKGCLTCRKRRVKCDEQRPTCQRCNKGFHPCKY	mito(13.5),mito_nucl(12.833),nucl(11),cyto_nucl(6.333)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NFH4	Zn(2)-C6 fungal-type domain-containing protein	Low	8.2	1	15-41	DSARRACDQCRTRKIRCDKDWPCSNCR	nucl(9),plas(7),cyto_nucl(7),cyto(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LGP8	Uncharacterized protein	Low	7.7	1	50-69	ETLCRSCRLVIRQRPTQPRI	nucl(8),cyto(8),cyto_nucl(8),mito(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LPZ7	Uncharacterized protein	Low	6.5	1	10-35	TENGTVPRSKKRTCARHCKRFWWVYL	plas(10),nucl(4),golg(4),mito(3),cyto_nucl(3),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5G7	Uncharacterized protein	Low	8.8	1	94-128	LVQKRRHGFLCRKRSKTGRKILLRRKIKGRRHIAQ	mito(22),mito_nucl(13.666),cyto_mito(12.166),nucl(4)	LCRKRSKTGRKILLRRKIKGRRHI (103-126, prob:0.986)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M9X9	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	2	4-29, 44-69	VPRSTGCRLCRTRKVKCDTLKPSCGN, LKFVDEKHQIRQRSRRQGKSQEVSTT	mito(12),nucl(4),cyto(4),cyto_nucl(4),plas(2),pero(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDI8	Sulfite reductase (Ferredoxin)	Low	6.4	1	1245-1267	LVQRDNGDRKNRKHARLKYTIDD	cyto(16),cyto_nucl(12.833),cyto_mito(9.499),nucl(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEG9	Uncharacterized protein	Low	6.5	1	239-260	VFFFLRRQKKKSKASDSSNYQQ	extr(11),mito(5),nucl(4),plas(2),pero(2),cyto(1),cysk(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MG76	Uncharacterized protein	Low	9.6	1	1-20	MSRKMPKVKLTKKHSQDVAK	mito(19),cyto_nucl(7),nucl(5)	RRGGHVAKKRVVP (218-230, prob:0.72)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHM0	Uncharacterized protein	Low	6.2	1	4-31	LFFASARKSYTRRQRAKKSPRAINYAIC	mito(15),cyto(5.5),cyto_nucl(5),nucl(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJM0	Uncharacterized protein	Low	5	1	35-54	PEELKHDKYREDRRGWRRIV	plas(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNY5	Zn(2)-C6 fungal-type domain-containing protein	Low	9.2	1	2-25	RQSLRRKSCSACARSKRRCSLSAP	mito(13),nucl(11),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPG2	Enhancer of mRNA-decapping protein 3	Low	9.5	1	171-201	IEGQTPRSAKKKNNNNRRSRQSKQGKGQRVE	cyto(8.5),cyto_nucl(7),mito(6),extr(5),nucl(4.5)	SAKKKNNNNRRSRQSKQ (178-194, prob:0.775)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVJ8	Uncharacterized protein	Low	8.6	1	248-276	VTEAKFKWPSNRWPKDKKHKELGVWNNEN	nucl(13.5),cyto_nucl(13.5),cyto(10.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LUE4	ANK_REP_REGION domain-containing protein	Low	9.2	1	87-113	LSIDGKVIPEKRRKKELRRYHVPQLEE	cyto(14.5),cyto_nucl(11),nucl(4.5),mito(4),pero(4)	KRRKKE (97-102, prob:0.76)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVN3	Peroxin/Ferlin domain-containing protein	Low	7.5	1	484-505	GQDGWGRWTRRRKWYRDAELVE	plas(13),nucl(7.5),cyto_nucl(6),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M446	Uncharacterized protein	Low	5.8	1	67-90	EQVMTIRKKKSEKPWPPHDRDVGV	cyto(14.5),cyto_mito(10),mito(4.5),extr(4),nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5G1	Methionine--tRNA ligase	Low	5	1	641-663	ERWRIEQLRLKKLREKKVAETKE	mito(23.5),cyto_mito(13)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MM97	D-lactate dehydrogenase (Cytochrome)	Low	5	1	34-60	TASQTKASKEQHQHRRQEQRKNPVFLA	mito(20.5),cyto_mito(13),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQU2	Uncharacterized protein	Low	8.1	1	406-428	RDEYCRNEHLKRFPNRQNQANFS	nucl(10.5),cyto_nucl(9.5),cyto(7.5),mito(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUQ2	HET domain-containing protein	Low	7	1	686-715	FESIRGREQLKRKQERRQRQKLSLPEENMW	cyto_nucl(7),nucl(6.5),cyto(6.5),cysk(6),mito(4),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZ56	Uncharacterized protein	Low	8	1	49-74	WLMFKIRKIKNKLKIRRRLKKDAAAA	mito(19),extr(4),cyto(2)	RKPRPRPLTRSAWLMFKIRKIKNKLKIRRRLKK (37-69, prob:0.986)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YBV5	Uncharacterized protein	Low	6.6	1	22-47	RPENLLKKASPRDYRRCQRIIRTSFT	cyto(9),cyto_nucl(8.333),cyto_mito(6.833),nucl(6.5),cysk(6),mito(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LIB9	TLC domain-containing protein	Low	8	1	58-78	LAPEHYSKLPRKRRLNWDAHV	plas(22),E.R.(4)	RRK (327-329, prob:0.626)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVR1	Aldehyde dehydrogenase (NAD+)	Low	5.8	1	67-89	ASATWKTTPPQQRRRLLNKLADL	cyto(21),cyto_nucl(13),nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LX46	Uncharacterized protein	Low	5	1	9-28	MNSPHPKRFIPLKKGKHSFP	mito(23),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2U0	Uncharacterized protein	Low	7.6	1	1213-1236	LTAENRKQMAKKRAERLRRQMFDD	mito(12.5),nucl(9),cyto_mito(9),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M8E3	Zn(2)-C6 fungal-type domain-containing protein	Low	7.4	1	1-45	MPRSKTSNFPRGKPRGIRRDRDCQTCKARGVKCDLNRPRCRPCVE	mito(7),nucl(6),plas(5),pero(3),cyto(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAQ7	Uncharacterized protein	Low	5	1	24-43	ELALKAPKKQLDKKIAQSLN	cyto(14),cyto_nucl(9),cysk(7),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ME55	HET domain-containing protein	Low	6.8	1	830-854	SMQRLTPLGRRKLRNFEKHMRNATQ	cyto(10.5),cyto_mito(9.5),mito(7.5),nucl(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MN58	Vesicle-associated membrane protein 7	Low	5	1	193-213	REFRVRSRGLKRKMWWKNVKL	mito(10),extr(4),cyto(3),plas(3),pero(3),golg(3),cyto_pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRI3	MFS domain-containing protein	Low	5	1	475-501	AWGLRFHLKHLNKKTRRDHPEVTNFYV	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N643	Uncharacterized protein	Low	7.6	1	96-119	LTKMSKKLSKTRNPLKSRFQPKQE	nucl(8),mito(8),mito_nucl(8),cyto(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LUX3	Uncharacterized protein	Low	5	1	28-59	RPNIKTPTSRPPPKISKTYKPKPQPPPFTSDS	mito(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M0U6	Fido domain-containing protein	Low	8.3	1	316-335	KKSVRSIQKLKQKVNGKKEA	nucl(11.5),cyto_nucl(10),cyto(7.5),mito(3),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M4N3	Uncharacterized protein	Low	9.1	1	6-27	WDRCWRCAKHLDGKPKWRASNN	nucl(14.5),cyto_nucl(10),mito(6),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKY6	Murein transglycosylase	Low	5	1	467-489	GDCCSRGGKCGRKAKQCECGCQN	extr(13),cyto(9),mito(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPJ9	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	21-49	VPEHKLSCDQCRQRKIKCDRENPCGPCQR	nucl(15.5),cyto_nucl(10),plas(6),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZZ4	Uncharacterized protein	Low	8.5	1	104-125	EAGRNGRYKHPQSRRLTRKMVS	nucl(12.5),cyto_nucl(9.5),cyto(5.5),mito(4),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LFE5	Ca2+-transporting ATPase	Low	5	1	1048-1070	ADELRKYLKYNKRRFGNDYSQAV	plas(20),E.R.(3),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7R1	MFS domain-containing protein	Low	8	1	555-582	QDRLDAKRAKYQKKLERKQQREAENAKT	plas(25)	KRAKYQKKLER (561-571, prob:0.679)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M905	Signal peptidase subunit 3	Low	8	1	204-224	SPKFQLPALKPKKKDGHKKSY	extr(16),golg(5),mito(3),vacu(2)	LKPKKKDGHKK (212-222, prob:0.846)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAG6	FAD-binding PCMH-type domain-containing protein	Low	5.8	1	429-448	RLQQIKKKWDPEQVFRNPQS	cyto(20),cyto_nucl(12.5),nucl(3),extr(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKQ5	Uncharacterized protein	Low	8.7	1	54-79	LEQKKRDLAQRKRHVSHKRRAVSQEK	extr(11),mito(8),plas(3),nucl(2),pero(1),E.R.(1),golg(1)	KKRDLEQKKRDLAQRKRHVSHKRRA (50-74, prob:0.896)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMB6	Uncharacterized protein	Low	5	1	524-546	MYFVGKRVREWARRRIWPKHHEE	plas(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVM5	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	1-34	MKPRRSHTKSRSGCRECKRRKVKCDERLPSCFNC	nucl(12),plas(9),mito(3),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LXQ6	T5orf172 domain-containing protein	Low	9.5	1	24-46	DTDVKKCHASTQKKARCQHPVSK	nucl(16.5),cyto_nucl(11),mito(5),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3I9	Uncharacterized protein	Low	5.4	1	281-306	AWATFLKHQRQKQKSNRPQRRGSNGV	plas(22),vacu(2),nucl(1),mito(1),E.R.(1),mito_nucl(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEA9	ANK_REP_REGION domain-containing protein	Low	5.6	1	343-367	KIEVMVRLRRQWRRKYTKLWPGPKA	cysk(17),pero(4),nucl(2),mito(2),cyto(2),cyto_nucl(2),cyto_mito(2),mito_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MGX7	Uncharacterized protein	Low	9.6	2	81-101, 435-455	EERALRKWSRDSKRDDVRWKL, IQRLARRSDSKDKKRQLEAIL	mito(16),nucl(7),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQF8	RRM domain-containing protein	Low	6.8	1	568-587	QYFRDEQRRRHSQYDRGTRL	cyto(10.5),cyto_nucl(10),nucl(6.5),mito(6),extr(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVC0	F-box domain-containing protein	Low	5	1	32-51	TCFYKRTKYYHPAHDPRAEE	plas(8),extr(6),mito(5),cyto(4),E.R.(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NFX9	HET domain-containing protein	Low	9	1	477-496	GSTIRRERRARNFLWRQSDN	nucl(13.5),cyto_nucl(10),cyto(5.5),mito(3),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVZ3	Uncharacterized protein	Low	5	1	24-45	VSGPRQPCYKLNHRFQHKKISA	cysk(17),cyto(7.5),cyto_nucl(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3J9	Palmitoyl-CoA hydrolase	Low	7.2	1	184-206	QDPNCKPQDRKSRQWMRSRQKIS	cyto(8.5),cyto_nucl(8.5),nucl(7.5),pero(6),mito(2),cysk(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRX5	Uncharacterized protein	Low	9.3	1	54-79	SQAPIVAPRKRRPQRIYRPAKNSLYD	nucl(13),cyto(8),cyto_mito(6),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTT5	Pectinesterase	Low	5	1	23-48	AKGPVDTYKKCQRQTKRATEGCPKGT	extr(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUP0	Uncharacterized protein	Low	6.4	1	136-160	YENQKTWHKIKKCIKHSKHKQLLED	cyto(10),cyto_nucl(8.5),nucl(5),E.R.(5),mito(3),extr(1),pero(1),golg(1),cysk(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVH8	Zn(2)-C6 fungal-type domain-containing protein	Low	8.1	1	2-36	ADTSPRVGFKRKRVAKACHKCRSMKSKCDGKWPEC	plas(15),nucl(8),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZX2	DUF2235 domain-containing protein	Low	6.4	1	34-54	DTNVVKILRKLDRNNKNQFHY	cyto(11.5),cyto_nucl(8.5),nucl(4.5),mito(4),E.R.(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVS7	Uncharacterized protein	Low	5	1	1-32	MSRSRNGCSTCKRRHRKCDETKPSCRECQKNN	plas(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M079	Zn(2)-C6 fungal-type domain-containing protein	Low	9	1	1-25	MQSTKPMRKRVSRACNLCRARKVRC	plas(15),nucl(10)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPC0	MFS domain-containing protein	Low	5	1	7-27	SETTREPSPYRGRRRSSSFSD	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQC3	Uncharacterized protein	Low	8.3	1	8-29	TGDLVKRSKRFIKNKFSFTQHS	nucl(12.5),cyto_nucl(11.5),cyto(9.5),mito(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQK0	ANK_REP_REGION domain-containing protein	Low	9.6	1	751-770	QKFLRDGKLKSIRRKLKILG	cyto(11),cyto_nucl(9.333),cyto_mito(8.833),nucl(6.5),mito(5.5)	LKSIRRKLK (759-767, prob:0.714)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRS8	INTRADIOL_DIOXYGENAS domain-containing protein	Low	8	1	63-87	ARRSAQVNKARQKRSLKKRDADTVL	extr(21),cyto_mito(3),mito(2.5),cyto(2.5)	IARRSAQVNKARQKRSLKKR (62-81, prob:0.812)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSN5	Uncharacterized protein	Low	5	1	102-131	VSIVWGKKYVKCKCRNKLAKHRQHRPIDIL	cysk(22),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTD5	Uncharacterized protein	Low	6.7	1	481-504	RNPSLTLKSKKPLRFKVRRVSEGS	cyto(14.5),cyto_nucl(11),nucl(6.5),mito(2),plas(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MU38	Uncharacterized protein	Low	7.8	1	35-61	DYDVHIMKKRTVRPRVRRSNVPTSSKE	nucl(9.5),cyto_nucl(9),cyto(7.5),mito(6),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUC6	NADH dehydrogenase	Low	8	1	57-82	ADEAPKPKPKPGKIRRTLRWTWRFTY	mito(22),cyto(4)	PKPKPKPGKIRR (61-72, prob:0.893)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YBV6	Uncharacterized protein	Low	5	1	98-117	WPTKWSKNTSKEAKKMKSFR	extr(20),cyto(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LLN9	Uncharacterized protein	Low	8.1	1	141-160	NQPTSSPPKQRNTRARHETE	nucl(8),cyto(4),plas(4),mito(3),cyto_pero(3),pero(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LT24	F-box domain-containing protein	Low	8	1	131-150	VDRRYREKHFPQKAAPRPAS	cyto_nucl(12),nucl(11.5),cyto(11.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2B4	Uncharacterized protein	Low	7.8	1	383-402	RGQPCWKKTKRDATPEPWCM	mito(9.5),nucl(9),cyto_mito(7.5),cyto(4.5),extr(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBF4	Uncharacterized protein	Low	8.3	1	1-25	MPSSPPYKSNKNQIKKDSIKQRLES	nucl(11.5),mito(10),cyto_nucl(8.5),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MF39	NodB homology domain-containing protein	Low	5	1	226-245	PAANWYKTTKRTKRDFEDDE	extr(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKR0	LDB19 domain-containing protein	Low	9.4	1	75-101	LRVHVVHKKPFKRTCKACKHQISELKR	nucl(14.5),cyto_nucl(8.5),mito(7),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MY41	FAD-binding FR-type domain-containing protein	Low	5	1	33-52	STYAFQRYNKYRQQDRNVLH	plas(22),extr(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5H6	Uncharacterized protein	Low	6.7	1	163-184	GQNEPRRQGRRESHRHDHDHDH	mito(9),cyto(7.5),cyto_nucl(7),nucl(5.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NDN5	Fatty acid hydroxylase domain-containing protein	Low	6.2	1	299-321	DHDLHHRKGYRKSHNYGKQTRVW	mito(8),plas(5),cyto(4.5),cyto_nucl(4.5),nucl(3.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NEZ0	Uncharacterized protein	Low	5	1	110-134	QDLRWWILSKRPRSRQKVKAILHVH	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LU26	ATP-dependent RNA helicase SUB2	Low	8.5	1	331-350	EERIRRYKEFKEFKKRICVA	nucl(13),cyto_nucl(13),cyto(11)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LUR4	DNA-(apurinic or apyrimidinic site) lyase	Low	9.5	1	309-353	EEKAEIKAPKKSRKKSPEAAEENVQPPKKKRTKATKKETNGDAIK	cyto(15.5),cyto_mito(9),nucl(5),cysk(4)	AEIKAPKKSRKKSPEAAEENVQPPKKKRTKATKK (312-345, prob:0.971)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAR4	Uncharacterized protein	Low	9.5	1	74-99	FIVVCCCRRPKQPKKRRSYRSTYADS	plas(9),mito(6),cyto(5.5),cyto_nucl(5.5),nucl(4.5)	PKQPKKRR (83-90, prob:0.73)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBT9	C2H2-type domain-containing protein	Low	9.9	1	1-21	MDRRKLYRYIKNRDRRSIITN	nucl(16.5),cyto_nucl(10.5),mito(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MF12	Potassium transport protein	Low	8	1	129-152	IVRTEREARKRRAALRRAKPLGRF	plas(21),E.R.(4)	REARKRRAALRRAKPLGR (134-151, prob:0.943)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQU8	ANK_REP_REGION domain-containing protein	Low	7.4	1	64-83	DKEEKFKWRRHDGSQIDKFR	nucl(8),cyto_nucl(8),mito(7),cyto(6),plas(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N462	Uncharacterized protein	Low	7.9	1	390-414	EYESRHPYWSSRRQRKPWQLPESYS	nucl(9),cyto(7.5),mito(7),cyto_pero(5.5),pero(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NA05	SHSP domain-containing protein	Low	8.4	1	26-51	LDQSIQQPQRKRQCQPQQKSRAQASS	nucl(16),cyto_nucl(10.833),mito_nucl(10.833),mito(4.5),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LPK9	TRP_N domain-containing protein	Low	8	1	614-639	INVLVKENPHRKRRKEMEKAKRDMDT	plas(14),extr(6),E.R.(4),mito(1),golg(1),vacu(1)	HRKRRKEMEKAK (623-634, prob:0.852)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LRD2	Uncharacterized protein	Low	8.4	1	134-154	VNSLEKPRMHTRPRRDNQLGT	nucl(12),mito(10),cyto_nucl(9),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVX7	ANK_REP_REGION domain-containing protein	Low	6.6	1	97-118	VEKYSRSRKVHDPKRYTDKVRW	extr(6),cyto_nucl(6),nucl(5),cyto(5),golg(4),pero(2),E.R.(2),cysk(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M9Q0	RNase_PH domain-containing protein	Low	5	1	85-105	FSSVDRKKRGRNDKRIQEIET	cyto(12),mito(9),cyto_nucl(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBC8	Uncharacterized protein	Low	5	1	463-485	IPGPDEKSKGPKKTPPKIEEMKD	extr(11),golg(9),mito(3),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MG47	Transporter MCH1	Low	5	1	23-46	ASSSDSSSRARRNKEKQALRLIAF	plas(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MH43	WD repeat-containing protein	Low	9.6	1	37-66	KKVMPTPQKKSTPTRSKTRTPAKREPAMPT	nucl(15.5),cyto_nucl(10),pero(5),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJW9	Uncharacterized protein	Low	5	1	365-387	LFSFIKNKIRGRKGKQLLDDRSD	plas(18),E.R.(6),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKS6	Fe2OG dioxygenase domain-containing protein	Low	5	1	289-311	GEFKEVMGKKWRRREGNEKSDDG	cyto(10.5),cyto_nucl(7),extr(6),mito(5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ML39	Abhydrolase_3 domain-containing protein	Low	5.8	1	107-128	ADPTRCKPSRGARKRCDVQENK	extr(10),cyto(7),E.R.(3),nucl(2),pero(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MX02	MFS domain-containing protein	Low	5	1	260-280	RSTNKMSKKQQFKKLFQKGVR	plas(22),vacu(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MXM0	Uncharacterized protein	Low	9.7	1	1-32	MEDAERKQRRKLQNRINQRARRNRMNNDDTIK	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ND01	Bifunctional cytochrome P450/NADPH--P450 reductase	Low	5	1	1-22	MAAKQKSKKHDEKHKGQIPGPK	mito(11),cyto(7),plas(4),cyto_nucl(4),cyto_pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NFP2	Uncharacterized protein	Low	7.2	1	2-21	TLNTRLKRKSLPSSPPKPSS	mito(16),mito_nucl(13),nucl(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LSL5	Uncharacterized protein	Low	6.7	1	35-54	HGRNCPCLPPKRKTAPRPET	cyto(13),cyto_nucl(10.5),nucl(6),extr(4),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LU23	Histone demethylase JARID1	Low	8.9	1	1041-1065	PIQEQSRSTRKPRPTKLQKMLVEYG	nucl(13.5),cyto_nucl(11),cyto(7.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEB6	Uncharacterized protein	Low	6.7	1	452-471	AHKHEAKKRRYLWWDRIWFF	mito(8),nucl(5.5),cyto_nucl(5.5),cyto(4.5),plas(3),golg(2),pero(1),E.R.(1),cysk(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFC1	Zn(2)-C6 fungal-type domain-containing protein	Low	6.7	1	55-79	DCQVPEITQRRKRGKSTRVAQLEKK	plas(9),cyto(6.5),cyto_nucl(6.5),nucl(5.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MH49	Glutamate synthase [NADPH]	Low	8	1	1605-1630	LDKTRGFKMYKRRQEKYRPVNSRLKD	nucl(10.5),cyto_nucl(10.5),cyto(9.5),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQU3	Aldehyde dehydrogenase (NAD+)	Low	5	1	62-81	RKAYKSWSKVPWEERKQKLF	cyto(18),cyto_nucl(10.5),pero(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUF8	50S ribosomal protein L34e	Low	7.1	1	1-20	MVNHRVTYRRRNGWNTRSNT	mito(12),cyto_nucl(8),nucl(7.5),cyto(7.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LGS9	Uncharacterized protein	Low	8.3	1	135-156	EENKIDNRKKVERKDENRDSNE	nucl(13.5),cyto_nucl(13.5),mito(7),cyto(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LY89	Delta24(24(1))-sterol reductase	Low	5	1	21-42	VETPIRRSRSNRRQTSQPLSDV	plas(15),mito(8),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2T3	Uncharacterized protein	Low	6.1	1	126-145	VFATKPYEEHRKKRKYTSAF	extr(12),cyto(6),nucl(3),plas(3),pero(2),mito_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQW9	Uncharacterized protein	Low	6.8	1	58-77	SKLPHLRIIQFRRKLRRAFC	plas(15),nucl(5.5),cyto_nucl(3.5),pero(3),mito(1),cysk(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MXJ4	Uncharacterized protein	Low	5	1	44-66	FGPLTPEKEKKLRRKLYWHVMGL	plas(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MYA0	BTB domain-containing protein	Low	9.3	1	1-21	MAPPRKKPRTRVSPKEDPADE	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N089	Uncharacterized protein	Low	8	1	220-243	GPQFHDSRKKRNGKPLRQSRQPYY	plas(18),mito(3),vacu(3),E.R.(2),mito_nucl(2)	KKRN (228-231, prob:0.629)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LKN8	Uncharacterized protein	Low	5	1	99-121	NWCNMPHARKREYKKAPKDYELQ	extr(16),golg(4),mito(3),plas(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LLA2	Propionyl-CoA carboxylase beta chain	Low	8	1	81-102	GPEKARQKHIARKKMLPRDRVT	mito(20),cyto(4),plas(1),pero(1),E.R.(1)	EKARQKHIARKK (83-94, prob:0.742)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LXP2	Phospholipid-transporting ATPase	Low	5.7	1	1306-1331	MEQFQKAIRKVRQVQRMRKQRGYAFS	plas(22),nucl(2),pero(1),E.R.(1),golg(1),mito_nucl(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MF52	Uncharacterized protein	Low	9.1	1	1-23	MMKSRRTQRSKSLPNNQSPKRSL	nucl(13.5),mito(11),cyto_nucl(8.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MP29	Uncharacterized protein	Low	5	1	387-406	AMSRKPIWIHGRKKYPEKET	extr(13),golg(7),E.R.