ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1F0	Uncharacterized protein	Low	5	1	396-420	YWDPNSSYSYKKKRNSKVWKSRLSD	extr(13),mito(7),cyto(4),mito_nucl(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1F4	Uncharacterized protein	Low	9.5	1	810-830	SPSNNKKSINRAPKSSKETPS	nucl(15),cyto_nucl(9.5),mito(9)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X517	SH3 domain-containing protein	Low	9.6	1	700-721	EAGSTKEKERKERNSAHKAELR	cyto(12),cyto_nucl(10.833),cyto_mito(8.499),nucl(6.5),pero(4)	EKERKERNSAHKAELRAIIREKIKEMK (706-732, prob:0.775)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5K0	Amidohydro_3 domain-containing protein	Low	5	1	459-482	GNFEKIFKKYPKHNPKRSGIIHRI	cyto_mito(8.166),mito(8),cyto(8),extr(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X938	Cation_ATPase_N domain-containing protein	Low	8	1	80-105	RQEYHLPQKVARKDKKGKKTAAEIAE	plas(27)	RKDKKGKK (91-98, prob:0.744)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9E3	Uncharacterized protein	Low	5	1	6-33	IRKFLLRGGLKKKQDNQKKEKNGEHVYS	mito(27)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9V9	Protein kinase domain-containing protein	Low	5.8	1	108-131	EYANMSTTQRRRKQLKQRAMAVGN	plas(20),nucl(2.5),cyto_nucl(2.5),cyto(1.5),E.R.(1),golg(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XA96	Metallophos domain-containing protein	Low	9.6	1	74-103	ETTNTENLPTRRRRRCKKTDSTKNDIKSKA	nucl(15.5),cyto_nucl(10),mito(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGG4	Uncharacterized protein	Low	9.1	1	577-601	GVDSRRHRWFPTRSKREGRKRHHGD	plas(19),nucl(3),mito(3),mito_nucl(3)	RHRWFPTRSKREGRKRHH (582-599, prob:0.886)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLF6	ANK_REP_REGION domain-containing protein	Low	9.3	1	51-76	CQYKGRLYGPWRCRKRLKTEEWVLVN	nucl(12),plas(7),mito(3),cyto(3),cyto_mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRB2	Uncharacterized protein	Low	7	1	404-426	DPTDKDPSKPWWRRRKGYCFWII	plas(14),nucl(5),cyto(3),mito_nucl(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTZ8	Cupin_2 domain-containing protein	Low	5	1	52-71	LEKSGKKPPKHFHPNQYEYF	mito(15),cyto(9),cyto_nucl(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9Q1	Uncharacterized protein	Low	7.5	1	184-205	EVPWTRSSATRKKKCLNRLVEY	plas(14),nucl(7.5),cyto_nucl(4.5),pero(2),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCM7	Beta-galactosidase	Low	5	1	747-771	TTGRHRCNFKLPKPWKKGDKHIITF	extr(16),vacu(4),cyto(3),mito(2),cyto_nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE13	Uncharacterized protein	Low	7	2	45-71, 457-479	AGGPIARKYIRRDRVRRQIPQLPKVPT, PAATTLVRRVRRRSIPQNDEELM	extr(22),E.R.(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XL99	Uncharacterized protein	Low	8	1	214-237	DLKPKILKTSKRSKLRKRSPVMIA	extr(17),E.R.(4),cyto(2),golg(2)	PKILKTSKRSKLRKR (217-231, prob:0.847)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRR6	Uncharacterized protein	Low	9.3	2	1-22, 43-62	MSTIGRKQKSMKQNAKKCNSAI, SSNQRQSSKRHCQCGRNCFE	mito_nucl(10.666),nucl(10.5),mito(10.5),cyto_nucl(7.333),cyto_mito(7.333)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XT20	Amino-acid acetyltransferase, mitochondrial	Low	5.9	1	31-58	QRGFTTRSSGQQQKKKQHRQVGEEARDL	mito(21),cyto_nucl(3),nucl(2.5),cyto(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XV53	DBF4-type domain-containing protein	Low	9.9	1	121-141	IDSQKYRKPIQTQKISTRDKQ	nucl(17),mito(9),cyto_nucl(9)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZZ6	Thioredoxin domain-containing protein	Low	9.9	1	200-227	DGLKAVGKGKKRRVRKSQDARRSQEVRK	cyto_nucl(10.666),mito_nucl(10.665),nucl(10.5),mito(9),cyto_mito(8.665),cyto(6.5)	AVGKGKKRRVRKSQDARRS (204-222, prob:0.967)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X341	Uncharacterized protein	Low	9	1	83-126	GWGHRGGQPRRPQNRRYDERDEADAYISKKRYGGPRKYKPAEDE	nucl(13.5),mito(12),cyto_nucl(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X350	Peptidase_S8 domain-containing protein	Low	6.2	1	514-536	LWPTARRPENYKRPPLKNPGVAE	extr(12),E.R.(7),cyto(4),nucl(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X416	Uncharacterized protein	Low	6.1	1	36-55	RDSRSRGKSPHQTRHSSQSS	plas(18),nucl(3),cyto(3),cyto_nucl(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X512	Uncharacterized protein	Low	7.2	1	320-344	GCTDPELKDKRKGRNPFRTRHGYEV	nucl(6.5),plas(6),mito(5),cyto_nucl(4),E.R.(4),golg(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5W6	Uncharacterized protein	Low	5	1	399-418	RIRSTTPTRRLTRRQSDKVY	extr(22),mito(2),plas(1),E.R.(1),golg(1),cyto_mito(1),mito_nucl(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X960	Uncharacterized protein	Low	7.9	1	836-857	DGGFRRASRGYQPRRNIRPEGV	cyto_nucl(16.5),cyto(13.5),nucl(12.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X964	Uncharacterized protein	Low	7.3	1	388-409	YLKDCLNRSKRQRKFNVENDSH	nucl(7.5),cyto_nucl(7),pero(7),mito(6),cyto(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCP9	Uncharacterized protein	Low	8.1	1	56-78	GYEFEKARKRSSKKNSRIDYYSG	mito(15),nucl(9.5),cyto_nucl(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE70	GMC_oxred_C domain-containing protein	Low	6.4	1	799-822	ADRLECLRKDKNKAKEKEERIIQH	cyto(14.5),cyto_nucl(11.333),cyto_mito(8.166),nucl(6),cysk(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEI3	Protein kinase domain-containing protein	Low	7.8	2	480-500, 542-568	RMEEETKQRKKHKGGFSNLAS, AAQKKPQPAKVPQSQQHQNRGRKKAGF	mito(17),cyto(6.5),cyto_nucl(5),nucl(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQI8	Uncharacterized protein	Low	9.5	2	214-233, 1349-1371	CDQCDPSKAVRYRKNRPGSG, SYESIRQDRDPRQGQKRLRDLED	cyto(10.5),cyto_nucl(10.5),nucl(9.5),mito(2),plas(1),pero(1),golg(1),cysk(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUS2	Uncharacterized protein	Low	9.9	1	43-67	IAKFGRPLKRKERKIMKRKFKLDQM	extr(7),nucl(5.5),plas(5),cyto_nucl(4.5),mito(4),cyto(2.5)	KFGRPLKRKERKIMKRKF (45-62, prob:0.972)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZB5	Uncharacterized protein	Low	8	1	1554-1577	EQEESRKKPVVRWRGRKSKKADGV	plas(19),E.R.(4),mito(3)	RKKPVVRWRGRKSKKA (1559-1574, prob:0.921)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2X8	Protein SSH4	Low	8.8	1	78-112	ANRPIKTKARDKPAPREGGREKKESWKKKEAQAAA	cyto(16),cyto_nucl(11.5),mito(7),nucl(3)	RPIKTKARDKPAPREGGREKKESWKKKEAQ (80-109, prob:0.983)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X650	PHD-type domain-containing protein	Low	9.5	2	72-91, 250-271	GITTWKRKCRLPSCPRPAAT, REDLCIKKKCEKHKYWLRIAVE	mito(11),nucl(8.5),cyto_nucl(8),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCL8	ABC1 domain-containing protein	Low	6.2	1	66-92	PPPSSLPPPRPPKQYPRLIKWGRRFIY	plas(10),mito(8.5),cyto_mito(6.5),nucl(4),cyto(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE44	Uncharacterized protein	Low	5	1	27-50	LSVVPTRRYSRRHRSTTCTRFCYI	mito(8),extr(6),cyto(5.5),golg(4),cyto_nucl(3.5),plas(1),pero(1),E.R.