(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQB3	Uncharacterized protein	Low	9.2	1	269-294	YASGAKDTSGRRRRRRPPSTSTSSSS	plas(17),nucl(3),mito(3),mito_nucl(3)	RRRRRRP (279-285, prob:0.791)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZR9	Pseudouridylate synthase	Low	8	1	88-118	QAATNNNKQQNQRRPKQKKKQDPPKVSESDE	mito(20.5),mito_nucl(12),cyto(3)	RRPKQKKK (100-107, prob:0.725)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LUD4	Uncharacterized protein	Low	8.8	1	70-105	IFYQAEKERKVKKPKVTNEEKRLRRFRPKPPQSFHE	mito(21),cyto_mito(13),nucl(3),cyto(3)	KERKVKKPKVTNEEKRLRRFRPKP (76-99, prob:0.929)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LWV5	Uncharacterized protein	Low	6.8	1	171-195	IIKACDSCKKKKIRCDPSHKKRGVS	extr(9),cyto(6.5),cyto_nucl(6.5),nucl(5.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LXT1	Mannosyl-oligosaccharide glucosidase	Low	6.9	1	737-758	QEGPYRGKAKDLFRRLRKNLVD	extr(9),nucl(5.5),cyto_nucl(4.5),mito(4),pero(4),cyto(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M0A8	Uncharacterized protein	Low	7.3	1	310-332	EESKRHSSVQKQRARQRRQQVVE	mito(16),nucl(6),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5V6	Protein kinase domain-containing protein	Low	6.7	1	512-536	LYRHPNAQSNRRRDRERSKKSFDIY	cyto(7.5),cyto_nucl(7),nucl(5.5),E.R.(4),extr(3),vacu(3),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MGU7	Hsp90 chaperone protein kinase-targeting subunit	Low	8.2	1	25-46	VDKRSFIRAKQNQIHQERQQRK	nucl(13),cyto_nucl(12.333),cyto(9.5),cyto_pero(6.166)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHT2	Adenylyl cyclase-associated protein	Low	9	1	362-386	KSPAPGKKPKPESMRIKKPAKKELE	mito(12.5),cyto(10),mito_nucl(9.166),cyto_nucl(8.333),nucl(4.5)	RGKSPAPGKKPKPESMRIKKPAKK (360-383, prob:0.982)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJE3	Dynamin GTPase	Low	5.8	1	896-918	GRDREKGNSGSRRDRKQSRWGLF	mito(19),cyto(5),nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ML50	Uncharacterized protein	Low	7.5	1	585-604	ILVFRCLSRRARRRIALENV	plas(12),nucl(7.5),cyto_nucl(6.5),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LBC1	Uncharacterized protein	Low	5	1	258-284	FTICCCKPESRSRDKKNRRSDGEKLLG	extr(14),plas(10),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LL02	Uncharacterized protein	Low	7.7	1	107-138	AERRRNINTHQDRKHARRCRLHIRQARVQRII	cyto_nucl(11.833),nucl(11.5),cyto(9),cyto_mito(6.999),mito(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LNB4	MR_MLE domain-containing protein	Low	5	1	41-62	ISTPASKWEKYKKSRTSWGINV	cyto(10),mito(8),extr(4),mito_nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M4A0	Uncharacterized protein	Low	5	1	109-133	SRLEAPSYKKPPRSKQRLNPPLFTK	mito(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M693	Uncharacterized protein	Low	8.8	1	270-293	EELWREIKEKARKELRKFLPRLSK	mito(8),plas(4),pero(4),E.R.(3),nucl(2),golg(2),vacu(2)	KEKARKELRKFLPRLSK (277-293, prob:0.766)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAP5	Uncharacterized protein	Low	7.3	1	649-674	SFRCLKLLFKHLKDRRRRLRDLSLAI	nucl(6),mito(5),cyto(5),extr(5),cyto_mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBS2	Uncharacterized protein	Low	8.3	1	6-33	QKANLARIRDNQRRSRARRREYLQELEQ	mito_nucl(11.166),nucl(11),mito(11)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MM14	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	11-44	RAFSRKTRTGCLTCKKRHKKCDEEKPTCRRCRDG	nucl(16.5),cyto_nucl(11),cyto(4.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWU4	Zn(2)-C6 fungal-type domain-containing protein	Low	5.4	1	10-35	KTPACDYCRSKKLRCSKDRPICMSCA	plas(22),E.R.(2),nucl(1),cyto(1),cyto_nucl(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N442	Zn(2)-C6 fungal-type domain-containing protein	Low	9.2	2	10-29, 50-81	RSSCDRCRSHKLKCTVSPED, GPRSQSKRTASSKSKPDKSKPENEPPHKSSPP	mito(18),nucl(6.5),cyto_nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N4R5	Uncharacterized protein	Low	5	1	501-524	LGFVSFAWRRKHKRNEIFVVEKKP	plas(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YBI7	Uncharacterized protein	Low	7.7	1	1-22	MDYGPRPPNRPKMEKWWNEHCE	nucl(10.5),cyto_nucl(9.333),mito(7),cyto(7),cyto_pero(5.333)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LQ89	Uncharacterized protein	Low	8.8	1	216-236	QGKPRKPKDSDDKEDKRQRRI	nucl(14.5),cyto_nucl(12),cyto(8.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTR5	Zn(2)-C6 fungal-type domain-containing protein	Low	9	1	8-35	KSCFACVETKRRCDKRYPSCSRCQDRES	mito(11),nucl(10),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQW4	Abhydrolase_3 domain-containing protein	Low	7.8	1	359-383	TESMRSMRLKRPVLKRPKYLSFKTW	nucl(9.5),pero(9),cyto_nucl(8.5),cyto(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTJ8	Uncharacterized protein	Low	5	1	269-291	NFNSCQKIGTRNKEKPPERDKYF	mito(21.5),cyto_mito(13.5),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUS6	Eukaryotic translation initiation factor 3 subunit M	Low	8.5	1	411-438	VSGNQDGGRRRQNQNREPREPREPREPR	nucl(13.5),cyto_nucl(9.833),cyto(5),cyto_mito(4.333),cysk(3),mito(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NCS1	Uncharacterized protein	Low	9.6	1	383-406	VVETLREKKIRRKIRDSNTYSSFP	nucl(18.5),cyto_nucl(12.333),cyto(5),cyto_mito(4.333)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LPS6	Uncharacterized protein	Low	8	1	98-126	SRNGNARGLKPKKGRKKPDKGANGKPRAV	plas(16),mito(3),E.R.(3),extr(2),mito_nucl(2)	GNARGLKPKKGRKKPDKGANGKPRA (101-125, prob:0.996)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M9P4	Uncharacterized protein	Low	5.8	1	327-348	AEEEAKRWKRDRKVFYRYGQED	cyto(7.5),mito(6),cyto_nucl(5.5),E.R.(4),golg(4),nucl(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MER3	Adenosine deaminase	Low	7.4	1	42-61	TPELRWKLAKRNNQTLKLER	cyto(8),nucl(6),cysk(6),pero(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQE7	Uncharacterized protein	Low	9.4	1	73-92	ETTKSSKRVRHTYGGRQVTK	nucl(11),cyto(5),mito(4),plas(3),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MW57	Uncharacterized protein	Low	9.1	1	1788-1807	ATRLMNRKRLIRQNDKRVME	nucl(11),mito(7),cyto(6),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MYS7	Uncharacterized protein	Low	5	1	480-500	LVMRWVFDRRNKKRDAEKAAL	plas(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LG45	Uncharacterized protein	Low	5	1	10-30	GKPGRIAKPLKQSPPSRQRSD	mito(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LH27	BSD domain-containing protein	Low	9.9	1	410-429	QTPNSPKDPKDAKKKEESSD	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LM71	Uncharacterized protein	Low	8.2	1	107-128	EEGHMRKNCEKPRKINRDHIAD	nucl(11),cyto_nucl(10.5),cyto(8),pero(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LY92	Uncharacterized protein	Low	7.8	1	2-27	VKKTGPSKKTAPPKQNSSSKQSSKKS	mito(13),nucl(9),cyto_nucl(7),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZW9	Uncharacterized protein	Low	5.8	1	105-124	MSLRPEKRSRPLKPKSTSVF	mito(18.5),cyto_mito(11.5),cyto(3.5),nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M271	Uncharacterized protein	Low	7.5	1	295-320	TEEEKMAKERFRKRLQKRYQELGYGC	cyto(12.5),cyto_nucl(12.5),nucl(9.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCZ5	Uncharacterized protein	Low	7	1	31-55	RSLSQTKSNRDDKPRRAPSRPSTAS	mito(16.5),mito_nucl(13.333),nucl(9),cyto_nucl(5.333)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ME22	Uncharacterized protein	Low	8	1	309-328	TKAFESRRLKKMKVKLLRKK	plas(23),mito(3)	RRLKKMKVKLLRKK (315-328, prob:0.931)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMK8	Uncharacterized protein	Low	7.5	1	136-163	FEPTKTRGTCVKKKLKRAKVTRTQVSRS	nucl(7),mito(5),cyto(5),cyto_mito(5),plas(3),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N1I7	Phospholipase C	Low	5.8	1	623-642	LARGRKEKLGWQKNQTFWKV	extr(18),cyto_nucl(3.333),cyto(3),cyto_mito(2.833),nucl(2.5),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LKY6	ANK_REP_REGION domain-containing protein	Low	7.6	1	1094-1116	LDMAERGRRKHQMRRDSDRIIQE	plas(9),nucl(7),cyto(4),mito_nucl(4),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LM89	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	37-61	VSAACEECRKRKSKCNVPRPCEPCV	nucl(15.5),cyto_nucl(11),cyto(5.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LS01	Uncharacterized protein	Low	8	1	187-210	KTEMREGYRKIKKIKPPQDGPSTA	plas(19),E.R.(4),mito(1),pero(1),golg(1),vacu(1)	K (198-198, prob:0.602)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M775	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	Low	9.1	1	671-694	MSEFVIKGRKEKKHLPDREPDFGP	nucl(11),cyto(9),pero(4),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCR2	Uncharacterized protein	Low	5	1	30-49	IFRCHIHRTCHRRWRIDDFY	plas(24),mito(1),E.R.(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJI5	Serine palmitoyltransferase	Low	5	1	668-687	VDPKNEKEWRKENRIPLQAP	mito(11),extr(10),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKS3	Uncharacterized protein	Low	9.4	1	52-74	FMPMNRRLRCRDIKLRRSCARSA	nucl(16.5),cyto_nucl(13.5),cyto(7.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LMM1	Uncharacterized protein	Low	9.9	1	97-123	KGYYESRSMRKTRRARRARNGGRTDVV	cyto(13.5),cyto_nucl(10.5),nucl(6.5),mito(4)	RKTRRARRARN (106-116, prob:0.822)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LX99	Regulator-nonsense transcripts 1	Low	7.3	1	887-908	LLQFSRPKVSYRQKNQQPQFGA	cyto_nucl(13.333),cyto(13),nucl(10.5),cyto_mito(7.999)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M789	Uncharacterized protein	Low	5	1	55-79	ASPSVHAPSKPKKKVIKTSQLHFLL	extr(11),golg(7),mito(3),E.R.(3),vacu(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAY8	Uncharacterized protein	Low	6.1	1	34-57	VKSGCCPRAPSKRLRRSAREIFAR	extr(19),nucl(3),cyto(3),cyto_nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBV9	Uncharacterized protein	Low	7.3	1	18-38	AQTPSKKSKEIQRLVRSRARS	plas(13),nucl(6),mito(4),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ML95	Uncharacterized protein	Low	8.7	2	861-880, 1239-1265	SPPLRLSKSRTRHNHKLHLP, ATPTSRATARRLRRTRQRLGSYRHDLL	cyto(7.5),mito(7),cyto_nucl(7),nucl(5.5),plas(3),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N2Q4	MFS domain-containing protein	Low	8	1	468-491	MFLNKMQERKRVKNGKPAKIRDLS	plas(27)	KRVKNGK (477-483, prob:0.626)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NCP9	AB hydrolase-1 domain-containing protein	Low	5	1	426-447	KVKLNKGCKKTVIKPVTKNFGL	extr(21),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LQA5	Uncharacterized protein	Low	5.3	1	221-248	EYSSSPYEPRRRRVQTRANYPARQNRIY	plas(23),nucl(1),mito(1),cyto(1),cyto_nucl(1),E.R.(1),cyto_mito(1),mito_nucl(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LQT4	Uncharacterized protein	Low	7.7	1	23-45	TAVGCFLYRRSRQRRFLFMNRGI	mito(13),nucl(7),cyto(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LS90	Uncharacterized protein	Low	5	1	513-537	GTASRPCETMKKPCRSKRIHPITIA	plas(20),E.R.(3),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPB9	Uncharacterized protein	Low	9	1	27-47	LIPLRRLNKAKSKPDVRSDHA	nucl(13.5),mito(12),cyto_nucl(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MYS4	Uncharacterized protein	Low	9.9	1	60-91	RPKGLRKGDRHKVEKKPQKPQKRLRLWVRVSE	mito(14.5),mito_nucl(11.999),nucl(8),cyto_nucl(7.333)	RVRERPKGLRKGDRHKVEKKPQKPQKRLR (56-84, prob:0.986)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N4Z5	Alcohol dehydrogenase	Low	6.1	1	263-285	GRLTGKYTKDKPPPKSRRFSSYK	cyto(12.5),cyto_mito(11),mito(8.5),nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N787	CFEM domain-containing protein	Low	8	1	559-582	EGFGDGRRTKKKRAMTEASRILRS	plas(25)	RRTKKKR (565-571, prob:0.714)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N8B9	Rav1p_C domain-containing protein	Low	7.2	1	1281-1300	SPTLKFDSHRENKKTVKPPP	mito(9),nucl(7.5),cyto_nucl(7.5),cyto(6.5),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NG40	TKL protein kinase	Low	6.2	1	79-103	GSTFTVRRHRLSRRIHAHNRRLVPG	cyto(10.5),cyto_nucl(8.833),cysk(7),cyto_mito(6.666),nucl(5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7L9P0	CAMK/CAMK1/CAMK1-RCK protein kinase	Low	6.7	1	63-83	DDYSRSKSKKRVDDEKLAKLI	mito(10),pero(6),nucl(5.5),cyto_nucl(5.5),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LIA9	DNA mismatch repair protein MSH5	Low	9.3	1	10-29	SSSSRRGRGRGGRGWRGRTY	mito(21),nucl(3.5),cyto_nucl(3)	RRGRGRGGRGWRGRTY (14-29, prob:0.889)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LNS7	Uncharacterized protein	Low	9.1	1	120-142	GICKIQRLPKPKHPRPNHGPLVK	mito(20),nucl(3),cyto(2.5),cyto_pero(2.5)	PKHPR (130-134, prob:0.622)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LUD0	Zn(2)-C6 fungal-type domain-containing protein	Low	8.6	1	1-31	MMKRRTHNKSRHGCRNCKKRHVKCDEGGPPC	nucl(9),plas(8),mito_nucl(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVV1	Syntaxin 1B/2/3	Low	8	1	278-297	VAVNTARKTRKKKWICLGIC	plas(9),nucl(8),cyto(5),mito_nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LXW6	ACB domain-containing protein	Low	7.2	1	258-278	VVLLWLRKRKDRRLEDLVRAA	mito(10),cyto(7),nucl(6),plas(1),extr(1),pero(1),golg(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZG6	Uncharacterized protein	Low	9.9	1	407-433	AKAQKRYLEKEREKEMRRSQKRQTQRA	cyto(9.5),cyto_nucl(8.5),nucl(6.5),mito(4),E.R.(3),pero(2)	REKARKAKRDAELKGLDAKAQKRYLEKEREKEMRRSQKRQ (390-429, prob:0.916)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M8M5	MFS domain-containing protein	Low	5	1	528-549	ADAKWASIKEEKRRARNNPMVA	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M9X0	[RNA-polymerase]-subunit kinase	Low	6.4	1	356-377	EHPWWHSEPKPTRKQDLPRKGG	mito(15),cyto_nucl(6.333),cyto(5.5),nucl(5),cyto_pero(4.166)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MI15	Carboxylic ester hydrolase	Low	5	1	76-99	DPPTGSLRLKPPKKLSKPLGNFDA	extr(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJT6	CN hydrolase domain-containing protein	Low	9.5	1	811-833	LHSRTSQHRSRGRQSRTRRTSSG	nucl(19.5),cyto_nucl(13.333),cyto(6),cyto_mito(4.333)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTZ5	Uncharacterized protein	Low	5	1	169-205	HSSRRSYHSSRHSHRSRSRSGSRYSSRSRPHSRRVYV	plas(19),E.R.(5),mito(1),golg(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N6A8	NACHT domain-containing protein	Low	6.6	1	86-107	LQPSNIKKDTRRSLKKLCLVLT	cyto(10),nucl(4),mito(3),extr(3),E.R.(3),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LN96	CFEM domain-containing protein	Low	5	1	236-256	IAGFFFWKKRQNQRDLPRENM	extr(23),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LU50	Uncharacterized protein	Low	9.2	1	1-25	MSPAATRRARSRPQVKRQRIEEDDE	nucl(14.5),cyto_nucl(9.5),mito(7),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MC29	Uncharacterized protein	Low	5	1	33-52	TQTLKRINRVKRPLNSVPQH	mito(11),extr(10),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MGK2	Glycogen [starch] synthase	Low	6.9	1	560-584	FMYDFCGKSRRQRINQRNRTERLSD	cyto(11),cyto_nucl(10),nucl(7),mito(5),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ML94	Altered inheritance of mitochondria protein 6	Low	5.8	1	36-57	LPQCEQQTSRARQRRVRFWPAT	plas(18),mito(5),nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWD5	Uncharacterized protein	Low	5	1	76-99	HITKTNFAKRRQRLGQQKKLSNAD	mito(22),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MYL0	DNA repair protein RAD5	Low	9.5	1	130-151	DGTYKKFVKKPSWKAPLRPAST	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZD8	Peptidase A1 domain-containing protein	Low	5	1	494-513	GIFFWRRRRRAQGQQSETQP	extr(19),plas(5),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N008	Uncharacterized protein	Low	5	1	260-282	VSNFKPKTTKVQKPKTKATKVAK	extr(12),mito(9),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N234	Cu2+-exporting ATPase	Low	8	1	164-192	TCCMSTRTTPTKKHRSKHAKKKAAPVIPA	plas(23),E.R.(3)	KKHRSKHAKKKAAP (175-188, prob:0.938)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5A0	Uncharacterized protein	Low	5	1	75-94	PSEHKETHPKPPQPSKPAPT	plas(13),cyto(5.5),cyto_nucl(3.5),mito(3),golg(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NGC7	Uncharacterized protein	Low	6.1	1	31-50	ADKWKEAKARFWKKDPRLSE	cysk(17),nucl(3),cyto(2),pero(2),mito_nucl(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LG13	Uncharacterized protein	Low	5	1	23-45	KGENPILPRKRRRIVRSCRGSNG	plas(9),mito(7),extr(4),cyto(3),vacu(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVP8	ERF-3	Low	6.1	1	630-656	ALLHKLQKGTNRKSKNPPTHAKKGDSI	cyto(15),cyto_nucl(10.5),pero(6),nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LW18	Uncharacterized protein	Low	5	1	1-20	MTARARRPQNKPARPPLTIK	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1V3	Uncharacterized protein	Low	8.9	1	36-59	RYSYYDPNQKSRPKPRIMQFQDAA	plas(20),cyto_nucl(3),nucl(2.5),cyto(2.5)	KRRKA (168-172, prob:0.666)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2W7	Uncharacterized protein	Low	8.4	1	320-346	PNDPEDKRKKPSGKKPQRPGHKRTTSA	plas(24),nucl(1),E.R.(1),golg(1)	KRKKPSGKKPQRPGHKR (326-342, prob:0.975)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDM1	Ca2+:H+ antiporter	Low	8	1	139-161	NIDLEKRKLKKRESTKIFRKVEP	plas(27)	KRKLKKRESTKIFR (144-157, prob:0.828)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJH2	Uncharacterized protein	Low	5	1	657-678	MDAQSKSSSRKQPRPRGPSSYN	plas(19),E.R.(4),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MW70	Uncharacterized protein	Low	5.6	1	156-176	VALCLRKQGHWKSKTYRRYGG	mito(16.5),cyto_mito(11.5),cyto(5.5),nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N2D9	Uncharacterized protein	Low	6.9	1	638-661	NWVWTGRLTRPKRHDKYPALAKVP	mito(11),cyto(10),nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYT1	Mannan polymerase complexes MNN9 subunit	Low	5	1	58-77	TSPYRKSKSRSGVPLKPPPV	mito(7),plas(6),golg(5),extr(4),E.R.(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M4W8	Uncharacterized protein	Low	5	1	41-60	AKAIRQTRSAWNRRKRVTSY	plas(18),E.R.(5),mito(1),pero(1),golg(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M897	Uncharacterized protein	Low	5	1	62-88	IGNFCCRTKKCCKKECCKNTARYCSAD	extr(16),cyto(5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M8M0	Mitochondrial intermediate peptidase	Low	5.8	1	9-32	LWICNRCVRHTAKPPQRRWNSITS	mito(24),nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAH9	Peptide hydrolase	Low	5	1	467-487	FEQWQKKKTLASNAHKCNHKT	cyto(11),extr(9),vacu(3),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJN4	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	1-36	MPEQQSRQRRRKVTLACDPCRERKSRCDGIKPICST	nucl(11),plas(11),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPI5	Global transcription regulator sge1	Low	9.5	1	32-51	QLLHVPRRPHDRERQNVIKS	mito(9),extr(7),nucl(4),plas(4),cyto(2)	PGEKKRAKGKGGK (94-106, prob:0.915)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRD9	E3 ubiquitin-protein ligase synoviolin	Low	5	1	206-225	QEAQKRKRLAERRQEVRQER	plas(17),E.R.(3),mito(2.5),cyto_mito(2.5),extr(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LWK3	DBR1 domain-containing protein	Low	9.6	1	495-514	TDTERRQRKAQGPPKTDQRF	cyto(15),cyto_nucl(12.5),nucl(6),mito(3)	RQRKAQGPPKTDQRFSGGGRGRGGGRGGRGRGRGQGRGRGGRW (500-542, prob:0.995)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCV5	Carboxypeptidase	Low	5	1	48-67	QPAFEKRSKSKFLNKHSEKF	extr(21),mito(3),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFC9	Uncharacterized protein	Low	5	1	29-53	PPLPTKTRFTHNRPDRKVNRPPLRD	extr(8),cyto(5),E.R.(4),cyto_mito(4),cyto_pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIF8	Carrier domain-containing protein	Low	8	1	519-544	APPSPRSPRPVEKKKKEHNIKVKTET	cyto(14),plas(7),cyto_mito(7)	PSPRSPRPVEKKKKEH (521-536, prob:0.874)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJ45	Elongation factor 3	Low	9.7	1	1018-1051	VTTKKKVKLSSSEARKKKKERMARRKRGEEVFSD	cyto(18.5),cyto_nucl(13),nucl(6.5)	KKKVKLSSSEARKKKKERMARRKRG (1021-1045, prob:0.995)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJB9	Signal sequence receptor subunit alpha	Low	8	1	194-216	EALFPQAKRPRTNKKAKKTIDVA	extr(13),E.R.(6),cyto(5),vacu(2)	KRPRTNKKAK (201-210, prob:0.716)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNB2	Uncharacterized protein	Low	6.6	1	371-391	LDHNKRFQANRTPRRREYHSG	plas(16),mito(5),nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0E7	Uncharacterized protein	Low	5.7	1	230-255	LITMCYRDKSKQRRQEEMRRVRSVKV	extr(13),mito(6),pero(3),nucl(2),plas(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NHP8	Uncharacterized protein	Low	7.1	1	203-222	CSTYYRTSLRRVRRNFRDDI	cyto(12),cyto_nucl(11),nucl(8),mito(3),E.R.(1),golg(1),cysk(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LFI8	Cellulase domain-containing protein	Low	8.3	1	37-81	DQDLGPTKKTRRRVRFADSEKPITQRRPWIRTRTRRCSCLRSPSS	nucl(11),plas(8),cyto_nucl(7.5),pero(3),mito(2),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LS18	Uncharacterized protein	Low	5	1	483-504	GAISIKSRRVGRKKMIAECYKP	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYS7	Uncharacterized protein	Low	7	2	3-23, 650-673	NSTSMAGPRRQRQQRMASGES, GTQLQSDKCKKNPKVKADPNAECL	plas(18),pero(3),extr(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M480	Uncharacterized protein	Low	8.8	1	1-23	MAPIRTRKQVRFRDQYERPKSKA	nucl(13.5),cyto_nucl(10),mito(7),cyto(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ME70	Uncharacterized protein	Low	5.8	1	649-670	RSSYPRCCHPHPMKKPILKDGK	cysk(17),cyto(7),nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MLH8	Uncharacterized protein	Low	8	1	462-487	MVAPRLESWRRKRKEAESKLKLKAKL	mito(7),cyto(7),cyto_mito(7),pero(5)	WRRKRKEAESKLKLKAKL (470-487, prob:0.927)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N104	Fungal_trans domain-containing protein	Low	8.6	1	186-211	FQAPGSSISRKKRNKRLWWSLFWRDR	nucl(9),cyto(8),mito(3),plas(3),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LE05	Transcription elongation factor S-II	Low	9.6	1	267-287	SLECGRCKKKQVSYTQAQTRA	nucl(18),cyto_nucl(12),mito(5),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LMG2	Ubiquinone biosynthesis protein COQ4, mitochondrial	Low	8	1	264-291	EQPPDMRDIRKREREEKKRLKELREQGL	mito(21.5),cyto_mito(13),cyto(3.5)	RKREREEKKRLKE (273-285, prob:0.847)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LSW2	GFO_IDH_MocA domain-containing protein	Low	9.7	2	282-304, 323-344	DMSLPKGQTKWKRRKLSFSNFLI, TNEKDLKKWTIKQYKKIYTFKD	nucl(9),mito(8.5),cyto_mito(7.5),cyto(5.