(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XG67	Uncharacterized protein	Low	9.2	1	35-55	IPNSTKKRFLRIPPKFQKPSQ	mito(17.5),cyto_mito(10.5),nucl(4),cyto(2.5)	KR (249-250, prob:0.602)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHK7	Uncharacterized protein	Low	5	1	378-398	ETNRAEELKRRQKRLEETERT	mito(26.5),cyto_mito(14)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJT3	Uricase	Low	5	1	11-30	KDNVRVYKVHRDEKKQTQTV	mito(12),cyto(8.5),cyto_nucl(6),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNB5	Uncharacterized protein	Low	8.9	1	1-26	MADKPAKARIRDNQRRSRANKKEYVA	nucl(14.5),cyto_nucl(10),mito(8),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNE7	FAD-binding PCMH-type domain-containing protein	Low	5	1	449-474	ESWRVRKLAMLKKKWDPKGRFSQYFP	extr(26)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTJ7	Uncharacterized protein	Low	8.6	1	135-154	VPSKRPQCYCPPYPHRNPSH	nucl(10),mito(7),cyto_nucl(7),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZ75	Bifunctional lycopene cyclase/phytoene synthase	Low	5	1	123-143	ANLKLQKKKHLVQNDYKRLRR	plas(18),E.R.(5),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6Q0	Uncharacterized protein	Low	9.2	1	47-66	APKADKPKPVKKSVDKKPKI	cyto(14),mito(6),nucl(3),vacu(2)	PKADKPKPVKKSVDKKPK (48-65, prob:0.868)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAE8	Cx9C motif-containing protein 4, mitochondrial	Low	9.9	1	68-89	LLDLRIKQRKEEKEKGNNGPLY	nucl(19),cyto_nucl(13.5),cyto(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XD71	Uncharacterized protein	Low	8	1	227-260	KPNPRPKTKTGSKDGKKEKKKNNLSKRAKYWDSC	extr(21),mito(2),vacu(2)	KAKPNPRPKTKTGSKDGKKEKKKNNLSKRA (225-254, prob:0.99)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XG76	Uncharacterized protein	Low	9.6	1	58-85	SITWCCYRCCCRSRRKKADRSKSTFFND	nucl(12),mito(4),cyto(3),golg(3),extr(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMG3	Uncharacterized protein	Low	8	1	23-43	VPTPGRKRSMSPVKRIKKIYD	plas(26)	RKRSMSPVKR (28-37, prob:0.659)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XML8	Uncharacterized protein	Low	8.7	1	62-85	NKNSGESKLLRKKRKGATAPTIPE	extr(9),golg(6),E.R.(3),nucl(2),mito(2),pero(2),vacu(2),mito_nucl(2)	RKKRK (72-76, prob:0.706)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMZ7	Uncharacterized protein	Low	8.4	1	444-463	CNIGQLKKKRGQHYVCKAVV	nucl(12),cyto_nucl(11),cyto(8),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNB0	Uncharacterized protein	Low	9.1	1	295-318	QSLEPIRKRDRIQKLNRRSRAMKS	plas(8),extr(4),E.R.(4),nucl(3),cyto(2),golg(2),vacu(2),mito_nucl(2)	KRDRIQKLNRRSRAMK (302-317, prob:0.716)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNW5	Peptidase A1 domain-containing protein	Low	5	1	95-114	WIPSTSSKLCRSRKNPCTQG	extr(13),E.R.(7),plas(3),pero(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQC1	Oxidored_q6 domain-containing protein	Low	5	1	199-218	IMQLQKKMRNTKITRMWYRK	mito(23),cyto(2),extr(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRZ7	Uncharacterized protein	Low	5	1	311-331	LFAGRQVYLRRRNRDQFEYKL	plas(14),extr(8),E.R.(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSY1	Uncharacterized protein	Low	8.3	1	50-73	LERGTGRVYRRKRGKQDDAKYQVA	nucl(11.5),cyto_nucl(10),cyto(5.5),pero(5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZY6	Uncharacterized protein	Low	7.5	1	7-36	RIAIVSSDKCKPKKCRQECRKSCPVVRTGK	mito(10),nucl(8.5),cyto_nucl(8.5),cyto(7.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE41	Uncharacterized protein	Low	5.4	1	229-249	CDLTKRVKRPERKSDVPHIHK	plas(7),cyto(6),mito(5),extr(5),nucl(1),pero(1),E.R.(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEV0	TPT domain-containing protein	Low	8	1	191-218	ESGLTESARDRRRKKKQRRRGLGGLSSD	plas(21),E.R.(2),vacu(2)	RDRRRKKKQRRRG (199-211, prob:0.984)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEW1	FAD-binding PCMH-type domain-containing protein	Low	5	1	472-496	YGHNNLVRMRRVKRKYDPRNVFGTL	extr(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLX1	General transcription and DNA repair factor IIH helicase subunit XPD	Low	9.6	1	637-656	LADKRFGKKRNQLPKWIAQA	nucl(12),cyto(7),cysk(4),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMG5	Velvet domain-containing protein	Low	9.7	1	203-222	GCRVRIRRDVRMRRRSDKPG	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XN09	Uncharacterized protein	Low	9.7	1	61-86	RDDHKIIHMKRKNKRLRELQKKDGVC	cysk(16),nucl(5.5),cyto_nucl(5.5),cyto(4.5)	KRKNKRLR (70-77, prob:0.747)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS68	F-box domain-containing protein	Low	9.2	1	56-75	GNWPKEYKQISRRRACPTNS	nucl(15.5),cyto_nucl(12),cyto(7.5),cysk(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTN8	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase	Low	8	1	199-218	YTHMMHQRRKMMRGKKPMRN	mito(17),extr(3),E.R.(3),plas(1),pero(1),golg(1),vacu(1)	RKMMRGKKPMR (207-217, prob:0.754)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUD3	Uncharacterized protein	Low	8	1	205-227	VLDKKGVLRKKRRIPRSGRPATL	plas(21),E.R.(3),vacu(2)	KGVLRKKRRIPRSGRP (209-224, prob:0.942)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X081	LCCL domain-containing protein	Low	5	1	29-53	PSPDQPLISRQPRNERNRYRDDDDS	plas(24),mito(1),E.R.(1),golg(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCF0	Uncharacterized protein	Low	8.8	1	160-181	ISTFPSKNSKNHPRTPKRRLGD	nucl(18),cyto_nucl(12.833),mito_nucl(9.833),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE25	Uncharacterized protein	Low	8.8	1	19-44	GSQAVERPSKRLRKRTNLIFNQRYDP	nucl(14),cyto_nucl(12),cyto(8),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEQ1	Beta-hexosaminidase	Low	5	1	63-85	ALTSRITRRKTSKKGQAETRIDA	extr(19),golg(3),cyto(2),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XF19	BTB domain-containing protein	Low	8.5	1	2-21	LPTDSKPSRRRVSLRGHAPD	nucl(14),cyto_nucl(12.5),cyto(9),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XF63	Uncharacterized protein	Low	8.9	1	311-336	KPQETPSWTKKPYKKGKPPVVIPPKP	mito(7.5),cyto_mito(7.333),cyto(6),cyto_nucl(5.333),extr(5),nucl(3.5),vacu(3)	KKPYKKGKPPVVIPPK (320-335, prob:0.793)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XH62	Uncharacterized protein	Low	5	1	240-259	DSESSSKKKAKKSVVPICKH	extr(11),cyto(10),cyto_nucl(6.333),cyto_mito(5.833),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKR7	Uncharacterized protein	Low	5	1	123-143	YMNDDDYKKNNNKNNSKKSYG	extr(8),mito(4),plas(4),golg(4),E.R.(3),mito_nucl(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNJ3	MFS domain-containing protein	Low	5	1	497-516	MPDYDELRRRRERKVNAEVD	plas(23),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQX4	Uncharacterized protein	Low	8	1	148-173	PIQQLQGKYKPRQRRRREEPPETIYA	plas(8),extr(6),E.R.(5),mito(4),golg(2),cyto_mito(2),mito_nucl(2)	RQRRR (159-163, prob:0.64)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSV4	Uncharacterized protein	Low	6	1	443-464	PPFAMPRHPYRRGPQRHLGSLH	cyto(12),cyto_nucl(8.833),cyto_pero(8.833),mito(5),nucl(4.5),pero(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X586	RING-type domain-containing protein	Low	6.8	1	364-385	ETCGRKSCRSCRKEWRAFHKCF	cyto(10),cyto_nucl(9),nucl(6),mito(5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7C0	Uncharacterized protein	Low	8.4	1	78-104	WAILGPGRRWYRRRKNKSAPIQWDRVG	plas(14),mito(7),E.R.