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LY99	Uncharacterized protein	Low	8.6	1	70-91	MLPSHQKKPLPLRRRIAKVYPY	nucl(13),cyto_nucl(9),plas(4),mito(3),cyto(3),pero(1),golg(1),cysk(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M0R0	Uncharacterized protein	Low	9.5	1	462-481	FPDTCPTCQRTRKFFHNCHV	nucl(16.5),cyto_nucl(10.5),cyto(3.5),mito(3),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCN1	Uncharacterized protein	Low	5	1	8-31	VQRPTPRSKVLHQTKTKQNHVAKT	mito(20),plas(4),cyto(1),pero(1),E.R.(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFU0	Ca2+:H+ antiporter	Low	8.3	1	98-123	GPERMRSATRLRKPPMPRRPSSNTPY	plas(24),nucl(1),mito(1),cyto(1),cyto_nucl(1),cyto_mito(1),mito_nucl(1)	RPARGPERMRSATRLRKPPMPRR (94-116, prob:0.842)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MLB3	ADP-ribose 1''-phosphate phosphatase	Low	6.7	1	510-529	EAKWKAWKSRVLREKKNVVI	mito(14),cyto(6.5),cyto_nucl(6.5),nucl(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MN50	Formyl_trans_C domain-containing protein	Low	6.2	1	647-670	SERYNTRRRDFVRKVKPTQSPLRF	plas(8),mito(6),cyto(5),nucl(3),cyto_pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZV2	Indoleamine 2,3-dioxygenase	Low	5	1	431-451	EEWTRRFMKRKMQTEGRNDFF	cyto(13),cysk(11),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N207	FAD_binding_3 domain-containing protein	Low	5	1	405-428	AEKRGFVPWTRKTRKSDDKTKARL	extr(10),plas(7),pero(4),mito(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYM7	TPT domain-containing protein	Low	8	1	181-210	DEETGLTRKDKQRRQKKRSRNTQLDQRIVR	plas(23),E.R.(2)	KDKQRRQKKRSR (189-200, prob:0.838)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M691	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial	Low	8	1	62-94	QPVPLRKQLKDEAKKAKKQGKKKPKGDSQTVHG	mito(23),cyto(2),pero(2),cyto_pero(2)	KQLKDEAKKAKKQGKKKPK (68-86, prob:0.985)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7Y4	Uncharacterized protein	Low	9.8	1	117-136	NRHLCPSSPTKQKWKFWKKD	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDV3	Uncharacterized protein	Low	9.1	1	35-57	ACDICKTRSKENKATLEKRRKIY	nucl(14.5),cyto_nucl(10.5),cyto(5.5),cysk(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ME08	C4-hydroxylase	Low	8	1	348-373	LLDTKYRGSKTNKPSQRKAKAAGKAQ	plas(16),E.R.(5),mito(4)	KPSQRKAKAAGK (360-371, prob:0.743)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUM9	UDP-glucose 6-dehydrogenase	Low	6.1	1	478-497	QSKTIGRKPNPKADPRPFES	mito(12.5),cyto_mito(11),cyto(8.5),nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWU3	Uncharacterized protein	Low	5	1	29-48	GDTKDKQPNIRQQRATQPPF	plas(23),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0F8	ANK_REP_REGION domain-containing protein	Low	8.8	1	50-78	QQRTSDPNYKPPDRQKRHLFRSKEQKAEA	nucl(14.5),cyto_nucl(13),cyto(10.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N7C5	Zn(2)-C6 fungal-type domain-containing protein	Low	7.2	1	67-108	GQNAANKKPKTKSFKTRTGCKECKRRKVKCDEGKPICNRCKA	mito(9),nucl(6),cyto(6),cyto_nucl(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LB04	Uncharacterized protein	Low	9.3	1	270-294	SKLSTRARTLSQRRRNNIRNRGEGH	nucl(16),cyto_nucl(11),mito(6),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LK37	Chitin synthase	Low	5	1	88-107	FYEKHDLRPKRFQHPRHTEI	plas(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LNL8	Uncharacterized protein	Low	9.7	1	87-112	SIILCDRRRKSKRKRAAERSQNRMTD	cyto(8.5),cyto_nucl(7.5),nucl(5.5),plas(5),extr(3),mito(2)	RRRKSKRKRAAE (93-104, prob:0.945)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYM9	Histidine--tRNA ligase	Low	8	1	385-404	AESKPSKKKGKKGSEDDDRS	mito(24),cyto_mito(13.333),mito_nucl(12.833)	KPSKKKGKK (388-396, prob:0.832)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MD39	30S ribosomal protein S12	Low	9.1	1	162-182	ASRTTSRSKYGTKKPKKATVG	mito(24),nucl(3)	RKGKR (63-67, prob:0.648)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDY0	Uncharacterized protein (Fragment)	Low	7	1	25-44	SLCEKWRRSKADKRRLETKV	mito_nucl(9.666),nucl(9.5),mito(9.5),cyto_nucl(9.333),cyto_mito(9.333)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MF09	Uncharacterized protein	Low	9.6	1	635-656	QAAAHRKKERRARKRSIVSDPA	cyto(13),cyto_nucl(10.5),mito(7),nucl(6)	HRKKERRARKR (639-649, prob:0.929)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWH1	Uncharacterized protein	Low	9.9	1	1205-1236	LRTSSGFRIERRWKRKPWKKRIPEPFKGHEVV	plas(17),nucl(5),vacu(2),cyto(1),E.R.(1),golg(1)	RIERRWKRKPWKKRIPE (1212-1228, prob:0.973)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0S5	Uncharacterized protein	Low	9.9	1	35-61	HSPPTPPLRIPRKSPRRALRNNAIPPA	plas(8),nucl(5),golg(5),mito(4),extr(2),cyto(1),E.R.(1),vacu(1)	RKSPR (46-50, prob:0.63)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5F5	Zn(2)-C6 fungal-type domain-containing protein	Low	7	1	14-36	VLACTNCSRRKIKCSKTIPCTAC	mito(11),plas(9),nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LQK7	V-type proton ATPase subunit H	Low	6.9	1	36-55	QYAKIRAVDKAKKPEQRKEI	mito(11),cyto_nucl(7.5),cyto(7),nucl(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M997	Uncharacterized protein	Low	8	1	52-72	SAPKGARKPLRPPPRAPKLVK	mito(15.5),cyto_mito(10),pero(5),cyto(3.5)	KGARKPLRPPPRAPK (55-69, prob:0.848)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MP26	MFS domain-containing protein	Low	5	1	14-40	VSKFKEDWERWIRRQIKKRGGDRSVLC	plas(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPY3	Uncharacterized protein	Low	5	1	257-276	IIFFIRRRDNKKKAAAQPLM	extr(21),golg(3),mito(1),pero(1),E.R.(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQ71	Uncharacterized protein	Low	8	1	65-95	VQRYAHIRLHKQRSRNRKRAKEALKHPHPGD	plas(21),E.R.(4)	HKQRSRNRKRAKEALKH (74-90, prob:0.921)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MT15	Zn(2)-C6 fungal-type domain-containing protein	Low	9.9	1	5-27	RQACDRCHSKKLKCTKIPASSVC	nucl(16.5),cyto_nucl(10.5),mito(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LJ76	Uncharacterized protein	Low	9.7	1	988-1007	DEPALSRRPKKIQNHCSFFK	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LK88	Uncharacterized protein	Low	5	1	200-219	ACLLKDRKERERYRHIDEKA	plas(14),E.R.(6),mito(4),vacu(2),cyto_mito(2),mito_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LNG1	acidPPc domain-containing protein	Low	8	1	27-54	LNTVPHRYRIGRRRTKSKSRPGNEEITS	plas(25)	GRRRTKSKS (37-45, prob:0.737)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LQY9	Uncharacterized protein	Low	9.7	1	473-498	LEAGPKSPSKARRHTEKRITGPRDAW	nucl(18),cyto_nucl(13.5),cyto(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVI4	1-alkyl-2-acetylglycerophosphocholine esterase	Low	5.8	1	104-127	ICNISSVKPKRFHKPKKEYPVALF	mito(20),cyto(3.5),cyto_nucl(3.5),nucl(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1G3	Uncharacterized protein	Low	6.3	1	406-426	SSKFTGPKKVVSRQLKFRDDD	cyto(12.5),cyto_nucl(9),nucl(4.5),mito(4),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAK1	Uncharacterized protein	Low	5	1	24-43	PSTPATRKRTMKNTDPNPSF	plas(21),mito(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAU9	ANK_REP_REGION domain-containing protein	Low	8.2	1	190-213	QTDNRYVKHKFKLRRDCISRCCSC	nucl(11.5),cyto_nucl(11.5),cyto(8.5),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBK3	Chitinase	Low	5	1	39-60	ITKGNGSKDQKGYRNRLREKLI	extr(23),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBW8	Foie-gras_1 domain-containing protein	Low	9.3	2	149-173, 1179-1200	IKTQIPSSSNPKRNSKQEKHDAFDY, TLLYRIKRKTNVRSSKRAARTM	cyto(14),cyto_nucl(12.833),nucl(10.5),cyto_mito(8.333)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDS8	Uncharacterized protein	Low	5	1	28-53	ICPFCSITSRPRIRPRRAILGKRFYT	mito(23),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHG8	DUF155 domain-containing protein	Low	7.3	1	9-31	VLVTDARQRPPQRRVLQRQDTGA	mito(8.5),nucl(8),cyto_mito(8),cyto(6.5),plas(1),pero(1),E.R.(1),golg(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIZ6	Zn(2)-C6 fungal-type domain-containing protein	Low	9.5	1	16-41	LPLRSCTYYRYRKVKCDRQQPCSNCL	nucl(19),cyto_nucl(15.5),cyto(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MU63	Uncharacterized protein	Low	5.4	1	645-667	AVATKSVRLKGNRRDHKIRAWLV	plas(21),cyto(3),nucl(1),golg(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUH4	AA_permease domain-containing protein	Low	5	1	507-527	FIFWKLYKKTRWLRPHEVDIA	plas(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NBV6	Uncharacterized protein	Low	8.9	1	149-170	VTQCKQGERCNHRRAWNRRQGR	mito(23),nucl(2.5),cyto_nucl(2.5)	AIKRGNAKRA (41-50, prob:0.695)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LHC0	Metallophos domain-containing protein	Low	8.8	1	249-272	REEFRKKEIEKKRKQAEKLRQKEL	extr(9),mito(6),plas(3),E.R.(3),golg(3),nucl(2)	FRKKEIEKKRKQAEKLRQK (252-270, prob:0.939)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LQV2	Uncharacterized protein	Low	7.3	1	9-28	LVNGTPYKWKRTQQNSYQME	nucl(10.5),cyto_nucl(9.999),mito_nucl(8.333),cyto(8),cyto_pero(5.333),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTQ1	Atypical/ABC1/ABC1-B protein kinase	Low	5	1	47-67	GAPRHAKEYRQGRRWARRLLL	mito(24.5),cyto_mito(13.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVE8	Uncharacterized protein	Low	5	1	855-875	YDSVRPMKRFTEKRMRSHRST	plas(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2R0	Protein disulfide-isomerase	Low	5	1	718-739	GLYSWIRNRTRRSRGTFFRMDD	cyto(9),E.R.(8),extr(4),golg(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M777	Uncharacterized protein	Low	8.1	2	34-53, 188-215	QMQMQKPKGKRTTRPWPSAL, KLNARKHTKITFQKNRGKKCSIKPNDCM	mito(21.5),mito_nucl(13.5),nucl(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M958	Uncharacterized protein	Low	5.8	1	13-32	SPKMSNTTTHKPKRDMKVLC	mito(11),cyto_mito(11),cyto(9),nucl(3),plas(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCP8	Uncharacterized protein	Low	7.9	1	227-248	LLATIRKQPAARKRSRFRSLMA	cyto_nucl(11),nucl(10.5),cyto(10.5),extr(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIF3	Nickel/cobalt efflux system	Low	5	1	352-374	GSIFLYKPWRRRVERQQQSLIQT	plas(16),E.R.(5),mito(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQ70	Uncharacterized protein	Low	7.3	1	644-670	DTTQAGKPRPPKQTGRRQPHRDNGPGD	mito(17.5),cyto_mito(10),nucl(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MYP9	DNA-directed RNA polymerase III subunit RPC9	Low	8.4	1	20-40	VSEQRERYKNAKRRGPPNLET	nucl(13.5),cyto_nucl(12.5),cyto(8.5),mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N339	Uncharacterized protein	Low	5	1	145-166	PPLDTKRYKGLQKKKDTRGDGN	extr(10),golg(8),plas(3),E.R.(3),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N6M5	Uncharacterized protein	Low	7.1	1	32-57	SMGLWDRVKEKRKQAKRDTTQDEEIK	cyto_nucl(12.833),cyto(11),nucl(9.5),cyto_mito(8.165),mito(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LKX4	Trehalose-6-phosphate hydrolase	Low	7	1	483-502	QSSLHHWRRVLKFRKQHSNI	cyto_nucl(9.333),cyto(9),nucl(8.5),cyto_pero(8.333),pero(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LXL8	AarF domain-containing kinase	Low	8	1	41-62	FASRRGSRKSNGHKSGPKRPLL	mito(20.5),cyto_mito(13.5),cyto(5.5)	FASRRGSRKSNGHKSGPKR (41-59, prob:0.858)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJN5	Elongation factor 1-gamma	Low	9.9	1	213-233	LTNTPPKKPEQPKKEAKKEAA	cyto(12),mito(9),nucl(5)	KKPEQPKKEAKKEAA (219-233, prob:0.82)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MM15	Uncharacterized protein	Low	8	1	373-395	DGMRKSKKIGKKMLKRVFRKWHF	plas(24),E.R.(2)	RKSKKIGKKMLKRVF (376-390, prob:0.883)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MU26	FAD-binding PCMH-type domain-containing protein	Low	5	1	438-464	HEPWRIEKLKALKKKWDPENRMRFYAP	cyto(22),cyto_nucl(12.5),mito(1),extr(1),pero(1),cysk(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N554	Tyrosinase	Low	8.2	1	229-250	LDKIKADRDPRRRIKPQFENIL	nucl(11.5),cyto_nucl(9.5),cyto(6.5),pero(5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LIR1	Tyrosinase	Low	5	1	58-77	ADVRRDWKVLSKKERKAYIN	extr(22),mito(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LLP0	Uncharacterized protein	Low	8.8	1	1060-1080	DDMMPKRKTRRVKDPYAIDFS	nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(3),extr(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LME0	Uncharacterized protein	Low	9.1	1	98-117	RGSSRDSHRRYHDRRRQDDD	nucl(14.5),cyto_nucl(10),mito(6),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LMY8	Serine/threonine-protein phosphatase	Low	8.7	1	501-527	DSSALKSHIKKSRNKRQHMLNSPPAMV	nucl(14),cyto_nucl(12),cyto(8),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2F7	Transcription initiation protein SPT3	Low	9	1	289-311	QEGSRRLQQRPKKSRAMLNGTRI	nucl(19),cyto_nucl(12.333),mito_nucl(11.833),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3B9	Uncharacterized protein	Low	5	1	703-722	EYPKTPSGKVQKYKLKDYAK	mito(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCZ9	Uncharacterized protein	Low	6.5	1	122-146	YLTLPRWKWSWRPRLPRLRIQLPQR	cyto(6.5),mito(6),cyto_nucl(6),plas(5),nucl(4.5),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LAS0	Uncharacterized protein	Low	8.6	1	26-47	STDQEKEGRKKHPPPPPPTSTS	mito(12),nucl(9),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LUY2	Uncharacterized protein	Low	5.3	1	6-32	SRSAKQEPITRRFRKHKVEILWNNFKQ	plas(13),mito(8),E.R.(2),nucl(1),cyto(1),cyto_nucl(1),pero(1),golg(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LW04	AB hydrolase-1 domain-containing protein	Low	5	1	439-462	WMEWIKERFERRKVQKEGCVQSKV	extr(22),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M485	Uncharacterized protein	Low	8	1	302-326	APVTPPKTGCSSKRRRARRAARRSL	extr(17),cyto(4.5),cyto_nucl(3.5),mito(3)	KRRRARRAARRSL (314-326, prob:0.934)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAG7	Uncharacterized protein	Low	6.4	1	302-325	GGGGQPEKPKRKQVTQRQDAPAAE	cyto(11.5),cyto_mito(10.5),mito(8.5),nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIA5	Uncharacterized protein	Low	7	2	73-95, 395-415	AEEPPPFQPKKRKWTFWTLCLLL, RFFNRCCGRNKSRPAEKPAPD	plas(20),E.R.(4),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIC2	Uncharacterized protein	Low	8.6	1	24-45	LPGYRGPKYRYKRKYWFSVAAH	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MLA4	Uncharacterized protein	Low	6.8	1	173-194	SETYMHGNKKQRKKVVSRCDSS	mito(13),mito_nucl(11.333),cyto_mito(9.333),nucl(8.5),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVT8	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	24-43	CNACRLRKSRCDGTRPSCSS	nucl(15.5),cyto_nucl(10),mito(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MW73	Uncharacterized protein	Low	8.9	1	417-437	ITRRFYSKLKRPRTEAPPTKI	nucl(13.5),cyto_nucl(10),cyto(5.5),mito(3),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWJ1	Uncharacterized protein	Low	9.9	1	201-225	LPVLKSSKGQTKKRKKIPQVVPEPH	cyto(13),cyto_nucl(11),nucl(7),mito(3),pero(2)	TKKRKK (211-216, prob:0.722)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LGD5	Anaphase-promoting complex subunit 2 (Fragment)	Low	5.8	1	646-669	GNDSRSSPRKPKIDPKEQERRTVY	mito(17.5),cyto_mito(11.5),cyto(4.5),nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LT65	Uncharacterized protein	Low	6.2	1	143-162	LNELKTKKGEKCKPGTHPAL	mito(17),cyto(6),cyto_nucl(6),nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTD6	3-oxoacyl-[acyl-carrier-protein] reductase	Low	5.7	1	1406-1429	LDINYRRRQIERRKKTIKQWQESE	cyto(16.5),cyto_nucl(10),cysk(5),nucl(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDP3	Uncharacterized protein	Low	8.2	1	30-53	RRNQAEFRRNLRRNERKQARVAKE	nucl(11.5),cyto_nucl(11),cyto(7.5),mito(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ME21	DNA polymerase delta subunit 4	Low	7.8	1	216-239	GPCIGMPRIKRWKRAERLGLNPPI	mito(14),nucl(9.5),cyto_nucl(7.5),cyto(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHW3	Alkaline phosphatase	Low	7.1	1	420-439	DPSIKKNKEKLKKYINEELI	cyto_nucl(8),nucl(7.5),cyto(7.5),mito(4),plas(4),pero(1),golg(1),cysk(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIV0	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	27-54	ACLVCRRSKIKCDWKPHQERCRRCIQLD	nucl(15.5),cyto_nucl(10.5),pero(5),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQX4	Zn(2)-C6 fungal-type domain-containing protein	Low	9.2	1	3-34	GVPSYKGCDACRKQKKKCDKAQPKCARCERLD	nucl(11),pero(6),cyto(5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LKX2	Mitochondrial Rho GTPase	Low	8.8	1	402-429	PITAALKITKPRKRRRRPGRVERNVVLC	cyto(11.5),cyto_nucl(7.5),mito(4),E.R.(3),nucl(2.5),pero(2),vacu(2)	KITKPRKRRRRPGR (408-421, prob:0.979)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LSG2	NmrA domain-containing protein	Low	6	1	30-50	VTLINRYPKKVPKKYVENGTT	cyto(13.5),mito(9),cyto_nucl(9),nucl(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LU94	Uncharacterized protein	Low	8.2	2	411-430, 1076-1097	TDEVRRRSPRQSPRQLPSPA, GVKVQQSKPPRNPPRRIKRVTM	plas(12),extr(7),nucl(3),mito(2),cyto_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M092	Clr5 domain-containing protein	Low	8.3	1	71-99	MYKRRFTKWGFYKSKPRNVKNTCKYRMPS	nucl(9),mito(9),mito_nucl(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMQ6	FAD-binding PCMH-type domain-containing protein	Low	5	1	474-495	KENWRQERLKSLKNKYDPKGKF	extr(13),mito(7),cyto(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZ04	U6 snRNA-associated Sm-like protein LSm1	Low	9.9	1	1-29	MPLHRAAVRRNRSHSCRRRCSPLQRSSWI	mito(18),nucl(5),cyto(3)	KKAVDKAREKARVKKL (171-186, prob:0.841)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5H1	Uncharacterized protein	Low	5	1	28-51	SESPSYKRCVPKRFGFPRFRKLTV	plas(19),mito(3),cyto(1),pero(1),E.R.(1),golg(1),vacu(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N601	Zn(2)-C6 fungal-type domain-containing protein	Low	8	1	18-58	ALQRSACTECHRRKQKCNRQWPCNSCQKRKVADQCRFRDDF	plas(12),nucl(8),cyto(3),mito(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NGP5	Zn(2)-C6 fungal-type domain-containing protein	Low	9.7	1	13-43	GTRSRSGCLTCRIRKKKCDEKRPACGACRSR	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LA80	MICOS complex subunit MIC60	Low	8.6	1	96-115	APAPIKKKGFFRRLKNFVFT	mito(12.5),cyto_mito(10.333),cyto(7),cyto_nucl(5.333),nucl(2.5),extr(2)	AKPKAKAKSP (218-227, prob:0.753)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1E8	Uncharacterized protein	Low	5	1	485-508	LIGLWLLRRKRKAQRDVRSAPTTE	extr(11),plas(5),cyto(3),mito(2),cyto_nucl(2),E.R.(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5M3	DUF1279 domain-containing protein	Low	5	1	78-101	GVLRRGFRFTTKRKTNKKPTVGEA	mito(21),plas(3),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M9H3	Serine/threonine protein kinase	Low	7.8	2	89-116, 468-491	TPEVRDWIQKAKKSQKFRRYVTKKIVTA, HSLKPASLKRFKKNWKPDEETKDS	cyto(8.5),cyto_nucl(6),mito(3),plas(3),E.R.(3),golg(3),nucl(2.5),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMF2	MFS transporter, SP family, general alpha glucoside:H+ symporter	Low	5	1	514-537	EIDILFKRKVQARKWKKTVIDVHD	plas(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQ78	Uncharacterized protein	Low	7.9	1	20-42	TPATPHLRQARIKRKNSPTDISH	mito(12),nucl(8),cyto(4.5),cyto_pero(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWL4	Serine/threonine protein kinase	Low	9.9	2	126-145, 508-531	RLGSDRRKLKKQQILPIQYK, VYEALKTKRKWKQFMRHKSQPSDA	cyto_nucl(11.5),nucl(11),cyto(10),mito(2),pero(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5C4	HET domain-containing protein	Low	8.6	1	56-83	DQSHPQSVKLKTKWRKPKEQAHPAPEPS	nucl(12.5),cyto_nucl(8.5),mito(4),cyto(3.5),extr(3),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N862	Uncharacterized protein	Low	8.7	1	287-312	PEVASPKGKKTKKALKRQSTIPNIAD	plas(19),nucl(2),cyto(2),cyto_nucl(2),E.R.