(3),nucl(1),extr(1),pero(1)	RRRKN (89-93, prob:0.676)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8A5	Uncharacterized protein	Low	6.8	1	289-312	TKFIKKIFSFSKKSKKSNELEGSD	mito(13),mito_nucl(11.666),nucl(8),cyto_nucl(7.166),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X948	F-box domain-containing protein	Low	5	1	69-91	YSLTGLKRSKKRQAENAARQLPN	mito(20.5),cyto_mito(14),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAV8	AA_permease domain-containing protein	Low	5	1	19-40	SNNINWSRPQPRHRHSPGNSGN	plas(27)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEC5	Cation_ATPase_N domain-containing protein	Low	8	1	235-260	ALSLQGKKQRKPNRSLSRKKHGPLQP	plas(26)	KKQRKPNRSLSRKKHGP (241-257, prob:0.902)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEX9	Uncharacterized protein	Low	9	1	232-253	EAPPEPIKKKGKFRHLLTFWQR	nucl(15.5),cyto_nucl(10.333),cyto_mito(4.833),mito(4.5),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEY1	SPX domain-containing protein	Low	5.6	1	739-762	MTMFVWRHQKIRRRRAVRYHDAWG	plas(19),pero(3),E.R.(2),nucl(1.5),cyto_nucl(1.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFB6	DUF2470 domain-containing protein	Low	8.9	1	209-231	FYALNKWKRMVRRQVKKNGKKDH	cyto(14.5),cyto_pero(10.666),cyto_nucl(10.333),pero(5.5),nucl(4)	KRMVRRQVKKNGKKDH (216-231, prob:0.823)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XH38	Uncharacterized protein	Low	9.6	1	185-205	DSPPINRRRRQSIRARPGTDS	nucl(16),cyto_nucl(9.5),mito(6),extr(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHE6	DUF155 domain-containing protein	Low	7.8	1	565-585	TSEERERGRKERQTKQEEDDE	mito(14),nucl(8.5),cyto_nucl(5.5),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIK7	CBFD_NFYB_HMF domain-containing protein	Low	7.6	1	61-82	EQAHKMTKVEKKPRKNIQYKDL	cyto_nucl(12.666),nucl(12.5),cyto(9.5),cyto_mito(8.499),mito(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMY7	Uncharacterized protein	Low	8.2	1	144-167	DDTPEEWRRRMKRHWDQRHLFFNP	nucl(11.5),cyto_nucl(9.5),mito(8),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTL1	F-box domain-containing protein	Low	9.3	1	72-92	GKRFKSIKVTWSRRIPRKPMT	nucl(16.5),cyto_nucl(11.333),cyto(5),cyto_mito(3.833),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUA4	Kynurenine 3-monooxygenase	Low	8.8	1	33-61	KSKSTSSSSSKRPTSKKPRRSTSVAPTIA	plas(19),mito(3),nucl(2),cyto_mito(2)	RPTSKKPR (44-51, prob:0.671)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXK2	Uncharacterized protein	Low	5	1	265-289	PTPPSPPKTSPKPPPPRPTLPPPRP	extr(18),mito(3),cyto(2),pero(2),cyto_pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0Z5	ANK_REP_REGION domain-containing protein	Low	7.2	1	321-340	ATSRPIPEIRQKFKRRETYK	cyto(12),cyto_nucl(11),nucl(8),pero(3),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1V4	AIG1-type G domain-containing protein	Low	5.9	1	18-37	APQCMFTKSIRQRPKIQAAM	cyto_mito(9.833),mito(9.5),cyto(9),cyto_nucl(6.833),nucl(3.5),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3Q1	Uncharacterized protein	Low	5.8	1	469-490	CSQNCRTNAVARKNKRFVKVYK	extr(24),nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X608	Uncharacterized protein	Low	8	1	289-345	SEFPRLTRKEKKAIKAEKKRAKEEKKYAKKEDKQRHKEWKKEDKRMRRRGTNELEMG	plas(21),E.R.(3),vacu(2)	TRKEKKAIKAEKKRAKEEKKYAKKEDKQRHKEWKKEDKRMRRR (295-337, prob:0.999)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7X7	Uncharacterized protein	Low	8	1	27-46	RIEANKPRRGRPQIPTNPTH	cyto(12),nucl(9),cyto_pero(9)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBA7	Uncharacterized protein	Low	5	1	271-290	YPEPKIKPPPKPKPVYVDKT	extr(17),mito(4),cyto(3.5),cyto_nucl(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCI5	Probable cytosolic iron-sulfur protein assembly protein 1	Low	6.5	1	236-257	DQTARVWHRKPKPEKKEEEEEE	cyto(12),cyto_nucl(9.833),cyto_mito(7.833),nucl(6.5),extr(4),mito(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJC3	Uncharacterized protein	Low	5	1	852-871	VEAPPKEKKKPESDPTHERF	extr(10),E.R.