(2)	PKGKKTKKALKR (292-303, prob:0.833)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NHN4	Uncharacterized protein	Low	5	1	17-36	VSLVRLKKGKKRFELACYKN	mito(24),cyto_mito(13.833),mito_nucl(12.833)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LBF3	Uncharacterized protein	Low	9.6	1	431-453	DDSPSMSERRRGKRPMRAVDESD	nucl(16),cyto_nucl(11),cyto(4),cysk(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LIK7	ENDO3c domain-containing protein	Low	7.6	1	25-47	VSDTKAIKVEKRKTVPRKVPAGV	nucl(9.5),cyto_nucl(9),cyto(7.5),mito(6),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTQ3	SNF2_N domain-containing protein	Low	9.5	1	72-91	MAMKKNKKSQGRKSRGKASR	mito(8.5),cyto_mito(8),cyto(6.5),pero(6),nucl(5)	MKKNKKSQGRKSRGKASRGKK (74-94, prob:0.986)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M734	Adenine DNA glycosylase	Low	9.6	1	67-91	VKLPIAKRRKTQSARGKNANSKIHE	mito(19),cyto_mito(11.5),nucl(6)	KRRK (73-76, prob:0.63)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBG6	Uncharacterized protein	Low	8	1	86-105	AAFPKVKRGGKKKLLKIRST	mito(25)	KVKRGGKKKLLK (90-101, prob:0.858)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ME06	Uncharacterized protein	Low	8.7	1	446-468	EKERDVKDKERWARLKRVKSLFD	mito(21),nucl(2),cyto(2),cyto_nucl(2)	KERWARLKRVKSLFDTKGSRKLRHP (454-478, prob:0.733)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRH7	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial	Low	8.9	1	122-142	EGSRAPKKRARIRPDGPWQVQ	mito(19),cyto(3.5),cyto_nucl(3.5),nucl(2.5)	APKKRAR (126-132, prob:0.72)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NGA1	Uncharacterized protein	Low	6.9	1	53-76	FPPTPRCCRPNRSHGRQHERRYNT	mito(11),nucl(5),cyto(5),cyto_nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LKU7	Zn(2)-C6 fungal-type domain-containing protein	Low	9	1	58-83	LIDSKRGKYARRSNAQRVSRRQQAQS	nucl(10),plas(10),mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LV23	Uncharacterized protein	Low	6.1	1	226-250	PEVVDVRKKNSRRNRTNTPPSRDEP	plas(13),mito(5),nucl(3),cyto(3),cyto_nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYG3	Zn(2)-C6 fungal-type domain-containing protein	Low	9.8	1	6-33	YQPTSPIRKTHRRTTRACDDCRRLKEKC	nucl(17.5),cyto_nucl(10.5),cyto(2.5),mito(2),plas(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBX8	Uncharacterized protein	Low	8.3	1	27-48	LVELRTRRSKRSRTLAPRNMSS	nucl(9),mito(9),mito_nucl(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRN7	Ankyrin repeat protein nuc-2	Low	7.3	1	143-162	FSKILKKWDKTSKSKTKELY	cyto_nucl(11.833),cyto(10.5),nucl(10),mito_nucl(7.499),mito(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWI9	3-phytase	Low	5	1	432-455	CSLSKYSKFTKDRLRKNGNFAKLC	extr(16),mito(6),cyto(2.5),cyto_nucl(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MYZ0	UNC45-central domain-containing protein	Low	6.3	1	159-178	LGTLMRRKWKSRKVETACLE	cyto(16),cyto_nucl(11.5),nucl(5),plas(2),mito(1),pero(1),E.R.(1),cysk(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LCM6	Zn(2)-C6 fungal-type domain-containing protein	Low	8.6	2	10-37, 65-84	VRSNAGCWTCRLRRKKCDEKRPVCDACG, KIKAQVKKQASQRRDRKYME	plas(11),mito(8),nucl(4),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LMX7	Glutamate carboxypeptidase II	Low	5	1	22-45	IQTVRVGPPRRRYPHQTWRRFFTL	plas(21),cyto(1.5),cyto_nucl(1.5),mito(1),pero(1),golg(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7Z4	Uncharacterized protein	Low	9.5	1	511-531	STSASRSRSRGRGRSRANSGG	nucl(17.5),cyto_nucl(11.5),mito(5),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M9Y1	FeS_assembly_P domain-containing protein	Low	9.2	1	15-34	SQLPTRQKKAEPRRGPDSKY	nucl(15.5),cyto_nucl(12),cyto(5.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNX3	Glycosidase	Low	5	1	335-358	EDMDKGKKEDKKKDSKDDDKDDKD	extr(24),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUQ5	Uncharacterized protein	Low	5	1	29-50	LVHAFRKGYRVRKKFQALKDQG	cyto(9.5),cyto_nucl(6),extr(4),E.R.(4),mito(3),pero(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N330	Uncharacterized protein	Low	5	1	369-390	DVAYNFTRRKPRRANEWQLWYF	plas(21),E.R.(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LQU4	Zn(2)-C6 fungal-type domain-containing protein	Low	9	1	6-26	TNSQRLVKPGVKRRRPPLACI	nucl(13.5),cyto_nucl(9.5),mito(6),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1C0	MFS domain-containing protein	Low	5	1	110-133	GPNDPSNPRNWTKRKKWLSTILVS	plas(23),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M340	Uncharacterized protein	Low	7.8	1	49-68	PPEPYAKKSHQCKRGRGGAR	mito(14.5),mito_nucl(13),nucl(10.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M994	Zn(2)-C6 fungal-type domain-containing protein	Low	9.1	1	32-67	GSLKCDRCHRLDKPCVNQTPAPARPRRSPKLSKIAA	nucl(14.5),cyto_nucl(9.5),mito(8),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHR0	60S ribosomal protein L12	Low	8.8	1	83-105	KALKEPPRDRKKEKNIKHNKSVS	cyto(21),cyto_nucl(13.333),mito_nucl(3.666),nucl(3.5)	KEPPRDRKKEKNIK (86-99, prob:0.824)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJU6	Aminotran_1_2 domain-containing protein	Low	7.3	1	29-50	SHLFSRVTRNRKPSNIKAFYKF	cyto_nucl(11.833),cyto(11.5),nucl(10),cyto_mito(7.166),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N340	Uncharacterized protein	Low	9.4	1	6-35	IPNHGRRSQIHLRRLRCRRCDKYLLHHPKS	nucl(15.5),cyto_nucl(10),mito(6),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NCA6	Uncharacterized protein	Low	5.3	1	9-33	KSQPTESLFKNKRKSKPFSSFPGSL	plas(23),nucl(1),mito(1),cyto(1),cyto_nucl(1),E.R.(1),cyto_mito(1),mito_nucl(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NHA6	Phosphoinositide phospholipase C	Low	9.9	1	125-144	AIRRTGRRSRLHKADRLFKP	nucl(19),cyto_nucl(13.5),cyto(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LWI2	DUF1996 domain-containing protein	Low	8	1	515-538	APSAAPARRRRRGAHLHGHGHRYF	extr(16),mito(5),cyto(3),plas(1),E.R.(1),golg(1)	ARRRRRG (521-527, prob:0.749)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5I4	Uncharacterized protein	Low	7.4	1	279-305	EDAKPYCYMKSPKNPHRCGRHGGKQGT	cysk(9),nucl(8),mito(8),mito_nucl(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6C3	Acetyltransferase	Low	8.8	1	158-180	DALDMRKPMKRDKDRQHIRDDGE	nucl(14),cyto_nucl(12),cyto(8),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7T3	F-box domain-containing protein	Low	8.1	1	71-90	DTPWKKLFILRKFRNEQLKR	cyto_nucl(12),nucl(11.5),cyto(11.5),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MG85	FAD-binding PCMH-type domain-containing protein	Low	5.6	1	438-459	VNLPRLRELKRKYDPNNVFNKW	cyto(13),cyto_pero(10.333),cyto_nucl(8.333),pero(6.5),nucl(2.5),mito(2),extr(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NF72	Zn(2)-C6 fungal-type domain-containing protein	Low	9.5	1	5-32	ETPKSAPSRRRASKACMNCRVRKVRCDV	nucl(14.5),plas(9),cyto_nucl(8.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LEC9	Glyco_hydro_63 domain-containing protein	Low	8.7	1	12-33	EEERRLKEDRDRTKYWKKWGPY	nucl(13.5),cyto_nucl(12.5),cyto(10.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LRV5	NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial	Low	8	1	271-290	PESFKLPTPKPEEKKEEPKK	mito(25)	EKKEEPKK (283-290, prob:0.687)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LT02	Uncharacterized protein	Low	5	1	50-69	DENGRRMRWKRKDTNPKVED	extr(8),mito(6),E.R.(4),golg(4),cyto_mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M8B5	Aspartokinase	Low	6.2	1	344-364	TRDSPKPQAEHKKPKRPTAVT	cyto(16),cyto_nucl(11.333),cyto_mito(10.333),nucl(5.5),mito(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRQ8	Endo/exonuclease/phosphatase domain-containing protein	Low	5	1	289-310	VDVRLNQVSRKQRRTGEKKDEF	extr(15),plas(4),golg(3),E.R.(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSJ7	Uncharacterized protein	Low	6.6	1	148-167	KLNSRFKWPRALKRTIRTGR	cyto(13),cyto_nucl(11.5),nucl(6),mito(4),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0M3	Zn(2)-C6 fungal-type domain-containing protein	Low	9.2	2	4-35, 39-58	VPSSRGCNSCRKAKKRCDQKQPKCGRCIRLGD, GSGTRRFKFHQYKPDTQSTQ	mito(14),nucl(6),cyto(4),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NE40	Uncharacterized protein	Low	5	1	283-307	YGNTERDANTKRRKRENSNADDRIL	plas(11),mito(9),E.R.(3),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LDW5	FK506-binding protein	Low	9.4	1	281-303	SKDDAKLSKKQQKKLKNNKGEAV	cyto(19.5),cyto_nucl(14),nucl(5.5)	KKQQKKLKN (289-297, prob:0.666)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LIZ4	Aldehyde dehydrogenase	Low	5	1	26-51	KTFATGKTKSIKWRKWQLKQMWWMLV	plas(24),mito(1),cyto(1),E.R.(1),cyto_mito(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LKP0	Uncharacterized protein	Low	5.8	1	472-497	VTPSLVTREDRKRMKRMVPKTPTLEM	extr(14),plas(9),nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LQJ6	Peptidase S53 domain-containing protein	Low	5	1	470-499	QDKVVKDYLKKNEKKWRQWKNYISKDGRAF	extr(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LUK8	Ceramide glucosyltransferase	Low	5	1	477-496	NTVNWRGRRFRIRRDTTVEA	plas(23),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5J1	Uncharacterized protein	Low	8.7	1	41-71	QASVVRIKKTGKKKKALPKDFKRHNLAKREF	mito(23),nucl(2),cyto(2),cyto_nucl(2)	RIKKTGKKKKALPKDFKRHNL (46-66, prob:0.975)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5R7	Choline-phosphate cytidylyltransferase	Low	9.2	1	2-24	SSPSSSSQGGKRKRNSLRAESAA	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6T9	Aa_trans domain-containing protein	Low	8	1	1-29	MEDSALLTPSRRRRKRKVRGGTGNNSPMN	plas(25)	RRRRKRKVRG (11-20, prob:0.936)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHL6	3-phytase	Low	9.6	1	44-66	ERLENWHTEHKRRETRRWSYLVM	nucl(12),plas(4),golg(4),mito(2),cyto(2),cyto_mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIQ8	Uncharacterized protein	Low	9.6	1	479-502	MRYMSAFPKKPRDHCREERDARMA	nucl(12),cyto(6),cysk(5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSI0	Carboxylic ester hydrolase	Low	8	2	43-65, 495-520	LPPVGQWRFRVPRRLPKDYRYGT, EVNWGTKNPKDMRRWRRDGKTDVCED	mito(11),cyto_pero(5.833),pero(5.5),cyto(5),cyto_nucl(4.833),nucl(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N2S0	HET domain-containing protein	Low	8.7	1	42-65	LELMKLKKGHQKIRRVCEQARKDG	nucl(10),cyto(6),mito(4),cyto_pero(4),plas(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N7U7	Chitinase	Low	7	2	23-44, 92-114	DDTTCSATKRCKNGCCNKSGNC, GTTKDFCGSKKVKKPSCSKTGDV	extr(11),E.R.(5),golg(4),plas(3),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LKT8	Alpha-galactosidase	Low	5	1	11-31	SEKPHVTKTKRSWPLWKKLTA	extr(13),cyto(6),E.R.(2),mito(1),plas(1),pero(1),golg(1),cysk(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LW51	Ras-like C3 botulinum toxin substrate 1	Low	7.2	1	179-199	RAVLNPRPTPSKQKKNKCSIL	nucl(12.5),cyto_nucl(11.666),mito_nucl(9.999),cyto(8.5),cyto_mito(7.999),mito(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ME71	Uncharacterized protein	Low	7.3	1	65-88	QSLESLRSKRCKRLKIRHLQSAHA	cyto(12),nucl(6),pero(5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MM29	Uncharacterized protein	Low	9.5	1	26-46	CYYPHRSKRALGPPKHRPLLP	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MM56	Rab-GAP TBC domain-containing protein	Low	9.5	1	891-911	FKLNRSKTTPHPPQQQPQDHE	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MP34	Uncharacterized protein	Low	9.1	2	1-20, 317-341	MSNTSSPKSRSPRSPQDPSA, VYIAKFRREVRSRKHHVYIRLRAVW	cyto_nucl(9.833),nucl(9),cyto(8.5),cyto_mito(8.166),mito(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSX6	Fungal_trans domain-containing protein	Low	7.7	1	1-29	MKPLKACTECRRIKRKCTRQNGRIGDPCD	mito(15),nucl(8.5),cyto_nucl(5.5),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTH7	Uncharacterized protein	Low	5.7	1	13-36	LTILYIRTKPRKNLPPGPKPLPIL	plas(12),E.R.(4),vacu(3),nucl(2),mito(2),golg(2),mito_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTK9	Uncharacterized protein	Low	8	1	334-358	PSTGGKCKAKRAAKRALKAKRALRK	extr(20),cyto(5)	KCKAKRAAKRALKAKRALRK (339-358, prob:0.989)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MW43	Uncharacterized protein	Low	9.4	1	307-334	SVKTCWWHRFRAWKDRFRKRDRSGSWVS	mito(14),nucl(11)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LLJ9	Uncharacterized protein	Low	5	1	637-661	TGDNPQSKLRRWRMLQREGHRRTDD	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LM82	Zn(2)-C6 fungal-type domain-containing protein	Low	9.5	1	96-118	VTACQFCRVRKTKCDNVRPTCGF	nucl(16.5),cyto_nucl(11.5),cyto(5.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7K0	Uncharacterized protein	Low	9.7	1	81-105	EELKLRGKSAPKKKKGPPAPTHKKR	mito(17.5),cyto_mito(11),nucl(6)	LRGKSAPKKKKGPPAPTHKKR (85-105, prob:0.996)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M9D2	Uncharacterized protein	Low	8	1	489-515	VLVTCFCLIRKHRRRRERVGSQQPMTQ	plas(17),extr(6),E.R.(2),golg(2)	KHRRRR (499-504, prob:0.673)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBT4	CAMK/CAMKL/PASK protein kinase	Low	9.2	1	115-135	LSGLRRIRQTRPPSRNPTLPG	nucl(11),cyto(8),cysk(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MD32	Uncharacterized protein	Low	8.5	1	577-599	AMELARRWQPRRDKENNDEFWKT	nucl(13.5),cyto_nucl(12),cyto(9.5),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIX3	Uncharacterized protein	Low	8	1	238-264	IPQALRRLRKLVKKREKRARQLQEEEV	plas(19),E.R.(3),mito(2),pero(2)	RRLRKLVKKREKRAR (243-257, prob:0.917)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNT6	Uncharacterized protein	Low	9	1	16-43	ISDAERRSRYRKHLLSRQKADKKRDDLI	nucl(15),cyto_nucl(14.5),cyto(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTJ4	Uncharacterized protein	Low	5	1	286-307	FLVLRGKKRKSSQQQLEDNDVG	extr(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWD3	Uncharacterized protein	Low	8.5	1	57-80	RDPAKDEKYARQKRHPANSPRFEI	nucl(9),mito(8),cyto(6),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMX9	Uncharacterized protein	Low	5.8	1	1-25	MSCPTRKYPLRKPQGHKLPIPRWHL	mito(19),cyto(5),nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSA3	Carboxylic ester hydrolase	Low	6.6	1	44-63	VGNLRWRKPQPLPKTHQYES	cyto(9),cyto_pero(8.833),cyto_nucl(8.333),pero(7.5),nucl(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N4J1	Mannan polymerase II complex ANP1 subunit	Low	9.1	2	34-57, 408-427	ISPHKFQPRTLTPAQRRRNKLLVR, ERLAREKQEEEKKKNQQKIK	plas(8),nucl(6.5),cyto_nucl(5.5),mito(4),cyto(3.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LJC6	Uncharacterized protein	Low	9.3	1	180-200	ISTGPRRRDKGKFNRRCDRYQ	nucl(16.5),cyto_nucl(11),cyto(4.5),mito(3),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LNP1	J domain-containing protein	Low	9.2	1	233-262	FDKAGHTRTHRREDQRRKDRRQRSAMGDDD	extr(11),mito(8),nucl(3),cyto(2),golg(2)	RK (249-250, prob:0.611)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LNQ8	SUMO-conjugating enzyme ubc9	Low	9	1	3-23	LCQNRLQEERKQWRRDHPFGF	nucl(14.5),cyto_nucl(10.5),mito(6),cyto(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LX76	Dolichyl-diphosphooligosaccharide--protein glycotransferase	Low	8	1	725-749	AGAFSRGQKKKKAVQKRGARVLRVD	plas(21),E.R.(5)	RGQKKKKAVQKRGAR (730-744, prob:0.878)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LXF1	Uncharacterized protein	Low	5.4	1	30-53	PYSIISEKTKKPRLRMRSLLGPCH	mito(11),plas(9),cyto(2),nucl(1),pero(1),E.R.(1),golg(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYE3	Uncharacterized protein	Low	5	1	138-164	KDTSCHHERRQSRARRRQSSHPPPEQA	plas(17),extr(3),E.R.(3),vacu(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M4Z2	Amidohydro-rel domain-containing protein	Low	5	1	245-264	HWYNKPSKKATRPSKEDYDY	cyto(18.5),cyto_nucl(10.5),mito(3),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJL3	Uncharacterized protein	Low	8.7	1	10-46	ASVLSGRSRRHKSSRSHKKRRSRSRSRSSSRERGRGG	plas(14),mito(6),cyto(3),nucl(2),cyto_pero(2)	RSRRHKSSRSHKKRRSRSRSRSSSRERGR (16-44, prob:0.998)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MR08	Uncharacterized protein	Low	8.3	1	1096-1121	FYHNRLERSNKDKSQRSRKLQLSDVD	nucl(12.5),cyto_nucl(11),cyto(8.5),mito(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVY1	Uncharacterized protein	Low	5	1	398-420	VYGIRRLKTWRQRQVYTKLKNDD	extr(11),E.R.(5),golg(5),plas(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N544	MFS domain-containing protein	Low	5	1	350-372	YDAHIYKKYRRTHRRILPESKIT	plas(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTU3	Zn(2)-C6 fungal-type domain-containing protein	Low	9.5	1	26-51	KYAPVACNECKKKKLKCVRDEGDEIC	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1R2	CFEM domain-containing protein	Low	7.3	1	50-74	TLEQCLSNKERKTKKKCTEDDEFEY	cyto_nucl(8),nucl(7.5),cyto(7.5),extr(3),mito(2),plas(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKH2	Uncharacterized protein	Low	5	1	89-110	LLSLVYKRWRERPQRPLKIWFF	plas(16),mito(5),E.R.(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKZ6	Uncharacterized protein	Low	6.7	1	927-958	EVPTRQHKIGKMRTARHERTKRERTPSPELTE	extr(6),nucl(5),plas(4),cyto_nucl(4),golg(4),cyto(3),mito_nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MLH9	Uncharacterized protein	Low	9.3	1	311-331	RTLMQRFKKRKQSIEDRHMKK	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MP43	Uncharacterized protein	Low	9.9	1	4-30	SSPQLACKQCRARKVKCDRRIAGCIRC	nucl(17),mito(9),cyto_nucl(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N393	Uncharacterized protein	Low	8.2	1	194-215	SPESWRDKERHSKRSHRVSPSE	nucl(12),cyto_nucl(12),cyto(10),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N974	Gamma-glutamyltransferase	Low	5.9	1	344-363	ERIRSKIDPRKTQKNEKYNP	mito(8),extr(8),cyto(7),cyto_nucl(6),nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LDB6	Uncharacterized protein	Low	9.5	1	280-304	DDNSRGHRGRRQKQHHRSPPPGPDR	cyto(9.5),cyto_mito(7),nucl(5),extr(4),pero(4),mito(3.5)	HRGRRQKQ (286-293, prob:0.687)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LFR5	Cytochrome c1, heme protein, mitochondrial	Low	5	1	318-337	SVWVKRYKWAWLKSRKIAYD	mito(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYF4	Phospholipid:diacylglycerol acyltransferase	Low	6.2	1	41-60	VVEHAVPKTRKRRNTFIFFL	plas(17),nucl(3.5),cyto_nucl(3),pero(2),cyto(1.5),mito(1),E.R.(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M584	Uncharacterized protein	Low	8.9	1	589-618	DEDAYFRKPVNPHRHQNKQRRVRPSDYREL	nucl(13.5),cyto_nucl(11),cyto(7.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MA54	Uncharacterized protein	Low	5	1	326-345	QIKSHAKKYGHPSLHKKAPS	plas(15),E.R.(5),mito(4),vacu(2),cyto_mito(2),mito_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MS56	Zn(2)-C6 fungal-type domain-containing protein	Low	6.9	1	3-31	THPNQIRSACERCRRQKLRCSRPLSSPSC	mito(19),nucl(5),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVP0	Uncharacterized protein	Low	8	1	95-114	GMRDREKHARRRRLLAHPLS	mito(16.5),cyto_mito(12.5),cyto(7.5)	HARRR (102-106, prob:0.633)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LDJ4	Retrograde regulation protein 2	Low	9.1	1	541-563	ADRVEKTAKKNGGKKPRYKITAQ	cyto(11.5),cyto_nucl(8),mito(7),nucl(3.5),plas(2)	KKNGGKKPR (549-557, prob:0.71)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LJS4	Acetyltransferase	Low	5.4	1	725-749	DEASRKIREAMKNRRHKTDQERTEG	plas(24),nucl(1),pero(1),E.R.(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LRZ9	HET domain-containing protein	Low	9.8	1	34-53	QSLSRFRRSRDTSRLPRVFQ	nucl(12),cyto(8),mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LXG3	Zn(2)-C6 fungal-type domain-containing protein	Low	5.6	1	17-45	RRIVISCTECHRRKQRCDREQPCSNCKSR	plas(20),nucl(2),mito(2),cyto(2),cyto_nucl(2),cyto_mito(2),mito_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LXT3	Uncharacterized protein	Low	8	1	88-109	LWPARGDHLRRKPRRKWWWYIL	plas(24),vacu(2)	RRKPRRK (97-103, prob:0.723)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQ39	Fungal_trans domain-containing protein	Low	8.2	1	19-50	GLPVKRKQVQHACASCRKKKRRCVHAEDAVEE	mito(17),nucl(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MX72	Atypical serine/threonine protein kinase BUD32	Low	9.8	1	41-62	YAMKLFKRDSRARRIRRELEIL	nucl(13),cyto(9),pero(2),mito(1),extr(1),golg(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LKE2	Beta-glucosidase	Low	6.3	1	40-64	NDTAGKRRLRYLRSWRAKKCCFTVI	cyto(8),cyto_nucl(7),mito(5),nucl(4),plas(4),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1E4	Uncharacterized protein	Low	8	1	61-87	AALRRPPSAQPAKKKKPGSKNDEDESF	plas(22),E.R.(2),golg(2)	RRPPSAQPAKKKKPG (64-78, prob:0.866)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5N0	Ornithine decarboxylase	Low	6.1	1	74-94	EVYRQHLRWKKNLPRVRPFYA	cyto(12),cyto_nucl(10),mito(5),nucl(4),extr(2),pero(2),cysk(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MGT9	TKL protein kinase	Low	6.4	1	98-125	ATGGTKQTHKRIQKSSKRLINVKREVRV	cyto(10.5),pero(9),cyto_nucl(8),nucl(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPT8	Uncharacterized protein	Low	5	1	179-204	SDQIRAELVNRKKQRKDSFRKAAAVS	plas(20),E.R.(3),golg(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSC5	Uncharacterized protein	Low	5	1	26-48	DCSLNRICSRWKKVCRCDPGWIG	extr(22),mito(2),cyto(2),cyto_mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWT4	Uncharacterized protein	Low	5	1	568-608	LSQAPDHRFRRCHRPSRQRHCHRRCHQHRHLHPRLHHYQLC	extr(16),plas(6),vacu(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZA4	Uncharacterized protein	Low	5	1	2-21	TGLDTVKKRRAQPENLNGAK	plas(23),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0J2	Cas1_AcylT domain-containing protein	Low	8	1	170-191	RNKAMEGRKKAKPHRSYNTTFN	plas(23),mito(2)	RKKAK (177-181, prob:0.686)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YB96	RING-type domain-containing protein	Low	7.8	1	96-116	MTPYMFRKQRKPKLEKLQRYF	nucl(8.5),cyto_nucl(6.5),mito(5),plas(4),cyto(3.5),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YBZ6	Aldo_ket_red domain-containing protein	Low	7.1	1	233-252	PNTFQGRKYRRRFWKDVIFD	mito(9.5),cyto_mito(8),nucl(7),cyto(5.5),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7L8S3	Zn(2)-C6 fungal-type domain-containing protein	Low	6.1	1	4-33	VPKALGCDACRKQKKKCDQAKPSCARCTRL	cyto(12),cyto_mito(9.833),cyto_nucl(8.833),mito(6.5),nucl(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LE01	60S ribosomal protein L11	Low	9.3	1	129-159	YCCMTRPGERVTRRRRTKSRIGASHRIKREE	mito(18),nucl(4),cyto(4),cyto_nucl(4)	VTRRRRTKSRIGASHRIKR (139-157, prob:0.892)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LKF2	Uncharacterized protein	Low	9.9	1	98-118	EPVSRRATKGKKAYIRRKLGL	cyto(12.5),cyto_nucl(10),nucl(6.5),mito(5)	RRATKGKKAYIRRKLGL (102-118, prob:0.828)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M8V9	Uncharacterized protein	Low	8	1	37-65	RPFILPPPKQHLNRRHKRRGNSFSPRLDI	extr(11),plas(8),E.R.(3),golg(3)	RRHKR (50-54, prob:0.65)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAD2	Uncharacterized protein	Low	9.1	1	143-169	ATIVLRGRIPKKQRSRRHKALWSANAS	extr(12),mito(7),nucl(3),plas(2),cyto_nucl(2),golg(2)	RGRIPKKQRSRRHK (148-161, prob:0.876)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAT6	Uncharacterized protein	Low	5	1	391-410	IITIKWCKRDMKREREEWEL	plas(21),E.R.(3),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NHD4	Uncharacterized protein	Low	5	1	37-56	MQNRRLTKAHYAFKKNKADG	extr(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LND0	AMPK1_CBM domain-containing protein	Low	8	1	803-827	GSSSTASGEKKKKHNRLSSIFSKIK	E.R.(8),extr(7),golg(4),mito(3),vacu(2),cyto_mito(2)	KKKKHNR (812-818, prob:0.729)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZ71	Zn(2)-C6 fungal-type domain-containing protein	Low	7.9	1	17-45	RSAPRTRMACSRCQRLKRKCNLELPVCSN	plas(13),nucl(8),mito(3),cyto(1),pero(1),vacu(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M0T3	NOT2_3_5 domain-containing protein	Low	9.6	1	407-430	AVELHSRNWRWHKKHQIWLTKDEH	nucl(16.5),cyto_nucl(11.5),extr(4),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5Q5	Uncharacterized protein	Low	7.4	1	227-250	TGLRRSMKRTCINKVHRYNKHLAI	mito(16),nucl(6),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M9E4	Uncharacterized protein	Low	5	1	27-47	ATGKRLKTRPHWAKPPRSGMS	mito(10),pero(7.5),cyto_pero(7.5),cyto(6.5),mito_nucl(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCQ9	Uncharacterized protein	Low	8.8	1	47-72	SSLAKRSPGRISKSKPRPRTRLEGAM	mito(20.5),cyto_mito(12),nucl(3)	KRSPGRISKSKPRPRT (51-66, prob:0.837)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MER8	Uncharacterized protein	Low	8.5	1	664-694	PRDPEMKILEWRRKPRPRPRAKGPAPERTAV	mito(18.5),cyto_mito(12),cyto(4.5),nucl(2)	WRRKPRPRPRAKGPAP (674-689, prob:0.971)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MH37	CHY-type domain-containing protein	Low	8.1	1	41-61	MIFACKKCRKCFRKDVKEFEE	mito(15),nucl(8),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJK4	Zn(2)-C6 fungal-type domain-containing protein	Low	8.1	1	1-23	MSHRQSCERCRQQKVRCLRDSTS	mito(11),nucl(10.5),cyto_nucl(8),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MX57	Uncharacterized protein	Low	9.2	1	116-141	FDDHSGHNHRQRHRHRQVKKWLEDDE	cyto(7.5),plas(7),cyto_nucl(6),mito(4),nucl(3.5),pero(2)	HRAKPGRRSLGHGRPVIGRAGDADKRPRA (148-176, prob:0.84)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NDZ9	Zn(2)-C6 fungal-type domain-containing protein	Low	8.6	1	25-49	GSKVSRKIRACQQCHTRKIRCVTED	nucl(12.5),cyto_nucl(8.5),mito(6),pero(4),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LDT8	Uncharacterized protein	Low	9.4	1	135-160	QLYNRRSHNIKVRKEKRRTNLFERGD	nucl(17),cyto_nucl(11.5),mito(6),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LH61	Hexokinase	Low	5	1	11-32	HGHGHEIKTKKRPWPRFLVSCV	plas(23),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LHN5	Uncharacterized protein	Low	8.7	1	182-212	CYGSTSLKEEEKRRRRRRRRRRRRKDAQQGC	mito(17),plas(3),nucl(2),cyto(1),extr(1),pero(1),golg(1),vacu(1),cyto_pero(1)	EKRRRRRRRRRRRRK (192-206, prob:0.999)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LK57	40S ribosomal protein S9	Low	9.8	1	1-21	MPPRAHSKTSRVPRRPFESAR	mito(15),nucl(6),cyto(6),cyto_nucl(6)	RPGRVRRKKA (166-175, prob:0.831)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LMN2	SMP-LTD domain-containing protein	Low	5.4	1	855-877	GDHRPPFSSRGRRRQSHAPEPDN	extr(12),golg(5),E.R.(3),mito(2),pero(2),nucl(1),cyto(1),cyto_nucl(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVJ5	Uncharacterized protein	Low	8.5	1	49-77	YATMKPEQRKAKQDKKDKKKAGKTAKPSK	cyto(10.5),mito(7),cyto_nucl(6.5),extr(3),plas(2),nucl(1.5)	QRKAKQDKKDKKKAGKTAKPSK (56-77, prob:0.994)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZR7	Uncharacterized protein	Low	5	1	795-821	VYRLARVSKTKTTKRSSERRQIQEVGG	extr(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M098	Beta-lactamase	Low	5	1	169-188	GKWSSKYKPKDGQKRKVEDT	mito(16),cyto(3),E.R.(3),extr(2),cyto_nucl(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3T4	SCP domain-containing protein	Low	8	1	198-219	STPKEAAKPKKVKKPASKPSTT	cyto(22),mito(4)	KEAAKPKKVKKPASK (201-215, prob:0.913)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MC47	Uncharacterized protein	Low	5	1	145-165	DRFGRLQGRMRRHWRRYAMSF	extr(11),mito(4),cyto(4),cyto_mito(4),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEB3	Mitotic spindle assembly checkpoint protein MAD2	Low	6.5	1	2-23	SSKEASKSKDKDKSKVHKLSLK	mito(13.5),mito_nucl(10.666),cyto_nucl(6.833),nucl(6.5),cyto(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHU7	Uncharacterized protein	Low	8.9	2	65-86, 1249-1272	SALYPPRQEHHLRRKTPNGTVD, RSVTWEQEQRRRWKMRKELFPALS	extr(9),nucl(7.5),cyto_nucl(7.333),cyto(6),cyto_mito(5.333),mito(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MK09	Zn(2)-C6 fungal-type domain-containing protein	Low	6.2	1	1-29	MPRPTKKGICNTCRRRKLKCNQALPICGQ	mito(21),nucl(3),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSW0	Uncharacterized protein	Low	9.7	1	1658-1680	DVILASKPRKSRKKDDPSGKMMA	cyto(11),cyto_nucl(9.5),nucl(6),E.R.(4),mito(2),plas(2)	PRKSRKK (1665-1671, prob:0.713)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYJ2	BTB domain-containing protein	Low	8	1	37-56	SPPKSNPWAPAKKPRVNPTA	nucl(9),plas(9),mito(4),cyto(4),cyto_mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZ08	60S ribosomal protein L10-A	Low	8.9	1	1-31	MARRPARCYRYCKNKPYPKSRFNRGVPDPKI	nucl(13.5),cyto(9),mito_nucl(9),mito(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3Y0	Uncharacterized protein	Low	9.2	1	490-518	PQPEAVVPIKKKKKPRKVVKHAKPDPGEL	plas(16),nucl(3),vacu(3),mito(2),cyto_nucl(2)	IKKKKKPRKVVKHAKP (498-513, prob:0.987)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M9C1	Rho-GAP domain-containing protein	Low	9.6	1	662-689	KQSGRLSPSDQKSKLKKKQLQISPSNGS	nucl(18),cyto_nucl(12.5),cyto(5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKL3	ANK_REP_REGION domain-containing protein	Low	8.3	1	722-750	GSKSSGKARKCGRQNSKKRGRDSTENMDE	nucl(11.5),cyto_nucl(10),cyto(7.5),mito(2),plas(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSU0	Uncharacterized protein	Low	5	1	42-67	LVPRTPARPIRQPKGTKQKNSTSLDT	extr(13),E.R.(6),plas(5),pero(1),golg(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NDM1	Uncharacterized protein	Low	5.7	1	2832-2854	FLNLLPLRFRRKRRGTQLSSIIQ	plas(17),E.R.(4),nucl(2),cyto(2),cyto_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTB3	Chloride channel protein	Low	8	1	69-92	QDAAREQAKRKARRKQAAGLYDKG	plas(24),mito(1),E.R.(1),vacu(1)	KRKARRK (77-83, prob:0.781)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVI1	Phospholipid-transporting ATPase	Low	8.4	1	286-305	KSEVLQKHSRKKSKGARENL	plas(22),golg(2),nucl(1),E.R.(1),vacu(1)	KHSRKKSK (292-299, prob:0.722)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYU6	Uncharacterized protein	Low	8	1	180-204	EPTEEEPKPKDKRRRKSTTISFHCD	plas(10),extr(4),mito(3),cyto(3),E.R.(3),cyto_mito(3)	KPKDKRRRK (187-195, prob:0.808)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MB93	Amino_oxidase domain-containing protein	Low	5.6	1	3-30	FFNFNKRDSSHKHSRRDRTIPSPKPVYN	plas(12),golg(4),mito(3),pero(3),cyto_nucl(2),nucl(1.5),cyto(1.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ML06	COX assembly mitochondrial protein	Low	9.2	1	59-78	RNAARAKRDKIREQQRELGL	nucl(16),cyto_nucl(11),mito(7),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNL6	Dimethylaniline monooxygenase (N-oxide forming)	Low	5	1	430-449	EPGVGRKLPKFRREWFRNFI	extr(10),E.R.(7),cyto(3),mito(2),plas(2),cyto_nucl(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MP23	Uncharacterized protein	Low	8	1	60-85	QNAPTGFQRPAKRQPLKKRLGKTGLT	plas(25)	KRQPLKKR (71-78, prob:0.649)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MY78	tRNA ligase	Low	8.5	2	54-73, 633-660	LDSARKDKKRGGFAVKKTTF, DIPDRGKKGYPQQQKPKVQKPRKMEYMS	mito(11.5),cyto_mito(10),cyto(7.5),nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YBJ9	Zn(2)-C6 fungal-type domain-containing protein	Low	7.8	1	24-43	FSACTFCKARKIKCNGATPA	nucl(8),plas(6),cyto(3),extr(3),vacu(3),E.R.(2),cyto_mito(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LKI9	MFS domain-containing protein	Low	5	1	507-528	FPYLFFRYGKRLRAKSKFASKI	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LR65	60S ribosomal protein L36	Low	9.1	1	62-85	ELLRNSKDKRARKLAKKRLGTFGR	mito(19),cyto(5),nucl(3)	NSKDKRARKLAKKRLGTFGRAKA (66-88, prob:0.968)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LSZ3	Zn(2)-C6 fungal-type domain-containing protein	Low	8.1	1	32-55	VTACQSCRLRKTKCDNVRPVCGFC	plas(12),nucl(8),mito(4),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3A9	DUF676 domain-containing protein	Low	7.7	2	5-31, 189-210	VLMSQASRPKPPRQRRREIYRTHSVHM, EELESLRKREKQKRPVVFVGHS	plas(16),mito(7),nucl(2),cyto(2),cyto_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7N4	Uncharacterized protein	Low	7.1	1	62-81	YGPSDKKRWGWQLRPGSPRY	cyto(9.5),cyto_nucl(9),nucl(7.5),pero(5),extr(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMW0	Uncharacterized protein	Low	8.5	1	4-31	QRTPAAHRDEPRKQNKGRPSKSDRVANI	nucl(11.5),mito(11),cyto_nucl(7.5),cyto(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N020	Uncharacterized protein	Low	9.2	1	1-27	MKRVKCCTACRRRHRKCVTQPGASQCG	nucl(13.5),mito(10),cyto_nucl(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LBT7	Uncharacterized protein	Low	8	1	67-89	GARRTYRRLRAKFPKTKRTKVVE	plas(18),mito(4),vacu(2),cyto_mito(2)	YRRLRAKFPKTKR (72-84, prob:0.778)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LMA5	Cell division cycle 20, cofactor-APC complex	Low	5	1	118-143	NTTKTPSSTKSKKSLRSKTAKTTLNY	mito(24.5),cyto_mito(14)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAU3	Sulfatase domain-containing protein	Low	6	1	333-353	YWPTRFIRTRRYKYHRNIAWR	extr(10),pero(6),cyto(4.5),cyto_mito(3.5),nucl(3),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNM5	1,4-alpha-glucan-branching enzyme	Low	6.7	1	183-202	SETYKFKNARPKKPASVRVY	cyto(12),cyto_nucl(10.333),cyto_pero(8.833),nucl(7.5),pero(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQ51	Probable dipeptidyl-aminopeptidase B	Low	5	1	754-775	DEVKRQPKAKALTHQWNKRRVE	extr(19),golg(3),vacu(2),cyto(1),plas(1),E.R.(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTW3	Uncharacterized protein	Low	7.5	1	9-32	SQGHSRNKSITKTRPRSSTKGPLD	mito(11),nucl(8.5),cyto_nucl(8),cyto(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUE2	Copper-fist domain-containing protein	Low	9.9	1	47-69	KTDQVRAAKRREKQSRPFCPDCA	mito(16),nucl(5),cyto(3),pero(2)	RAAKRR (52-57, prob:0.654)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUV7	Uncharacterized protein	Low	6.5	1	179-199	AWLFWWKPRQKNKHQREHDAG	extr(7),cyto(5.5),cyto_nucl(5.5),plas(5),nucl(4.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWB4	N1-acetylpolyamine oxidase	Low	6.5	1	268-291	AVDFKPTLPHRKRKTIQQMRVGAY	extr(13),mito(6),nucl(4),pero(1),E.R.(1),golg(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N7Z2	Uncharacterized protein	Low	9.7	1	4-24	AYNQHADRSRRKNRSSSSLNH	nucl(17.5),cyto_nucl(11),mito(5),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7L899	G domain-containing protein	Low	6.2	1	591-611	REISKIKYKMHCSNKATRRAV	cyto(12),cyto_nucl(9.333),cyto_mito(8.833),nucl(5.5),mito(4.5),cysk(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M557	MFS domain-containing protein	Low	5	1	469-493	LASIIKWHLTRKNKKLKAEADRLGV	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M8F6	DnaJ like subfamily C member 3	Low	5.8	1	242-262	PDSKICKKLHKQEKKVEKAYK	extr(10),cyto(7.5),cyto_nucl(5.5),mito(5),nucl(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M8R9	Uncharacterized protein	Low	9.6	1	352-380	ARLRASRVANPEKPRRRWRMLRAYYHAYQ	mito(7.5),cyto_mito(6.5),nucl(5),cyto(4.5),plas(4),pero(4)	PEKPRRR (362-368, prob:0.706)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M948	CAP10 domain-containing protein	Low	5	1	410-430	GYSRNGRWRHQHRQRLVQKIN	extr(7),golg(7),E.R.(4),mito(3),pero(3),cyto(1),plas(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEJ2	Uncharacterized protein	Low	5	1	12-31	VPEWRIKYLNYKQGKKHIKA	plas(25)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQN1	Peptidase_M14 domain-containing protein	Low	5	1	187-206	STNSCWRKNRNPKSSKGNPD	cyto(12.5),extr(10),cyto_nucl(7),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQW6	Uncharacterized protein	Low	7.8	1	14-40	TLNPNPTRVRDNQRRHRARVKARTESL	mito(14),nucl(9.5),cyto_nucl(7),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSH7	MFS domain-containing protein	Low	5	1	458-480	AATLWWIKRDNRKRASRPAEAEL	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N1E7	Fungal_trans domain-containing protein	Low	9.9	1	8-41	RMRNRKTSEICAQCRNRKRPTCSRCSDRGSPCHY	nucl(17),mito(9),cyto_nucl(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NGN7	AMP-binding domain-containing protein	Low	5	1	434-454	IAVPKRPLRRTEKGTISRRAA	cysk(19),cyto(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LBG5	ANK_REP_REGION domain-containing protein	Low	5.9	1	593-616	QKDKGVTKMPQRWHKNDRHPTLYE	cyto(19.5),cyto_nucl(12),nucl(3.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYH3	AGC/NDR/NDR protein kinase	Low	9.8	1	52-71	SKRWTPFRGAFKNMRKNARS	mito(13),nucl(12)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBS8	Uncharacterized protein	Low	6.1	1	232-251	NVTQKTKKVKMTPLKIVQKA	cysk(13),mito(6),cyto_nucl(5),nucl(3.5),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MF00	F-box domain-containing protein	Low	9.6	1	196-236	DLWVCRCRRVWQKPNCLQCPDCSSTCPLRPKRRWCGCDYSS	nucl(12),mito(9),cyto(3),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJP9	Uncharacterized protein	Low	8	1	552-576	PKSPSGKILRRLLRDKEREKRRAEG	cyto(17.5),cyto_nucl(10),cysk(5),pero(2)	SGKILRRLLRDKEREKRRAEGAKL (556-579, prob:0.921)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MP78	Glyco_transf_28 domain-containing protein	Low	9.2	1	524-548	WTYDAKRLDKKDRKRFKNGLRLSPR	mito(8.5),cyto_mito(8.5),cyto(7.5),nucl(4),plas(4)	DKKDRKRFKN (532-541, prob:0.77)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRI0	Phosphate system cyclin PHO80	Low	8.7	1	24-44	SSPQHSSKPSPALRRRPSTRS	mito(13),nucl(11.5),cyto_nucl(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MS80	Nitrilase	Low	6.5	1	276-297	EIALPKSPSRRRRKSVFDEDGN	cyto(10),cyto_mito(9.333),cyto_nucl(8.833),mito(7.5),nucl(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MXI5	Zn(2)-C6 fungal-type domain-containing protein	Low	7.5	1	3-32	PATGKQELSCKRCRYRKLRCTRTIPCTNCA	mito(9),nucl(7),plas(6),cyto_mito(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MYW9	Uncharacterized protein	Low	7.7	1	82-104	SDKRFKLTMTARRRERYRRHIDQ	mito(17),nucl(7),plas(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0A1	Aa_trans domain-containing protein	Low	8	1	116-139	REPGGFRRYHLQRRARQRRMSGYT	plas(25)	RRRSSKRMR (191-199, prob:0.698)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NCN3	Carboxylic ester hydrolase	Low	5	1	60-83	AEPPLKSLRFQPPKRKHSSEHIPA	extr(20),mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M4W9	Dolichyl-phosphate-mannose--protein mannosyltransferase	Low	5	1	33-57	QTTAVTTKNKSKPKNTKNTSYQSDG	plas(24),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5Y5	ANK_REP_REGION domain-containing protein	Low	8	1	260-284	PNEICRAAWRRRHRVKNFFKKLPGK	cyto(13),mito(5),plas(5),pero(3)	RRRHRVKNFFKKLPG (269-283, prob:0.724)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6C0	Uncharacterized protein	Low	5.8	1	840-859	SHNHQQQRHNHQQQQQQNPW	plas(11),extr(9),E.R.(3),nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MA70	Endonuclease	Low	5	1	309-331	LEFATKLPPQRRRRLCSDHTCAL	extr(13),mito(7),cyto(3),pero(3),cyto_pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMZ3	Alcohol dehydrogenase (NADP+)	Low	5	1	11-31	CVDSPKTWNKFQKQTLTPKTW	cyto(23.5),cyto_nucl(13)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNM2	Zn(2)-C6 fungal-type domain-containing protein	Low	6.2	1	8-31	RPVSCNFCRVRKLRCSREFPCSNC	plas(13),mito(7),nucl(3),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUF7	Uncharacterized protein	Low	6.1	1	91-117	NLGEPTKKVYRRKYIKGLKKHVNQEVT	pero(9),cyto(8),cyto_mito(7.333),cyto_nucl(6.833),mito(5.5),nucl(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N2E2	Uncharacterized protein	Low	8	1	133-152	HHHFHLREKHRQRLERRKSL	mito(10),plas(6),E.R.(4),extr(3),pero(2)	KHRQRLERRKS (141-151, prob:0.718)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LRJ4	Uncharacterized protein	Low	6.8	1	16-37	AAPHGERRYKFRRRSQGKDYCG	cyto(11),cyto_nucl(10.833),cyto_mito(8.499),nucl(7.5),mito(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDQ8	Methylsterol monooxygenase	Low	8	1	237-260	EAGAEAHKRRREKKLAQIKAKKAQ	mito(8),plas(7),cyto(4),E.R.(4),extr(2),cyto_pero(2)	HKRRREKKLAQIKAKKAQ (243-260, prob:0.952)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFB0	Alpha-1,3-glucosyltransferase	Low	8	1	1-28	MAGPSPSPHKPRRKANTKKPGNGNGNGG	plas(24),E.R.(2)	PHKPRRKANTKKPGN (8-22, prob:0.897)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MGZ9	Uncharacterized protein	Low	6.1	1	250-272	SWKGHELKSRRSRDKEKKDGTVS	cysk(9),cyto(7.5),cyto_nucl(6),pero(5),nucl(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0V6	Uncharacterized protein	Low	5	1	254-273	MFNARHPRRYLPKNNKIYLS	plas(22),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N4D7	Potassium/sodium efflux P-type ATPase, fungal-type	Low	8	1	239-260	ASTSKKTRKAGRSMNYKKYGKR	plas(21),E.R.(2),cyto(1),golg(1),cysk(1),vacu(1)	KKTRKAGRS (243-251, prob:0.693)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N992	Arginyltransferase	Low	9.2	1	26-48	KSSRCGYCGKRDKSQSKRYAYHA	nucl(15.5),cyto_nucl(12),cyto(7.5),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NA53	Uncharacterized protein	Low	9.9	1	92-112	FEKYSDRRSEWKNRKQFRVEV	nucl(18),cyto_nucl(13),cyto(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LMV2	Alanine--tRNA ligase	Low	6.9	1	21-42	SFSGCGRWSWRCRPRSLRTIIG	mito(14),cyto(7),nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LQ01	Arrestin_C domain-containing protein	Low	6.7	1	261-280	FLEPISKRNRRRKSMVMDKS	mito(17),nucl(5.5),cyto_nucl(5.5),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LU83	Calcium-transporting ATPase	Low	5	1	341-365	DYQKERQFTKLNKKKQDRLVKVIRS	plas(19),E.R.(3),golg(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LXN4	Zn(2)-C6 fungal-type domain-containing protein	Low	7.3	1	17-46	PERAHRACEKCTRTKKKCDKALPACSRCTR	mito(14),nucl(6),cyto(4),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M498	Peroxisomal biogenesis factor 6	Low	9.4	1	1-31	MASPSKPALSSNRRRNRRRRQDKPAITAKLV	mito(20.5),cyto_mito(11.5),nucl(5)	NRRRNRRRRQD (12-22, prob:0.867)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M9C4	ANK_REP_REGION domain-containing protein	Low	7.8	1	411-436	STIMKFIYLKWKKKDRKNQSLTASFF	nucl(8),mito(8),mito_nucl(8),cyto(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAK5	Carboxylic ester hydrolase	Low	5	1	518-537	MDPNHWRKVKKSRALELPDS	extr(12),mito(8),cyto(3.5),cyto_nucl(2.5),plas(1),pero(1),golg(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MID9	Uncharacterized protein	Low	5	1	9-32	SAAANRSQTKKQKFKTFMRQWFLV	plas(15),mito(5),E.R.(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIY1	Uncharacterized protein	Low	9.4	1	97-138	HSPVAARKVSRKPKGKGKKARKYKKPKKSKKQDTKDPATDEI	cyto(11.5),cyto_mito(10.333),cyto_nucl(9.666),mito(7),nucl(6.5)	ARKVSRKPKGKGKKARKYKKPKKSKK (102-127, prob:0.999)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVX3	Uncharacterized protein	Low	6.8	1	30-49	HARTRKQRMVHYQGQKRQQS	mito(17.5),cyto_mito(10.333),nucl(7.5),cyto_nucl(5.333)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LLN1	Atypical serine/threonine protein kinase BUD32	Low	6.5	1	57-76	ALKYRPPKPWRHPILDQRLT	cysk(11),cyto(5.5),cyto_nucl(5.5),nucl(4.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LUH0	Uncharacterized protein	Low	8.8	1	6-25	GNNHERQQRRAPRPINEQSL	nucl(12.5),cyto_nucl(8.5),mito(8),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LV21	Uncharacterized protein	Low	5	1	1-21	MRDKSKWTKTPKKRDLGLTRF	mito(18.5),mito_nucl(11.5),cyto(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MH07	Uncharacterized protein	Low	5.3	1	431-457	IKTKPHVLFSWRRQRCRENSSKEMDGK	plas(24),nucl(1),mito(1),cyto(1),cyto_nucl(1),cyto_mito(1),mito_nucl(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MK40	STE/STE20/YSK protein kinase	Low	8.9	1	557-577	ASNNPHLRSHRRRHADTPTMY	nucl(12),cyto(9),pero(5),cyto_mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMR5	Uncharacterized protein	Low	5	1	24-46	LTVWEAWKQTRRNRNPLRSTYIY	plas(17),mito(5),E.R.(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUK2	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial	Low	6.6	1	2-26	ATRHITRKLWQPKFPIKHQRRGLAL	mito(15),cyto_nucl(6),nucl(5),cyto(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N150	RNA-dependent RNA polymerase	Low	8.5	2	58-79, 111-130	LERHGKQQRHDQPQKENINPRY, KHSIAHLKHEREKKQQKAAA	cyto(12),pero(5),cysk(5),nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LGV6	Uncharacterized protein	Low	8.7	1	162-194	TESEPLRIKIKKKRRQRRMRQAKSKHRYTILRI	mito(18.5),mito_nucl(11.333),cyto_nucl(3.833),cyto(3.5),nucl(3)	RIKIKKKRRQRRMRQAKSKH (168-187, prob:0.993)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LLM0	Uncharacterized protein	Low	9.4	1	346-366	SSPPRDRQKPATTSRNSRPRV	cysk(15),nucl(4.5),cyto_nucl(4.5),cyto(3.5),mito(2),pero(2)	SRIPPLEARRVAREAAEKRRARPGTGSGKRLGGSAPRPG (142-180, prob:0.972)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LNE7	Isocitrate lyase	Low	6.6	1	28-47	KAWWSDSRWRHTKRPFTAEQ	cyto(10.5),pero(9),cyto_nucl(8.5),nucl(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M0W4	Uncharacterized protein	Low	5	1	301-322	SQEKNSKKSNSHSQEKRKSHTL	plas(22),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJX8	Uncharacterized protein	Low	7.4	1	1215-1234	WFQHGLKKHDGKKLNSKVMT	plas(12),nucl(6),E.R.(4),golg(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NC66	Uncharacterized protein	Low	5.3	1	31-52	QVNPAKKDKAAQRKIRQHVMKD	plas(17),E.R.(5),cyto(2),nucl(1),golg(1),vacu(1),cyto_mito(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LKL5	Beta-N-acetylhexosaminidase	Low	6.7	1	37-62	EPEPQQKRSKYHVTRHRRRPTIMAHT	mito(12),cyto(7.5),cyto_nucl(7),nucl(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZ72	5-oxoprolinase (ATP-hydrolysing)	Low	6	1	1329-1348	GSESRAKKKIDHTEGWRKGS	mito(13),cyto(10.5),cyto_nucl(7.5),nucl(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2F1	Murein transglycosylase	Low	5	1	411-436	FTTATSKTTKHKTTKKVYPTVKPGIF	extr(21),mito(3),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3U0	Peptidase A1 domain-containing protein	Low	8	1	467-486	SLYFRRKRKRAAKGNDLPAE	extr(25)	RRKRKRAAK (471-479, prob:0.805)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRZ2	Uncharacterized protein	Low	5	1	3-27	NSDGKSFPPRKWYRRVPFLSAKPIQ	plas(21),mito(3),cyto(1),pero(1),E.R.(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MV44	SAC domain-containing protein	Low	9.8	2	767-788, 844-864	EVDHGDKKKSKKDAHPHANVTS, NIAPRRSQQPWRNPRLHNGLS	nucl(10),cyto_nucl(10),cyto(8),pero(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVR8	Uncharacterized protein	Low	9.9	1	71-90	GLLPKPKPKPQQKSLPYSKQ	nucl(16.5),cyto_nucl(10.5),mito(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YBJ2	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	16-40	APQNCNTCVRRRIKCDRSVPSCLKC	nucl(12),plas(5),cyto(4),mito(3),cyto_pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LFQ4	Zn(2)-C6 fungal-type domain-containing protein	Low	7.2	1	31-58	QKNSLACERCFRRKQKCDRLRPACTSCA	cyto(9.5),cyto_nucl(9),nucl(7.5),mito(4),plas(2),extr(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LFY3	FMN hydroxy acid dehydrogenase domain-containing protein	Low	8	1	215-237	AKEKGNSKDNKQKKKQSRAASAA	mito(13.5),cyto_mito(8.5),cysk(5),pero(3),cyto(2.5)	KGNSKDNKQKKK (218-229, prob:0.732)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LPS2	Uncharacterized protein	Low	5	1	190-216	AVFVTCCSGRRRRNRENKKMATYNSSP	plas(17),mito(3),vacu(3),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LQ69	Uncharacterized protein	Low	5	1	31-51	RPDVEPRRRRHSFFIPRRRSI	plas(22),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LS16	ANK_REP_REGION domain-containing protein	Low	6.6	1	1-20	MPIRKKLKKIFHHRNAEGVS	mito(12),nucl(4.5),cyto_nucl(4.5),plas(4),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1I8	Mitochondrial 18 kDa protein	Low	6.1	1	1-23	MSWWGKSKDPKPEEKKNEATQIK	cyto(8.5),plas(8),cyto_nucl(6.5),mito(5),nucl(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3N3	DNA replication ATP-dependent helicase/nuclease	Low	9.4	1	951-985	TATGPTQRIKSPRKKASGKENRRRSPKTARISDKA	mito(15),cyto(6.5),cyto_nucl(6),nucl(4.5)	RIKSPRKKASGKENRRRSPKTARISDK (958-984, prob:0.98)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M8X5	Succinate-semialdehyde dehydrogenase	Low	5	1	61-85	DAAFKTYRKTPARQRARYLRRWYDL	cyto(19),cyto_nucl(11.5),pero(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTX7	26S proteasome regulatory subunit RPN2	Low	8	1	959-982	LSTTAQAKRRAQKKERAQRRESME	mito(14),cyto_mito(12.666),mito_nucl(9.832),cyto(8),cyto_nucl(6.832)	KRRAQKKERAQ (966-976, prob:0.733)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NB24	Glyco_trans_2-like domain-containing protein	Low	5	1	289-311	NTWTMWSMKKRNRPKLRLTGNDV	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NEG0	Zn(2)-C6 fungal-type domain-containing protein	Low	6.6	1	7-31	RATLSCSSCRQRKLKCDRDEPCSNC	mito(21),nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LRC4	Oxidoreductase	Low	8	1	394-413	VKWPIQYHRAPPKPRGPHSK	cyto(19.5),cyto_nucl(11),pero(5)	KPRGP (406-410, prob:0.624)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3V1	Zn(2)-C6 fungal-type domain-containing protein	Low	9.7	1	1-46	MQTKTSTKPNCRRASKTKNGPNPRSRSGCVTCKAKHTKCDETRPEC	nucl(16.5),cyto_nucl(10),mito(6),cyto(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5X8	60S ribosomal protein L27-A	Low	9.8	1	49-72	PSKITRRMSKTRQEKRNKIKPFIK	mito(17),nucl(6),cyto_nucl(6),cyto(4)	KTRQEKRNK (58-66, prob:0.654)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRX1	Uncharacterized protein	Low	9.8	1	54-76	FPVAVAKKHKRSQQNRPGTPTKT	mito(9.5),mito_nucl(8.5),cyto(7),nucl(6.5),plas(2),pero(2)	RARKPPVKLGFPVAVAKKHKR (44-64, prob:0.737)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MS77	Beta-glucosidase	Low	5	1	26-48	KGPTERPQCKKATKTHEPKYTYT	extr(22),pero(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVJ1	Rab-GAP TBC domain-containing protein	Low	9.9	1	674-701	KASPASNKLPPPQHKKKMSNSVSREKNA	nucl(16.5),cyto_nucl(10),mito(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWE7	Uncharacterized protein	Low	5	1	22-42	DLVLGKRHTHRQPLTKRNADW	extr(22),cyto(1.5),cyto_nucl(1.5),mito(1),E.R.(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NEH0	Uncharacterized protein	Low	8.1	2	55-89, 364-384	EESNRSKPPQKTSPKEPFHRRPQHKDDDDKKKDQS, PPTAKPGKTWHGKKRKTCIHD	mito(7),golg(6),cyto(4),nucl(3),plas(2),extr(2),E.R.(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LAT5	Ribosomal protein	Low	6.9	1	59-84	HSSVKKRCEHCKVVRRKAGKRHNGYL	mito(19),nucl(5),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LGJ1	Fungal_trans domain-containing protein	Low	6.5	1	17-39	ACEICRERKVRCDRALPKCRFVP	plas(15),nucl(4),mito(4),mito_nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZC0	Uncharacterized protein	Low	7.5	1	325-348	RYGAVHFRQKREKIERKEACEPRT	pero(9),nucl(8.5),cyto_nucl(8.5),cyto(7.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M041	O-acyltransferase	Low	5	1	40-62	NGTATTKTPKKPGQKYRHVAAVH	plas(24),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6C7	Pex24p domain-containing protein	Low	8.9	1	462-491	NEDGSGRRGDWRRRRWVRLVKRKAAQVQPS	plas(19),nucl(2.5),cyto_nucl(2.5),vacu(2),cyto(1.5)	GRRGDWRRRRWVRLVKRK (467-484, prob:0.875)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MDS2	YL1_C domain-containing protein	Low	9.6	1	22-47	STHKNFRSPTWKPNQRRNKNLKAIVG	nucl(17),cyto_nucl(12),cyto(5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MLE9	Mitochondrial intermediate peptidase	Low	8.1	1	649-669	QDDPWDRPKWQRFRFKVLQYG	nucl(11),cyto_nucl(11),cyto(9),cysk(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPJ4	TRAM domain-containing protein	Low	6	1	42-77	NGNAQQVNKRPNQQNNRQWKQKKTKREKNITEGSSE	mito(21),nucl(3),cyto(3),cyto_nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQH0	Fungal_trans domain-containing protein	Low	9.8	1	2-22	PCTFLTARKPRGPPNRRVAEA	nucl(16.5),cyto_nucl(10.5),mito(4),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MS26	Uncharacterized protein	Low	8	1	617-643	LVLCVVFSCIRKRRRRQKGTQLQSGNI	extr(19),cyto(4),mito(1),pero(1),E.R.(1),golg(1)	KRRRR (628-632, prob:0.682)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N4S0	Fe-ADH domain-containing protein	Low	9.5	1	57-84	PGTVQRPSSRSRHRRSKRPSSSSPRLVV	mito(12),cyto(9.5),cyto_nucl(9),nucl(5.5)	SRSRHRRSKRP (65-75, prob:0.821)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N6E5	Amino_oxidase domain-containing protein	Low	5	1	103-128	VGRSEPQRLHRVRRRNIQKRGTDSIL	plas(16),E.R.(5),extr(3),mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M591	Zn(2)-C6 fungal-type domain-containing protein	Low	9	1	36-59	SVACDDCKKKKLKCIPSEDNACER	nucl(14.5),cyto_nucl(10),cyto(4.5),plas(4),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M9V0	Alkylated DNA repair protein alkB like 6	Low	8.1	1	42-65	DKISSAPKPRWKQLTKRRLQTWPS	cyto_nucl(12),nucl(11.5),cyto(9.5),mito(2),extr(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNU8	Uncharacterized protein	Low	8.8	1	61-80	SNYPEKKRWQAKGKGEPKNT	nucl(10),mito(8),cyto_nucl(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MT61	Zn(2)-C6 fungal-type domain-containing protein	Low	9.7	1	1-35	MEDSRPTKRARQACEPCRRKKSKCPGEKPVCSYCE	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MY66	Uncharacterized protein	Low	9	2	61-80, 547-570	DAILRFLRIRKPRRNDIYDL, QYPGTFFYYRWRNNQKAKKWDAMT	mito(9),nucl(5),plas(5),cyto(4),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NAZ3	Uncharacterized protein	Low	5	1	33-56	STSTCTRARPWRCRWLQRTRGSSC	plas(19),mito(4),cyto(1),E.R.(1),golg(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M159	Zn(2)-C6 fungal-type domain-containing protein	Low	8.5	1	42-66	AKVECVYSQRARPKRQKNLESEGSS	nucl(13),cyto_nucl(10),mito(9),cyto(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7U5	Zn(2)-C6 fungal-type domain-containing protein	Low	8.9	1	2-38	PTMPPKKRAYVPKTKGCHECSKRRIHCDRNEPSCNKC	nucl(11),plas(8),mito(3),cyto(3),cyto_mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M8I4	Mediator of RNA polymerase II transcription subunit 5	Low	7.9	1	121-141	KSDDKEKDEKKQKITRWKSSY	cyto(11.5),cyto_nucl(11.5),nucl(10.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MD04	Zn(2)-C6 fungal-type domain-containing protein	Low	6.3	1	23-50	PFSCLLCRKSKLKCDRTRPSCSRCSKQG	cyto(6),extr(6),nucl(4),pero(4),cyto_mito(4),E.R.(3),mito_nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEM3	Uncharacterized protein	Low	8.3	1	1-21	MAGPRRPKRLQSCSKPDQDKV	nucl(11.5),cyto_nucl(9.5),mito(7),cyto(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MI38	Metallophos domain-containing protein	Low	5	1	191-210	LTVRRGPPREVKKPTPRINS	extr(14),mito(5),E.R.(4),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTA2	Tyrosine--tRNA ligase	Low	8	1	341-368	VTLKAYPPPVKKEKKVKNRGTRFPGAKG	cyto(25.5),cyto_mito(13.833)	VKKEKKVKNRGTRFPG (350-365, prob:0.863)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7L8W2	MFS domain-containing protein	Low	5	1	466-485	IVSLRWYLRRENKKRDALAE	plas(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LG04	5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase	Low	5	1	513-535	RVLGIKWKKGTKRPDKSNAIDLL	mito(21.5),cyto_mito(13.5),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LIG9	Uncharacterized protein	Low	5.9	1	1449-1470	QRKALFTARKLRQKKIEKTLLE	extr(10),cyto(7),cyto_nucl(6),nucl(3),E.R.(3),mito(1),plas(1),pero(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVY1	Uncharacterized protein	Low	8.9	2	1-25, 57-82	MAGRKPKARYRNKNKQNVPGNIPVN, MKVTPICKPENRRRYGPKESRERLES	mito(15.5),cyto_mito(10),nucl(7),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1J9	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	7-40	QVKSTRVGYKKSRNGCIRCKKRRVKCDEDVPCSA	nucl(11),cyto(8),mito(3),plas(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M8R3	5'-3' exoribonuclease 1	Low	9.9	1	87-107	DGVAPRAKMNQQRSRRFRTAL	cyto(12.5),cyto_mito(8.5),nucl(6),pero(5)	PRGRGRGRGRGGRGRGGASRGRG (1382-1404, prob:0.986)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MD25	HET domain-containing protein	Low	9.4	1	243-269	VPLWMSIRKKATKRKWDAKFKDEWRFE	cysk(16),cyto(5.5),cyto_nucl(5.5),nucl(4.5)	KKATKRK (251-257, prob:0.638)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ME17	Ubiquitin-like 1-activating enzyme E1 B	Low	6.6	1	52-71	NESRKRTPAMTRDRHNQQSL	cyto(15),cyto_nucl(11.5),nucl(6),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFG1	Uncharacterized protein	Low	8.7	1	53-78	GGVGGRRWWKNRRHEREQGRKLVRTN	mito(11),plas(9),nucl(2),E.R.(2),cyto(1),extr(1),pero(1),cyto_pero(1)	KNRRH (62-66, prob:0.627)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHG5	Endoglucanase	Low	8	1	333-358	ATKPAKTGCKAKRGMKARRHARDLMN	cyto(12.5),extr(12),cyto_nucl(7)	KAKRGMKARRH (342-352, prob:0.774)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSJ1	Uncharacterized protein	Low	6.2	1	1989-2008	DFPKLPSRKIDRKALKKMLD	plas(16),cyto(4),nucl(3),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LPI7	HeLo domain-containing protein	Low	9	1	116-139	VTGSKPRKSPSPSRKRSKDDESRG	cyto(21),cyto_nucl(13.5),nucl(4)	KPRKSPSPSRKRS (120-132, prob:0.768)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M4F2	Uncharacterized protein	Low	6.2	1	637-657	APAMMIRKELQRRRIQKRASS	mito(21),nucl(3),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5A0	HET domain-containing protein	Low	8.2	1	217-240	AILSDTSRRKRNRRYTEQQFRVLH	nucl(10.5),mito(8),cyto_nucl(8),cyto(4.5),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MB51	Uncharacterized protein	Low	8	1	265-287	SAPPRGAGKKKERHGHNPNRLMD	mito(12.5),cyto_mito(11.999),cyto(10),cyto_nucl(8.333)	RGAGKKKERH (269-278, prob:0.769)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEX5	TatD DNase	Low	8	1	343-371	AAESTQKPQKQSKKNQKKEPEVPERYKTV	mito(23.5),cyto_mito(13.666),mito_nucl(13.499)	KKNQKK (355-360, prob:0.634)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFI7	Uncharacterized protein	Low	8	1	204-228	PNVDPAKKPPVRKKRKIPRSGGPAA	plas(16),E.R.(5),mito(4)	AKKPPVRKKRKIPRSGGP (209-226, prob:0.982)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHS5	GPI inositol-deacylase	Low	5	1	84-104	ARTPTQSPSPNRRIPRPRFSI	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIW2	CDH-cyt domain-containing protein	Low	5	1	1-26	MPLLRNIHTRRTTRQRHINPHRILAT	mito(17),extr(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJ87	Zn(2)-C6 fungal-type domain-containing protein	Low	6.2	1	14-38	GGACVRCRKGKTKCVYENGRAPCKN	mito(23),nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJD6	Cation-transporting ATPase	Low	8	1	1310-1334	GSVKQSVTGKAKKRKEYKVIAEGSR	plas(23),golg(2)	AKKRK (1320-1324, prob:0.656)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQF3	Zn(2)-C6 fungal-type domain-containing protein	Low	7.4	1	5-33	QSSRRKACDYCRARKIRCDGRKPICSNCT	plas(15),nucl(7),mito(1),cyto(1),pero(1),E.R.(1),golg(1),cyto_mito(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQN8	Uncharacterized protein	Low	9.9	1	539-566	DEAARRARQPSVRQRWPSARKGPPNMET	nucl(19),cyto_nucl(13.5),cyto(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQS3	Uncharacterized protein	Low	6.4	1	14-39	LQHACSLCPKRFKRRSHLVRHAATHS	mito(7),cyto(6),plas(6),nucl(4),extr(3),cyto_pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MXV8	Uncharacterized protein	Low	5	1	603-628	EEVPERRPLSRRKSTKDQLPRATQAR	plas(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N3G3	Uncharacterized protein	Low	9.9	1	580-607	VRAVQRRHILTLRKKKKRSKQQKIKLKV	plas(19),nucl(5),cyto(2)	LRKKKKRSKQQKIKLKV (591-607, prob:0.985)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LSK0	Zn(2)-C6 fungal-type domain-containing protein	Low	8.2	1	1-21	MPPRRACDTCYKRKIQCLIKT	mito(11),nucl(10.5),cyto_nucl(7.5),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LSU3	RING-type domain-containing protein	Low	9.6	1	355-375	ESEGWKRCSRCRHLIEKIDGC	nucl(17.5),cyto_nucl(13),cyto(5.5),cysk(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LT88	Uncharacterized protein	Low	8	1	1153-1177	GGEFQRDRKPRTPAEKKKTRTEASL	plas(6),extr(5),E.R.(5),mito(3),golg(3),vacu(2),cyto_mito(2),mito_nucl(2)	KPRTPAEKKK (1161-1170, prob:0.659)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTF2	Zn(2)-C6 fungal-type domain-containing protein	Low	6.8	1	1-34	MSSRRTHTKSRTGCINCKKRKVKCDEARPSCFHC	plas(11),mito(7),nucl(5),cyto(1),extr(1),pero(1),E.R.(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LV61	G domain-containing protein	Low	5	1	317-338	PPLSLNQAKKQKKQAIAQERAG	cyto(15.5),cyto_pero(9.5),mito(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MB47	Uncharacterized protein	Low	7.4	1	408-427	RVKKQFPQLKQQPKLRSPPR	cyto_nucl(9),nucl(8.5),cyto(8.5),mito(4),pero(3),cysk(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ME52	ANK_REP_REGION domain-containing protein	Low	8.8	1	669-689	DAYPRVPRYNRNYRRKDFERL	nucl(15.5),cyto_nucl(12.333),cyto(8),cyto_mito(5.333)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEG4	Uncharacterized protein	Low	6.6	1	22-42	GIIKRFCAPPKRRSNVRFGHL	cysk(14),nucl(5),cyto(4),pero(4),cyto_pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEY8	Uncharacterized protein	Low	5	1	82-105	YIKQTVPKPAHKQKPKNETQEWKQ	mito(21.5),cyto_mito(13),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NG89	Uncharacterized protein	Low	6.3	1	31-53	YGLYRMIQPKKKHNLPVFRLRDN	mito(14.5),cyto_mito(10.333),cyto_nucl(5.833),nucl(5.5),cyto(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LSR7	Uncharacterized protein	Low	7.4	1	336-357	QSKRVTPKYKDPLKLREPKKEM	cyto_nucl(9),nucl(8.5),cysk(7),cyto(6.5),pero(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MB42	Zn(2)-C6 fungal-type domain-containing protein	Low	9.8	1	15-40	NHGIKRGTACERCNRRRTKCDGSVTG	nucl(12),plas(5),cyto(4),mito(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKI6	Uncharacterized protein	Low	5	1	235-258	NAELRPTEKGPKRKQEPIKLAKEI	plas(22),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQM6	Uncharacterized protein	Low	7	2	1227-1250, 1404-1423	MVTYKWPHWLRQQKEKQREIWGYK, CNNPQTKEPKLDRARRQVPE	mito(7),extr(7),E.R.(5),cyto(4.5),cyto_nucl(3),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSN0	Zn(2)-C6 fungal-type domain-containing protein	Low	8.1	1	27-49	CDHGQPTCSRCRKRNETCVYTVS	nucl(12.5),cyto_nucl(8.833),mito(8.5),cyto_mito(6.833),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTB0	Uncharacterized protein	Low	8	1	32-84	YQAPKAPKPHYEKPKPKPHHEKPKHEYPAPKPHHEKPKPKPHPKKPEYPAPHH	extr(13),E.R.(4),mito(2),cyto(2),golg(2),cyto_mito(2)	KAPKPHYEKPKPKPHHEKPKHEYPAPKPHHEKPKPKPHPKKPEYPAPHHEKPKPAPKP (36-93, prob:0.998)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUN0	Zn(2)-C6 fungal-type domain-containing protein	Low	7.8	1	24-43	CLVCRRRHLKCDGERPCSRC	cyto(8),nucl(7),mito(5),cyto_pero(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MVE1	Zn(2)-C6 fungal-type domain-containing protein	Low	7.8	1	4-27	LQDCKTCSLRRIRCDRTTPHCLKC	mito(14),nucl(9),cyto_mito(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MYV7	Zn(2)-C6 fungal-type domain-containing protein	Low	9.5	2	9-49, 538-558	VQYRSACAECHRRKQKCNREWPCNHCQKRKVADKCRFVQPT, QKMPRRSPPPRETVNRKKQRV	plas(17),nucl(7),mito(1),cyto(1),vacu(1),cyto_mito(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N1D5	Alpha-galactosidase	Low	9.3	1	244-265	EYPKGAPKVKAKDKKKICSTSG	cyto(11),cyto_nucl(8.833),cyto_mito(7.333),extr(6),nucl(5.5),mito(2.5)	PKVKAKDKK (250-258, prob:0.692)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N6D4	Uncharacterized protein	Low	5	1	22-42	VVCRLISRRMKLRKWSRLAIE	plas(20),E.R.(4),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1F4	Zn(2)-C6 fungal-type domain-containing protein	Low	9.8	1	18-43	ASALKARKACINCRKQKMKCVLQGSS	nucl(16.5),cyto_nucl(10.5),pero(4),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBB2	SF3b1 domain-containing protein	Low	9.9	1	207-230	TTEASSTARKRKKRWDVSSAPAED	plas(17),nucl(5.5),cyto_nucl(4.5),cyto(2.5)	KRKK (216-219, prob:0.66)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRL2	Protein SSH4	Low	5	1	486-506	SDSARSPPPNRTPSNRPRSST	extr(16),cyto_mito(4.833),mito(4.5),cyto(4),cyto_nucl(3.833)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MW68	MFS domain-containing protein	Low	5	1	442-465	LNVLWCAKTNRDKKNGKYNQYTGY	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N1W9	HET domain-containing protein	Low	9.6	1	460-486	TTSFYRYIQPHGKKRHRQPTKRSLEWL	nucl(17),cyto_nucl(13),cyto(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N6H4	NAAA-beta domain-containing protein	Low	6.9	1	337-364	DLDKLWKKCVRNCRRRYKLRNDVVTRED	cyto(10.5),cyto_nucl(10),nucl(6.5),mito(4),plas(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N7Q8	Uncharacterized protein	Low	9.4	1	487-506	LPDGRRKIRTHKYKYTTGMW	nucl(15.5),cyto_nucl(10.5),mito(5),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7L917	Uncharacterized protein	Low	8	1	18-43	PHLVISPAKRHNRKARKNQHSTPHVP	mito(17.5),cyto_mito(10.833),extr(4),cyto(3),cyto_nucl(2.833)	KRHNRKAR (26-33, prob:0.671)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LK49	Uncharacterized protein	Low	5	1	172-193	AMRRTLVSRKDRQRRIAQNAEM	extr(24),plas(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LUG6	AAA domain-containing protein	Low	9.1	1	96-115	KYAVIIRKRKPKEADSNKPL	cyto(13),nucl(11),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3Q5	Atypical/ABC1/ABC1-C protein kinase	Low	5	1	479-500	QVLERLRPYRHRKDPKAWEAEL	mito(11),cyto(8),plas(5),cyto_nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MU61	F-box domain-containing protein	Low	9.8	1	142-162	SVDWKRQYKLRHNWARGKCAV	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWR3	HET domain-containing protein	Low	7.3	1	671-690	KFLARFRRPFQKGKQCSRAM	cyto(11),cyto_nucl(10.5),nucl(8),pero(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0E8	Plasma membrane ATPase	Low	5	1	887-909	FDNLMHGKSPKQNQKQRSLEDFV	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MLG3	Uncharacterized protein	Low	5	1	332-355	YYQLRRPPTLAHHRPRTNRTYKSF	plas(18),E.R.(5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNE6	APH domain-containing protein	Low	5.4	1	237-259	GSLQRWKWKRVLEKQRRKSTGRF	E.R.(7),golg(7),extr(5),mito(4),nucl(1),cyto(1),plas(1),cyto_nucl(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LPW5	Carboxypeptidase Y receptor	Low	5	1	1266-1292	DCLFGHKAKYLRKKTDRKCYNQASMSR	extr(8),plas(7),E.R.(6),golg(3),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LY46	Uncharacterized protein	Low	6.5	1	58-78	LWSICNKKTSTKAPWRWPSII	plas(9),cyto(7.5),cyto_nucl(6.5),nucl(4.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M181	Uncharacterized protein	Low	9.7	1	1168-1191	HEDEKEDKEKKKKGFLSRFKRSNS	extr(10),cyto(6.5),cyto_nucl(6.5),nucl(5.5),mito(3)	KEKKKKGFLSRFKR (1175-1188, prob:0.835)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MB31	MFS domain-containing protein	Low	5	1	520-543	FAKGYYTSRNKSKRSKWESMTTHE	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MB48	TLC domain-containing protein	Low	5	1	60-79	SPTTTAPRPRLKKDNSTPNM	plas(19),E.R.(4),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCE1	DNA damage-inducible protein 1	Low	7.5	1	84-108	STGVPEQPRRPQPRRPAQNEQDPEL	cysk(13),nucl(7.5),cyto_nucl(6),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFN5	Vacuolar protein sorting-associated protein 51 homolog	Low	8.7	1	4-23	IASPRDPPRRTPTNSNRPSF	nucl(14),cyto_nucl(11),mito(9),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MP76	Uncharacterized protein	Low	5	1	4-29	AGASAFKSPKIPRRPKTPETRQVHFG	mito(18),cyto(5),extr(3),cyto_pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MY88	Uncharacterized protein	Low	9.7	1	686-710	MAKQARDEKLRKLKKRKDDEDDDMD	cyto(9.5),cyto_nucl(8),plas(7),nucl(5.5),mito(3)	RRGHRAKTMAKQARDEKLRKLKKRK (678-702, prob:0.96)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5Y1	Peroxisomal membrane protein PEX16	Low	7.8	1	16-39	PTTLPSATTNKQKKKPSLGRILSL	nucl(8),mito(8),mito_nucl(8),cyto(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YC07	Uncharacterized protein	Low	5	1	12-36	AGTVSQIKQRYKKEHDKRLRSDGLS	cyto(9),mito(8),plas(4),extr(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1I2	Murein transglycosylase	Low	8	1	324-344	IDWLRSKNGASKKARRHARQF	extr(22),cyto(4)	ASKKARRHA (333-341, prob:0.727)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M4I5	Uncharacterized protein	Low	9.9	1	1-22	MGSEKRKRSGESTKPKKKVVID	cyto_mito(10),mito(9.5),cyto(9.5),nucl(7)	KRKRSGESTKPKKK (5-18, prob:0.763)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6Y3	Uncharacterized protein	Low	9.6	1	475-495	GLSRSTSTRRNPRPQSDQYTG	nucl(18.5),cyto_nucl(13),cyto(4.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEC1	Transformation/transcription domain-associated protein	Low	7.9	1	3437-3461	MYEYIYKLRRWRNKFEEKLDHRIPR	nucl(10.5),cyto_nucl(9.5),cyto(7.5),pero(3),mito(2),plas(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHW0	Glutamate decarboxylase	Low	6.4	1	216-236	AVLAMKKRWKNRRQAEGKSTE	cysk(18),cyto_nucl(4.833),nucl(4.5),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJD1	Uncharacterized protein	Low	8	1	286-312	GCITRDPRTVERKKHGHVKARKMPAWV	mito(21),cyto(6)	ERKKHGHVKARKMPAWVKR (296-314, prob:0.898)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNE8	Uncharacterized protein	Low	9.7	1	396-420	EKLPVVGRRAARRVRKNRDASDDEG	cyto(11.5),cyto_nucl(10.333),cyto_mito(7.666),nucl(7),pero(5)	ARR (406-408, prob:0.618)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQ23	Uncharacterized protein	Low	9.5	1	1-25	MEPSSKKRKLAPKVNTTPSKPPPPT	nucl(16.5),cyto_nucl(11),mito(5),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWK3	Sulfatase domain-containing protein	Low	7	2	513-533, 769-789	FNKLKDDKKSKSKLKWTSKSD, QSLIRPYKAKHNGRRAWNFGI	plas(10),E.R.(7),golg(3),vacu(3),extr(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MXM6	AIP3 domain-containing protein	Low	9.2	1	168-193	INLLHGLKRKQQKLRQKQARDRDGHA	nucl(16.5),cyto_nucl(12),mito(6),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N096	Pyr_redox_2 domain-containing protein	Low	5.8	1	369-388	QIDREKNPGHDQRRKLWRQM	mito(9),extr(9),cyto(5.5),cyto_nucl(4.5),nucl(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N6F7	Amidase domain-containing protein	Low	6.3	1	8-31	PEPQPWQSTVERKKQQQRDILSKA	cyto(11),cyto_pero(9.833),cyto_nucl(8.833),pero(7.5),nucl(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N6L9	Clr5 domain-containing protein	Low	9.5	1	51-74	EDAFRNRIKRNWRDCAKNNRVARG	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LJT6	Uncharacterized protein	Low	9.2	1	1-22	MDCPPCRRRKLWRDLRPECCGQ	nucl(11),mito(9),cyto(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LL45	Uncharacterized protein	Low	6.6	1	964-987	MPRSAFGYRAKRARRPVRFVIEKG	mito(18),nucl(4.5),cyto_nucl(4),cyto(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LV65	S4 RNA-binding domain-containing protein	Low	7.3	1	1-26	MRRPTKYYSLTRPKLRQSWNKYNLFN	mito(16),nucl(6),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LY30	Polyprenol reductase	Low	8	1	54-78	MDYGPRRPKAGKSKSKKGDDEKQNF	plas(8),mito(7),extr(6),cyto(3),E.R.(3)	PRRPKAGKSKSKK (58-70, prob:0.897)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M255	Uncharacterized protein	Low	5.5	1	60-79	PLIPLRPKRRVPKTPFHFLS	mito(21),cyto(2.5),cyto_nucl(2.5),nucl(1.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M8X9	RHOMBOID-like protein	Low	8	1	178-200	IYDAPGRPKKKGKKGKVRLGELG	plas(26)	GRPKKKGKKGKVRLG (183-197, prob:0.984)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MC33	Uncharacterized protein	Low	6.3	1	64-84	LATGRVEKKKNNNNNKKTADH	mito(15),cyto(7.5),cyto_nucl(6.5),nucl(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCN4	Uncharacterized protein	Low	5	1	799-818	KKCVCKDGYKPTKKGCKKDC	extr(19),golg(3),E.R.(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHL8	Uncharacterized protein	Low	9.9	1	79-111	VCCWYPCCRPRLQRQRRRQRRRRGPPAADEEEN	plas(11),nucl(5),mito(5),mito_nucl(5)	QRQRRRQRRRRGP (91-103, prob:0.937)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MQZ4	MFS domain-containing protein	Low	5	1	458-478	WLAKIILKRRNQKLRAQDSET	plas(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N6R0	Aldo_ket_red domain-containing protein	Low	5	1	299-321	ELKEVAKKDKKYRFLNPGKDWGV	extr(16),E.R.(4),cyto(3),golg(2),cyto_mito(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LU01	Uncharacterized protein	Low	8	1	1-22	MSYSERNSKKRKTEHNGREGGS	mito(11),nucl(8),cyto_mito(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LXR4	MRP-S28 domain-containing protein	Low	6.2	1	296-319	PLDTRHHKIQPKPRFPKEWRMSPE	mito(19.5),cyto_mito(10.833),nucl(4.5),cyto_nucl(3.333)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3W1	Uncharacterized protein	Low	8	1	96-122	HYKEEPRRHSHHHRSRSRRSHRSSISA	extr(22),mito(4)	PRRHSHHHRSRSRRSHRSSISAPPPIVVRDSRSRSHRRG (101-139, prob:0.873)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3W4	Zn(2)-C6 fungal-type domain-containing protein	Low	9.7	1	1-43	MTPPPRPPKNTPSSRQKLARRACDSCKIRKIRCSEKPPCTACE	nucl(15.5),cyto_nucl(9.5),mito(8)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6P4	Peptidase A1 domain-containing protein	Low	5	1	44-64	SDPISNDRRRLRRRDGTVDID	extr(23),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M959	Zn(2)-C6 fungal-type domain-containing protein	Low	8.6	1	4-33	VPGKYKGCETCRRRRVKCSNERPYCQKCIS	nucl(12),plas(7),cyto_nucl(7),mito_nucl(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M981	Uncharacterized protein	Low	8.6	2	12-33, 51-70	TTCSRPKSTSCYRAPRLRKALS, TSSSLRHRRHHTPTINRYEL	plas(13),nucl(4),mito(4),mito_nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N173	Uncharacterized protein	Low	5.8	1	140-163	FNWERDRRYTPRKHPKARYGKTNG	mito(16),cyto(6.5),cyto_nucl(5),nucl(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NHF7	Uncharacterized protein	Low	7.3	1	15-39	LTVTLVWWRNKKRHDPKPALPHDTH	nucl(7),cyto_mito(6),mito(5.5),cyto(5.5),pero(4),plas(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LLN5	Uncharacterized protein	Low	8.7	1	15-44	IDSNDGPKQPDKKKSRRPANTAFRQQRLKA	plas(21),nucl(2),mito(1),cyto(1),golg(1),vacu(1),cyto_mito(1)	KKKSRR (26-31, prob:0.708)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LSB9	Arf-GAP domain-containing protein	Low	6.9	1	25-51	KLEANKVCSDCKRNKHPRWASWNLGVF	mito(11),extr(9),nucl(5.5),cyto_nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYG7	Protein transport protein SEC24	Low	8.5	1	38-62	AQQQQPHDQGHKKKKRGYAAQAFEV	nucl(13.5),cyto_nucl(11.5),cyto(8.5),pero(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MG26	Uncharacterized protein	Low	7.2	1	44-63	LGKLWDKPARKGDNRNAVKS	plas(11),nucl(6.5),cyto_nucl(5),E.R.(4),cyto(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJ12	Uncharacterized protein	Low	5	1	90-110	LKIHRAWSKNSKRPIVKQTCS	extr(20),plas(4),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LDL1	Kinesin-like protein	Low	8	1	111-136	VPPSPRAADKPRSTRKPSKVAKESMY	mito(26)	KPRSTRK (120-126, prob:0.629)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LV64	Phosphatidylinositol 3-kinase VPS34	Low	8.9	1	170-189	ALVSTKKKTTRKGEVPPLDK	nucl(15),cyto_nucl(12),cyto(7),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEP8	Uncharacterized protein	Low	8.5	1	12-34	NADKTSKKLMRRHVMKGKNAGKT	nucl(9),cyto(8),pero(5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMF5	Lysophospholipase	Low	5	1	703-730	TIKGVIKKVYENKKKHRIDIHRTEPFMR	mito(21),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMF7	PHD domain-containing protein	Low	9.6	1	423-442	TPNRALRKRNNKQYNLKVLT	nucl(18),cyto_nucl(12),pero(5),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMG8	Zn(2)-C6 fungal-type domain-containing protein	Low	8.2	1	62-90	RLPSHPERRRGSRACVKCRSQKVKCSGDL	mito(13),nucl(8),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MS63	Zn(2)-C6 fungal-type domain-containing protein	Low	6.9	1	32-62	ATRINAPKKVRLACRRCRVRRIKCDGQVPAC	cyto(6),extr(6),nucl(5),cyto_mito(5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MXI4	Uncharacterized protein	Low	8	1	768-793	ISTPVATKRPSKCKRSMRQRRHHRRL	extr(18),mito(4),cyto(4),cyto_mito(4)	RPSKCKRSMRQRRHHRRL (776-793, prob:0.856)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MXW4	Uncharacterized protein	Low	8	1	328-351	QTPSLTKKMVSKKRQSTEDQPKQE	plas(16),mito(6),E.R.(2),vacu(2)	RSREKRRGGARPQTPSLTKK (316-335, prob:0.842)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N4E4	Uncharacterized protein	Low	7.7	1	898-921	GFLHDIRKGTRWKPKPERLSELMS	nucl(10),cyto_nucl(10),cyto(8),pero(5),mito(2),cysk(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NBS9	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	1	31-61	CVNYKTNCTHTARSRKWKPKVLQNDEPQKED	nucl(9),mito(6),plas(6),cyto_nucl(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NG93	MBOAT_2 domain-containing protein	Low	5	1	131-151	QWNLRRIKTSRPARNTPPFSS	plas(20),mito(2),extr(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LCG0	NodB homology domain-containing protein	Low	6.2	1	66-90	RSSLFRLPTKLRRRVRRNRMATIIA	plas(7),extr(6),mito(5),nucl(3),cyto(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1N9	Uncharacterized protein	Low	7.1	1	16-51	PYGATGPTQARKRKNHDCKRRKVKCSGENTCQNCRS	cyto_nucl(8),nucl(7),cyto(7),plas(6),mito(3),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCT7	Seryl-tRNA synthetase	Low	6.1	1	1-24	MNRMIVKCRRCKHIPRIQAIKYYS	mito(12.5),cyto_mito(9),cyto(4.5),nucl(4),pero(2),plas(1),E.R.(1),golg(1),cysk(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ME14	Uncharacterized protein	Low	5	1	1836-1856	QDLVRKHTSARDPKRQPTSDA	plas(19),E.R.(3),cyto(2.5),mito(2),cyto_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEZ5	PAC domain-containing protein	Low	9.5	1	46-66	LQAPPKTSRANRPKSAKFSSY	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MF84	Helicase C-terminal domain-containing protein	Low	8.8	1	12-37	NRVKDIKCALCRKKTPPTNPVQSSNC	nucl(10),mito(9),pero(4),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRD1	Palmitoyltransferase PFA4	Low	5.7	1	90-109	NKCAAPKPPRAHHCRHCARC	plas(10),pero(3),E.R.(3),golg(3),vacu(3),nucl(2),mito(2),mito_nucl(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRQ2	HET domain-containing protein	Low	5.8	1	35-54	TPPIEVSRKRSKRTGPPSFG	mito(18.5),cyto_mito(12),cyto(4.5),nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YBJ3	Uncharacterized protein	Low	6.4	1	35-57	ASSVLKYKWKHGRRYHSDRAGQY	cyto(8),cyto_nucl(7.333),cysk(7),cyto_pero(6.833),nucl(5.5),pero(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LPH4	Uncharacterized protein	Low	9.8	2	65-86, 658-680	LIEQQHCRKRRRLAPSIPMTPE, AGYAKKHGMKRRFAREEKVKEYH	cyto(8),nucl(7),plas(5),mito_nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LRQ9	Zn(2)-C6 fungal-type domain-containing protein	Low	9	1	1-20	MPPAPKPVTRSKANHKRSLQ	mito(15),nucl(10)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5H8	Uncharacterized protein	Low	9.5	1	18-44	CASAKQPKTVRSWKRNRKNHEIIQTKR	mito(17.5),mito_nucl(12.666),nucl(6.5),cyto_nucl(5.333)	KRNRK (31-35, prob:0.644)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MGJ6	MYND-type zinc finger protein samB	Low	8.8	1	38-68	VYCDRDCQKKHWSEHKSRCRVMKQRKILLRA	nucl(16),cyto_nucl(12.833),cyto(7.5),cyto_mito(6.166)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MGT0	Cryptochrome	Low	8.2	1	615-637	DQSMSKRSSRRHSSENTTKRQKT	mito(12),nucl(8),cyto(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIM1	Uncharacterized protein	Low	5	1	1-23	MSRQTPRKARHSRQPSNRIPAVS	mito(22),cyto(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKI2	Uncharacterized protein	Low	8.6	1	29-48	VKNGRPCKGKKKDPVTNIKH	nucl(14.5),cyto_nucl(13),cyto(8.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MU84	Uncharacterized protein	Low	8.3	2	35-54, 349-370	KFTTNWKKPRFAQGDKQKVP, QKQVNAVKHKYKKKPKFVILVG	cyto(10.5),cyto_nucl(8),nucl(4.5),E.R.(4),extr(3),mito(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZD3	CAP10 domain-containing protein	Low	8	1	105-125	AAQAYRKRRGRHPPPGFDKWW	golg(8),extr(7),plas(4),mito(3),E.R.(3)	RR (112-113, prob:0.603)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LPL8	Uncharacterized protein	Low	9.5	1	474-501	EEERMGRGERSKKKRRFRSLSPLGRGGT	mito(18),nucl(4.5),cyto_nucl(4.5),cyto(3.5)	GRGERSKKKRRFRSLSPL (479-496, prob:0.957)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYH6	Uncharacterized protein	Low	9.8	1	167-186	ELLKRKQKLIADNKRRKDDL	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M013	Ribosome assembly factor mrt4	Low	9.6	1	11-32	HLTQVSKKTRENKDKLFQNIRD	nucl(18),cyto_nucl(12),mito(5),cyto(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBL1	Uncharacterized protein	Low	8.3	1	150-172	PCPYPGCRTSFKRKEHAKRHHIS	nucl(13),cyto_nucl(12),cyto(9),mito(1),extr(1),pero(1),golg(1),cysk(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0J9	Uncharacterized protein	Low	5	1	38-57	LFKPDPKPTAPKKKNGITTE	extr(18),golg(5),E.R.(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LHR7	A to I editase domain-containing protein	Low	8.9	1	13-34	LQQFYKLPSKRKPAVRDNGAHE	mito(13),nucl(11),cyto(1),plas(1),pero(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTQ9	Tyrosine--tRNA ligase	Low	9	1	343-367	LAYPIHVKPKKGNKVKSNGKISREL	cyto(20.5),cyto_nucl(12.5),nucl(3.5)	PKKGNKVKS (351-359, prob:0.699)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LXW8	Protein-tyrosine-phosphatase	Low	8.3	1	465-484	PTPGQPRKTARDRHHPYQRS	nucl(9),mito(9),mito_nucl(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M0P5	Uncharacterized protein	Low	8	1	144-190	ELVARAKKGRKGKKGKKGKKGKKGKKGKKGKKGKKAAKKTGNNANKN	extr(18),E.R.(4),vacu(3)	RAKKGRKGKKGKKGKKGKKGKKGKKGKKGKKAAKKT (148-183, prob:1)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5P0	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit	Low	9.6	1	4-32	FSQRVLSRGKDPNKSSKKNKDSKDGTASP	nucl(15.5),mito(9),cyto_nucl(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUW5	Zn(2)-C6 fungal-type domain-containing protein	Low	9	1	11-36	ILACVLCHQRKKKCDRKRPCSFCTKA	nucl(13.5),mito(13),cyto_nucl(7.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N1L0	Uncharacterized protein	Low	5.7	1	31-58	ISEFRDKHPYAPPKHKHREIVRIRASKN	extr(13),pero(4.5),mito(4),cyto_pero(3.5),nucl(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LQ92	Small nuclear ribonucleoprotein B and B	Low	6.2	1	47-68	ADTEEFRRVKRKQNKPSAPGAS	mito(18),extr(5),nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVB9	MFS domain-containing protein	Low	5	1	503-522	ALFFVKPPKKRSREDPTDSD	plas(24),mito(1),E.R.(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVG3	Uncharacterized protein	Low	5	1	84-103	CLQVKKKTTLLKKNNLNHGI	extr(21),E.R.(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LW79	Cysteine synthase A	Low	5.6	1	30-55	KDFYPDLERRFQRKRRANTGGGRRSS	cyto(8),cyto_nucl(6),E.R.(5),mito(3),plas(3),extr(3),nucl(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M0Y2	Uncharacterized protein	Low	9.7	1	352-371	SSNAISSSRPRRFRRIFENA	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(1),pero(1),golg(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1H1	Uncharacterized protein	Low	9.9	1	321-344	AALPDRPHKKPHQPPNPKVRQIRD	nucl(16.5),cyto_nucl(10),cysk(4),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCB3	Uncharacterized protein	Low	9.3	1	8-34	SLSSTRMSHSSRRRGPRVKPDPEDNTS	nucl(14.5),mito(10),cyto_nucl(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEY5	E3 ubiquitin-protein ligase listerin	Low	8.2	1	1014-1035	STDKRMPDKRCTTCKNLFHRTC	nucl(13),cyto_nucl(12.333),cyto(7.5),cyto_mito(5.832),mito(2.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFE5	Uncharacterized protein	Low	9.9	1	83-105	NPITRRPGPGRGRPRKQPPVPVP	cyto(9),cyto_nucl(9),nucl(7),extr(7),mito(2),plas(2)	RRPGPGRGRPRKQ (87-99, prob:0.837)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MGT3	Uncharacterized protein	Low	8.4	1	61-82	TSTSDSSQSKRKRNESPATTTA	nucl(12),cyto_nucl(10),cyto(6),mito(3),pero(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MLW0	Uncharacterized protein	Low	5	1	102-124	RTWDLRSKLKRIQKQQKSSISSP	plas(14),mito(5),E.R.(4),golg(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPR6	Uncharacterized protein	Low	8	1	27-49	ILDNGRRRRGTKKSLRAKIQIPL	plas(20),mito(5)	RRRRGTKKSLR (32-42, prob:0.779)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSW4	MFS domain-containing protein	Low	5	1	24-44	REPSLFDQKRRDRLDPNRPAC	plas(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWQ1	Zn(2)-C6 fungal-type domain-containing protein	Low	7.7	2	2-24, 50-80	RKNGSCWICRLRHKKCDEIHPTC, QRQMSQRLKAQVKRNARNKRGRQMIQKIAHQ	mito(15),plas(5),cyto(3),nucl(2),cyto_pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZZ8	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	66-98	KIRRVQTGCLTCKRRKKKCDERKPSCGDCRRLC	nucl(11),plas(7),cyto_nucl(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5B3	Uncharacterized protein	Low	5	1	22-43	WAKPSVPKKYLRLPRLRRSTVI	plas(24),mito(1),cyto(1),vacu(1),cyto_mito(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	A0A139YBL0	Uncharacterized protein	Low	7.7	1	9-35	VTGFKCSRCSKTYKRREHLQRHAASHS	plas(9),nucl(7),cyto(5),mito_nucl(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LW72	Palmitoyltransferase	Low	5	1	106-130	NGEFRFCKKCQARKPDRAHHCSTCR	plas(11),mito(8),extr(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M327	Uncharacterized protein	Low	5	1	308-330	FFFPYLGLRKKQKNQSKVYEGYR	plas(22),E.R.(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6L5	Uncharacterized protein	Low	8	1	394-413	ADISMTTKRGKRNMRRAQRA	extr(26)	RGKRNMRRAQR (402-412, prob:0.702)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MYM5	Asparaginyl-tRNA synthetase	Low	6.6	1	1-24	MRSFRASRVPRLGRPRPQIRPYAV	mito(21),nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZK0	Uncharacterized protein	Low	7.1	1	15-34	MSARNKPRTGRQRSYPSAGY	plas(7),nucl(6),mito(5),cyto(5),cyto_mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LBE3	NACHT domain-containing protein	Low	9.2	1	263-289	SADSSHERQKSRRRKLKRESDMERTKD	cyto(8),cyto_nucl(7),E.R.(5),nucl(4),plas(4),golg(4)	QKSRRRKLKR (271-280, prob:0.85)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LH77	Phosphoinositide phospholipase C	Low	6.7	1	4-26	FCGLIRRRSAKDDKPRRARTMSI	mito(16),nucl(5.5),cyto_nucl(5.5),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LKY5	Sphingosine N-acyltransferase-like protein FUM17	Low	8	1	29-58	GLQRYSLKDKEHKIRRRKRSWGFQHSVILK	plas(17),mito(7),pero(2)	KEHKIRRRKR (38-47, prob:0.814)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LWA2	CFEM domain-containing protein	Low	5	1	231-251	AKKVRFVYPPQPNKPKDKCRI	extr(13),cyto(6.5),cyto_nucl(4),E.R.(3),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LXG5	Translation initiation factor 4E	Low	7.3	1	310-330	EEQRREKASQHHHHDKRHTGG	mito(12),cyto_nucl(8),nucl(7.5),cyto(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZP4	Uncharacterized protein	Low	9.2	1	458-477	LVRAGRHPYARKVRRPGSKL	cyto(14.5),cyto_nucl(11),pero(7),nucl(4.5)	RKVRRPGS (468-475, prob:0.696)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2W6	Uncharacterized protein	Low	8	1	633-658	GKAQPSSRHHHHHQPHRRKTNETTEG	plas(22),golg(2),vacu(2)	EEKKRRRIV (298-306, prob:0.794)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6A7	50S ribosomal protein L22e	Low	8.8	1	1-21	MAPQAKKSGKAQKQTKKYIID	nucl(13.5),cyto_nucl(11),cyto(7.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M920	Uncharacterized protein	Low	6.5	1	56-86	VPDKKYDECKSKEKYKKPCPTPQKPKLMCDA	mito(9),extr(6),nucl(4),cyto(4),cyto_nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAQ3	Zn(2)-C6 fungal-type domain-containing protein	Low	7.8	1	36-61	ARPASACVQRPNKRYRRQNDARQDVS	mito(12),nucl(8.5),cyto_nucl(6.5),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MMB2	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	7-35	IYLGCERCRCRRIKCDRAKPQCQRCVKYG	mito(12),nucl(11),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MRB4	Uncharacterized protein	Low	8.2	1	881-900	INPDKNRDSKQQARKKPVPT	nucl(11.5),cyto_nucl(10),cyto(7.5),pero(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N6X2	Uncharacterized protein	Low	8	1	202-227	VATFAIWWRRRRNRTQKGPRTPHVDE	nucl(9.5),cyto_nucl(8),mito(6),cyto(5.5),plas(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NB77	Zn(2)-C6 fungal-type domain-containing protein	Low	9.1	1	41-68	ISVKTACQACRQRKAKCNGQRPRCSGCI	nucl(14.5),cyto_nucl(10.5),cyto(5.5),mito(3),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LLJ8	Threonyl-tRNA synthetase	Low	8.1	1	27-46	SRFYSEKTEKREPPDHRKLG	mito(16),nucl(8),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LSY4	Zn(2)-C6 fungal-type domain-containing protein	Low	8.6	1	5-34	QSGQFRIIKKCAKACKRCRSMKVKCSGAQP	mito(11),nucl(10),plas(2),cyto(1),pero(1),E.R.(1),golg(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVD2	DUF3835 domain-containing protein	Low	9.7	1	452-476	TSEVKSTRKPSRFKKARDTVPPGPL	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVX2	Uncharacterized protein	Low	9	1	11-33	NPSAVRIRDNQRRSRARHKEYVE	nucl(15.5),cyto_nucl(12),mito(6),cyto(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZZ2	Uncharacterized protein	Low	7.3	1	509-528	NKNLAHKQKRSMTRYNGPAP	nucl(7),cyto(6),pero(6),cysk(6),cyto_pero(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M073	Chitinase	Low	7.8	2	721-743, 1336-1359	AQDPNKGQKSRRKLCCPKKDSFS, EDVLCIRAKKKAKRQNNSTPDNYD	extr(17),nucl(2),mito(2),vacu(2),mito_nucl(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3Y1	Uncharacterized protein	Low	6	1	55-77	QLAKRGRRAPQKQQQWHKRVPKI	cyto(9.5),mito(8),cyto_nucl(7),nucl(3.5),pero(2),plas(1),extr(1),cysk(1),vacu(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5Q2	PiT family inorganic phosphate transporter	Low	9.1	1	1-25	MAKNKVKKGNKSKGAKKPSIPPKAL	mito(16.5),mito_nucl(11.666),cyto_mito(11.333),nucl(5.5),cyto(4)	KNKVKKGNKSKGAKKPSIPP (3-22, prob:0.951)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MCS5	Uncharacterized protein	Low	8	1	619-644	QYCIKAPKVKKAKWRKNKTGFYPRSP	extr(21),mito(2),E.R.(2)	PKVKKAKWRKNK (625-636, prob:0.855)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MGL3	Uncharacterized protein	Low	8	1	590-609	QSTATRRRSLERRPQRKSNP	plas(27)	RRPQR (601-605, prob:0.615)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N1R5	Na_H_Exchanger domain-containing protein	Low	5	1	539-560	DDEREREEQEKRRQRRTIQYMV	plas(20),E.R.(3),vacu(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N9I8	Nucleolar protein 58	Low	9.3	1	511-571	ADAPEPETKKSKKDKKEKKEKKEKKDKKEKRKRDEEDAEPVKEDGEKKKKKKRKSKAADDE	cyto(17),cyto_nucl(12.666),cyto_mito(10.166),nucl(7),mito_nucl(5.166)	KKSKKDKKEKKEKKEKKDKKEKRKRDEEDAEPVKEDGEKKKKKKRKSKA (519-567, prob:0.999)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NCL1	AlcB domain-containing protein	Low	7.8	1	396-418	QDRFLPQERKKRFHLPHKTAMLF	nucl(9.5),cyto_nucl(8.5),cyto(6.5),mito(5),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NFW0	Hydrogen voltage-gated channel 1	Low	5	1	16-35	QPLLRRGKRRLPSLNVQHWH	plas(24),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7L9I6	Uncharacterized protein	Low	7.3	1	56-79	GRSSCHQRKTERRYQKKMQRAERM	mito(10),cyto_nucl(8),nucl(7.5),cyto(7.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LDF0	Hydroxymethylglutaryl-CoA lyase	Low	5	1	4-25	LRSSICRACRRSQQIRLHRGLA	mito(26.5),cyto_mito(14)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LJK9	ATP-binding cassette, subfamily G (WHITE), member 2, PDR	Low	8.4	1	1487-1507	FIYWLARMPKKSFKKKTVKKE	plas(24),nucl(1),E.R.(1),vacu(1)	PKKSFKKKTVKKE (1495-1507, prob:0.862)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LLW8	Uncharacterized protein	Low	7	2	28-50, 97-119	LDPTTKGPERRARDRRWVNSSPY, PDEIPRPNRKRDVNQRRRVLRDI	extr(14),golg(4),E.R.(3),vacu(3),plas(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1F5	Mannosyltransferase	Low	5	1	581-606	ASFIPDKFKRKWGRHCLLQRKNAAEP	plas(23),mito(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M456	Mitogen-activated protein kinase	Low	8.2	1	246-269	TLRFVKSLPKRERQPLRNKFKNAD	nucl(11.5),cyto_nucl(10.5),cyto(8.5),pero(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MGE2	Uncharacterized protein	Low	8.9	1	1-20	MSTHSSSRKNSPRKFVSESS	nucl(13),mito(11),cyto_nucl(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LU73	Uncharacterized protein	Low	8.8	1	68-89	SGDVPKCTNCTRRNRPCTYVSK	mito(13),nucl(10),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LWC9	Component of oligomeric Golgi complex 3	Low	9.7	1	84-110	VVKEQLSKDTRPRPKKTDKHSRAWEAL	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZC4	Uncharacterized protein	Low	5	1	481-500	SHTWEKKQRDLTKLTKNLKN	plas(27)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M9C6	DNA replication licensing factor MCM7	Low	8.7	1	61-80	DANRQQAKERRAPQYKYKSM	nucl(14.5),cyto_nucl(12),cyto(8.5),mito(2),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBH8	Uncharacterized protein	Low	8	1	279-298	KYERDHKKKSLGPWKKRIVI	extr(12),E.R.(4),mito(3),golg(3),vacu(3)	KKKSLGPWK (285-293, prob:0.635)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFZ2	Uncharacterized protein	Low	5.8	1	25-46	SESYHYAPPRRRRCSACRCVGW	cyto(6.5),mito(5),cyto_nucl(5),E.R.(5),plas(3),nucl(2.5),golg(2),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LAY3	G domain-containing protein	Low	6.8	1	389-409	EKDAEKIRRDRQKVQAYTKEI	cyto(14.5),cyto_nucl(12),nucl(6.5),mito(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LS83	Uncharacterized protein	Low	8	1	755-782	SANEKNAPRERRGKNKMDKKSRLIKEIL	mito(25.5),cyto_mito(13.5)	KTRVPRNARVGKGPDDGGKRAGQGKKPRKVEIVMGPGGISANEKNAPRERRGKNKMDKKSR (716-776, prob:0.97)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2G6	Ribosomal_S7 domain-containing protein	Low	8	1	290-309	VINKKPSKGSGRKQFPYRIA	mito(25)	KLKVKKK (344-350, prob:0.714)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M5G5	Uncharacterized protein	Low	5.6	1	12-37	KVLTCCCCCTRRKHENARHSNHPYGP	extr(9),cyto(8.5),cyto_mito(7.5),mito(5.5),nucl(2),E.R.(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MBU8	Uncharacterized protein	Low	5	1	73-92	SHNPSIHKHGHRRSRMSNTS	plas(21),cyto(2),mito(1),extr(1),cyto_nucl(1),E.R.(1),vacu(1),cyto_pero(1)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEF4	Ubiquitin-like domain-containing protein	Low	9.7	1	38-63	AQPQIPAERRRQHRRSNRPLDQHIDK	nucl(18),cyto_nucl(14),cyto(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFL0	Uncharacterized protein	Low	8	1	90-112	ELEFEKPRKKVKSKEENRDLISS	mito(13),extr(4),plas(3),E.R.(3),golg(2)	RKK (97-99, prob:0.634)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFP7	Chloride channel, other eukaryote	Low	5	1	7-31	EGSEPPSPRTTRRRNPLQRNASTGE	plas(26)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MIJ4	MFS domain-containing protein	Low	5	1	485-504	FSTVKFAKTRPRNTPQQFLA	plas(22),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ML35	Zn(2)-C6 fungal-type domain-containing protein	Low	6.6	1	3-32	GVSKSKACADCKRRRVKCDLTSPRCQRCTK	plas(18),nucl(4),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MT22	Serine/threonine protein kinase	Low	9.2	1	333-355	EGVEEFRQKRKHKVRNWTFYQFH	nucl(15.5),cyto_nucl(12),cyto(7.5),pero(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTA8	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	1	8-34	VVEGSCWPCKKRRIKCDLAKPTCSRCA	nucl(9),mito(9),mito_nucl(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MXU2	Zn(2)-C6 fungal-type domain-containing protein	Low	7.8	1	3-35	FPGTLSRGCSRCRKRKIKCDGRRPGCRRCELYK	mito(18),nucl(7)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0H0	Uncharacterized protein	Low	6.9	1	867-887	ILSSKLRPKVHRPFSRRVTSG	plas(10),mito(7),nucl(5),cyto_mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N2Z5	NADH dehydrogenase	Low	5.8	1	54-74	NSEIKATYKEGRKKRERVVVL	mito(17.5),cyto_mito(12),cyto(5.5),nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N8Y6	Hypoxia up-regulated 1	Low	8	1	925-956	VEEKNRQAKKAAKEAKKKSKKSKTTSGEASQE	extr(6),E.R.(6),mito(5),cyto(3.5),cyto_nucl(3),golg(3),vacu(2)	RDKLEKASVEAALKGARKVEEKNRQAKKAAKEAKKKSKKSK (907-947, prob:0.996)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LJM6	Uncharacterized protein	Low	8	1	178-200	VVVFLGRRSRSRRNQNNFNFQLD	nucl(10),cyto_nucl(7),mito(5),plas(5),cyto(2),pero(2),golg(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LYW2	Protein Ras-2	Low	9.1	1	210-235	DARGGDRDERHRNRNKDRSKSKCVVL	mito(12),cyto_mito(10.332),mito_nucl(9.832),cyto_nucl(8.166),cyto(7),nucl(6)	RHRNRNK (219-225, prob:0.633)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M0L2	MYND-type zinc finger protein samB	Low	7.5	1	33-53	VYCSSKCQRAHWPIHKIHCKS	nucl(7.5),mito(7),cyto_nucl(6.5),pero(5),cyto(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M6X2	Translation initiation factor 5	Low	8	1	138-164	GFILKNQPKKGKKDKAERRAAKKARQN	cyto_mito(10.666),mito(10.5),cyto(10.5),cyto_nucl(8.333),mito_nucl(8.333)	QPKKGKKDKAERRAAKKAR (144-162, prob:0.985)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MHH4	Uncharacterized protein	Low	7.7	1	1-21	MCIPLFRKKKHDRVYDYHPQP	mito(12),nucl(9.5),cyto_nucl(8),cyto(5.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSP7	Uncharacterized protein	Low	9.9	1	21-44	EVTRSPRRRSVRFFRSKQRRDWGA	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUF6	Tyrosinase_Cu-bd domain-containing protein	Low	5	1	18-39	VSEAKSCKKPFVRREWRSLSTK	extr(17),E.R.(6),cyto(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N7C9	Uncharacterized protein	Low	8.2	1	337-356	MQVRKDLRNKKLHPYFKVRF	nucl(12.5),cyto_nucl(12),cyto(8.5),mito(3),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LCG8	Beta-mannosidase	Low	7.4	1	658-681	ITIGMTRREHKHPKNKYTRVDIET	cyto(13.5),cyto_nucl(13),nucl(9.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTH0	Uncharacterized protein	Low	8.6	1	1184-1204	ADGKRPCRDIRLQKHQNPGGN	nucl(13.5),cyto_nucl(12),cyto(9.5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LTQ6	Uncharacterized protein	Low	9.6	1	193-212	FLEQHTKEKSKRWTWKMRRR	cyto(11),mito(6),nucl(4),pero(4)	KSKRWTWKMRRR (201-212, prob:0.768)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LU96	AGC/YANK protein kinase	Low	9.5	1	491-513	FGFLKGKKGRTNSPKPKERGVLG	cyto_nucl(7.333),cyto_mito(7.166),pero(7),mito(6.5),cyto(6.5),nucl(6)	KGKKGRTNSPKPKERGV (495-511, prob:0.839)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LX89	Uncharacterized protein	Low	9.8	1	33-58	MQLCVCARQEKRPRCSCKNFEKVASE	nucl(13),cyto(6),mito(4),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LXC3	STE/STE7/MEK1 protein kinase	Low	8.9	2	2-22, 484-504	ADPFAPRSMKRKNVKGLALKA, PPPPRKETPDELRRENRRQAA	mito(19),nucl(5),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M1H9	Uncharacterized protein	Low	8	1	292-329	DSEFPKLSRKEKKAIKQQKKMEKKQAKETKKARKTGAQ	plas(16),E.R.(6),mito(2),vacu(2)	KLSRKEKKAIKQQKKMEKKQAKETKKARK (297-325, prob:0.99)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N0F2	Uncharacterized protein	Low	9.7	1	342-363	GGPKAARSRKMRAQRLARIGIE	mito(14),nucl(5),cyto(5),cyto_nucl(5)	AARSRKMR (346-353, prob:0.669)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N5J0	GH115_C domain-containing protein	Low	6.5	1	77-97	TLSNGKKKASPAKYKFKPVDV	extr(10),cyto_nucl(5),nucl(4.5),cyto(4.5),mito(4),vacu(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	H6D5G2	GIY-YIG intron encoded protein (Fragment)	Low	7.1	1	50-71	ETTRDPRKIFTRRYSPWNKNTL	nucl(6.5),cyto_nucl(6.5),pero(6),cyto(5.5),mito(4),extr(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LDE2	PhoLip_ATPase_N domain-containing protein	Low	6.2	1	802-821	GVSRDRSTSRRPNVDRSKSF	plas(18),cyto_nucl(4),nucl(3.5),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M324	Septin-type G domain-containing protein	Low	9.2	1	1-24	MSSMGKMIRRKKNVKKGIQFCLMV	mito(19.5),mito_nucl(12.5),nucl(4.5)	RKK (10-12, prob:0.615)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7Y9	PDCD2_C domain-containing protein	Low	9.1	1	83-103	YVFACRRQTCRRKDGSIRALR	nucl(15),cyto_nucl(13),cyto(9)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MC62	Uncharacterized protein	Low	5	1	232-251	YFPSLKTSPKGPKKLPTQGV	extr(18),mito(5),plas(3),cyto_mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MFM7	Protein ZIP4 homolog	Low	8	1	69-92	GRKLWNECIKERRRRDNLLQSASR	nucl(10.5),cyto_nucl(9.5),cyto(7.5),cysk(5),pero(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MH91	Uncharacterized protein	Low	6.8	1	438-457	AWTFIDKRRQEQHKKDDADL	cyto(11),cyto_nucl(9.833),cyto_mito(8.333),nucl(7.5),mito(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MTC7	Protein FYV4, mitochondrial	Low	8.5	1	216-240	GGERRRAEVRFKKRSAERRAEREAE	mito(20.5),cyto_mito(12),cyto(2.5),nucl(2)	RKIDGGERRRAEVRFKKRSAERRA (212-235, prob:0.918)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LJH4	Uncharacterized protein	Low	9.2	1	76-103	REHSASRTGRTRERKKKKTDSIALQLPE	mito(20),nucl(3),pero(2)	RTGRTRERKKKK (82-93, prob:0.875)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LP94	Uncharacterized protein	Low	5	1	221-243	LQYARKTMKRFNQAKKKLNLTCP	cyto(21),cyto_nucl(12),mito(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LU42	Wiskott-Aldrich syndrome protein	Low	9.7	1	112-132	EKEAKQFKKKMDEREKNASRA	mito(11),cyto_nucl(8),nucl(6),cyto(6),extr(4)	RGSRAPPPPPPPGGRPQSDGPPAPPAPRKGGPPPPPAPRRSGKAESPAKDAAPERAPSPPRPKFGVPP (276-343, prob:0.992)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LZL4	Calcium-transporting ATPase	Low	5	1	800-820	NPPDHDIMKRRPRKRDEALIG	plas(21),E.R.(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M786	Dihydroxy-acid dehydratase, mitochondrial	Low	8	1	554-575	EEEVARRRKAWKAPAPRYTKGT	mito(24.5),cyto_mito(14)	RK (561-562, prob:0.617)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MAM1	Biotin carboxylase	Low	7.3	1	2154-2174	WTNARRFFYWRLRRRLNEEYI	cyto(11.5),cyto_nucl(10.5),nucl(8.5),pero(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MNM7	Fe-S_biosyn domain-containing protein	Low	8	1	104-125	TEAQKPKAARPRPKLRPRKAAM	mito(22),cyto(3)	KPKAARPRPKLRPRKA (108-123, prob:0.953)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MR65	PfkB domain-containing protein	Low	9.8	1	333-362	AKNGGRKRGRDPKTTKRRKKDYVRGGLQPD	cyto(12.5),cyto_nucl(10),cysk(7),nucl(6.5)	KNGGRKRGRDPKTTKRRKK (334-352, prob:0.97)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MZR3	Uncharacterized protein	Low	9.2	1	250-273	AKGSISRKVVERKFKEKRYPRKRT	cyto(16.5),cyto_mito(10.5),nucl(4),mito(3.5)	ISRKVVERKFKEKRYPRKRT (254-273, prob:0.944)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LNT6	Dynein intermediate chain, cytosolic	Low	8.3	1	173-192	TSTPSKRLSRRERDREEELR	mito(13.5),nucl(11),cyto_mito(8.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M3X8	MFS transporter, PHS family, inorganic phosphate transporter	Low	8	1	623-650	MAETSRLRKPRIWRRHRKAKSSSGTDIA	plas(27)	LRKPRIWRRHRKAK (629-642, prob:0.916)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M8P9	Mitoc_mL59 domain-containing protein	Low	6.1	1	139-158	PSLIKRWKRVGKYGWTKFPK	mito(21.5),cyto_mito(12),nucl(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MG95	Uncharacterized protein	Low	9.5	1	167-188	NGTFQRWQWRKRKTQNTSTLRQ	nucl(17.5),cyto_nucl(13),cyto(5.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPK5	Uncharacterized protein	Low	9.8	1	24-43	EGKLKKLKTLYKNGVHWQKC	nucl(13),mito(11),cyto(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MPU2	Zn(2)-C6 fungal-type domain-containing protein	Low	7.6	1	38-57	CDEARPACRRCERSHRICEY	mito(13.5),nucl(9),cyto_mito(9),cyto(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MSQ2	Uncharacterized protein	Low	7.6	1	425-445	VDTKERIETRRQKEKTRPEHS	cyto_nucl(11.833),nucl(11.5),cyto(10),mito_nucl(6.666),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MUY8	Acetyl-CoA acyltransferase	Low	5	1	380-402	IVTGLSECRRRKKKMLLTSMCIG	cyto(14),cyto_mito(11.833),cyto_nucl(9.333),mito(8.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7N7M0	Uncharacterized protein	Low	9.5	1	53-72	VSWAAPKESRKEHRDNKAMT	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7NCD4	Uncharacterized protein	Low	5	1	463-488	DDIRGNKFKKFWKRAYHTRTIRTKAE	plas(23),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LKZ9	HET domain-containing protein	Low	9.8	1	442-465	GNKLLDRHKAKKRFPKKEPDWAPL	cyto(13.5),cyto_nucl(10.5),nucl(6.5),pero(5)	SKKPIGNKLLDRHKAKKRFPKK (437-458, prob:0.955)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LLC8	Uncharacterized protein	Low	8	1	4-34	AAKLMFKIRKIKNKLKIRRRLKKDAANVTHE	mito(20),cyto(6)	KIRKIKNKLKIRRRLKK (10-26, prob:0.964)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LU82	Uncharacterized protein	Low	9.9	1	113-140	EYEERYKQVRKVRLPQQQKKKQKVPNTN	nucl(19),cyto_nucl(13.5),cyto(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVI2	50S ribosomal protein L14e	Low	8.5	1	120-144	FERFQVLRLKKQRRFEERKALAKVK	cyto(19.5),cyto_mito(11.5),mito(2.5),nucl(2),pero(2)	KKQRRFEERKALAKV (129-143, prob:0.723)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M110	Uncharacterized protein	Low	8.9	1	113-138	DMTDKCWKHLRKQKNRNQRLDKWNLD	nucl(13.5),cyto_nucl(11),cyto(7.5),mito(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M4T2	Zn(2)-C6 fungal-type domain-containing protein	Low	9.2	1	1-40	MSTRSSKVTKKSRLSRTAISCDRCKSRKTKCNKPDADGPC	nucl(11),mito(9),cyto(4),plas(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7K5	Uncharacterized protein	Low	6.6	1	309-331	RDINQRREAKRLQREKEGRDQEH	mito(19),nucl(4),extr(2)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M910	Uncharacterized protein	Low	7.1	1	504-524	DNTHHWQRKHALKKRWNELTP	cyto(10),cyto_nucl(9.833),nucl(8.5),cyto_pero(7.833),pero(4.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MJP5	Uncharacterized protein	Low	5.9	1	324-343	IWNSFYTDFKRKRKEICGLD	plas(6),golg(6),E.R.(4),nucl(3),mito(3),cyto(3),cyto_nucl(3),cyto_mito(3),mito_nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MKL1	Uncharacterized protein	Low	6	1	6-27	LSPPEWAEPRRKSRISKWKLFG	mito(11),cyto(7),cyto_nucl(5.833),cyto_pero(5.833),nucl(3.5),pero(3.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LSJ2	Amine oxidase	Low	5	1	82-103	YDAANRKHTRHIQKFLRGHRPA	cyto(15.5),cyto_nucl(9.5),mito(5),pero(4)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LVH3	Metallophos domain-containing protein	Low	5.8	1	17-38	ISDTHGSKPKPKHKGGPTTDDE	mito(13),cyto(7.5),cyto_nucl(6.333),cyto_pero(5.666),nucl(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7LWH4	Uncharacterized protein	Low	6.3	1	20-39	GIIIRLKTKKHKLRLESYKL	mito(8),plas(8),nucl(4),cyto_mito(4),pero(3),E.R.(3)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M2X2	Uncharacterized protein	Low	7.6	1	5-31	NNGHRIRKPYPRSRGLVKNKNFKPPLN	nucl(11.5),mito_nucl(10.666),cyto_nucl(9.333),mito(8.5),cyto(5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M495	Ubiquitin-conjugating enzyme E2 G1	Low	9.4	1	150-176	FREEREGKNKDFRRRCRKCVRESLGED	nucl(11),mito(8),cyto(6)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7M7R2	Protein-serine/threonine kinase	Low	5.5	1	25-48	CYTSHRCLSQWRGPRQPHRGHEST	mito(24),cyto_nucl(2),nucl(1.5),cyto(1.5)	
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MEJ1	Uncharacterized protein	Low	8	1	403-423	YNERRVSERSRGEPRRKPRYS	plas(18),extr(5),mito(1),pero(1),E.R.(1),vacu(1)	SRGEPRRKP (412-420, prob:0.695)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7ML33	R3H domain-containing protein	Low	9.2	1	706-729	AKPGRKLLLGLKKKRPQQPEAGKV	mito(15),cyto_nucl(4),nucl(3.5),cyto(3.5),extr(3)	GRKLLLGLKKKR (709-720, prob:0.727)
UP000009096	Gibberella moniliformis (strain M3125 / FGSC 7600)	W7MWS6	Uncharacterized protein	Low	5	1	78-100	ALEASIRKKKNRQVPIVKDRLTA	plas(26)