(6),golg(3),vacu(3),mito(2),cyto(2),cyto_mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XM89	Uncharacterized protein	Low	6	1	2-23	SPQSPFTDRNARRQRNPNEIMV	mito(13),cyto(6),cyto_nucl(5.333),cyto_pero(4.833),nucl(3.5),pero(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMX0	Carboxylic ester hydrolase	Low	5.4	1	507-533	GVQSSIKEHCKWPKKNKYLGGNPNAKE	extr(18),mito(5),nucl(1),plas(1),pero(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRB7	Uncharacterized protein	Low	9.4	1	243-272	VRDKAKSKAKKTEAKREKREQKEAERRLRP	cyto(19.5),cyto_nucl(14),nucl(5.5)	KSLVAKQKERAKKLKGPTAAKLKAVRDKAKSKAKKTEAKREKREQKEAERRLRP (219-272, prob:0.998)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3I7	Uncharacterized protein	Low	9.6	1	1129-1165	GVDPDAKRARKERKMAEKRQKFRKHRGIMQWKPARNM	plas(15),mito(5),nucl(4.5),cyto_nucl(3.5)	AKRARKERKMAEKRQKFRKHRGI (1134-1156, prob:0.986)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X482	PUA domain-containing protein	Low	6.1	1	58-79	GIGLRKLKLEKRPKLLSKCQAI	mito(13.5),cyto_mito(10),cyto(5.5),nucl(4),extr(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4Y9	Uncharacterized protein	Low	8.9	1	71-99	QLKKVLQLWNSKRNLKRKQRDYIVQIVKE	nucl(14.5),cyto_nucl(11.5),cyto(7.5),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5U5	Uncharacterized protein	Low	5	1	229-248	VPLEQKKQWHEKTPMRREGY	cyto(15.5),cyto_mito(10.666),cyto_nucl(9.333),mito(4.5),cysk(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9R9	MFS domain-containing protein	Low	5	1	11-31	ETSPLLRKENVKKGPRLPLKQ	plas(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9Y6	p-aminobenzoic acid synthase	Low	6.1	1	531-551	EDSSWKIYKHLRKRNPAPFAG	cyto(8.5),cyto_nucl(6.5),E.R.(5),mito(4),extr(4),nucl(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBN0	Uncharacterized protein	Low	6.1	1	351-370	GWQERNTKFRKSKLQAVYST	extr(9),cyto(5.5),cyto_nucl(5),E.R.(5),nucl(3.5),golg(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJ96	Uncharacterized protein	Low	5	1	92-112	LKMNTKSMKKMKQKLKLVNGE	extr(12),cyto(4),mito(3),plas(3),cyto_nucl(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XP31	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit	Low	6.7	1	14-40	LPTTKPFKKLWLRWRSLRLPWRKRYFI	mito(17.5),cyto_mito(11),nucl(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQX3	Uncharacterized protein	Low	5.4	1	355-374	QEKELERKRREMVRKTHMRM	plas(17),E.R.(5),mito(2),nucl(1),extr(1),vacu(1),cyto_mito(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRT9	Uncharacterized protein	Low	5	1	90-109	PPPGNRYQSRRNGNNYNNNN	mito(20.5),cyto_mito(12.5),cyto(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS77	Tr-type G domain-containing protein	Low	9.7	1	84-108	NQVGATEKKKQKKPVVPEPKAPTQK	cyto(16.5),cyto_nucl(12),nucl(6.5),mito(2),pero(2)	KKKQKKPVVPEPK (91-103, prob:0.742)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XT21	Uncharacterized protein	Low	9.5	1	122-144	VVLEAKKQRWRKQERNRIDRDNS	nucl(16),cyto_nucl(11.5),cyto(5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X133	Uncharacterized protein	Low	9.1	1	101-122	APAPTQKRRRRAFGKVKRDDPA	extr(17),mito(4),nucl(3),cyto_mito(3)	KRRRRAFGKVKR (107-118, prob:0.819)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1W2	Uncharacterized protein	Low	8	1	734-759	EGAPNLPNRDPRRPPRQQDQILANNP	extr(13),plas(10),E.R.(3)	PPRGGPMMRGRGGPGGMGPRGGGFGPPRGGMGPRGGPGMGTRGGP (346-390, prob:0.885)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2N6	Nup188_C domain-containing protein	Low	5.3	1	172-191	QTPETQRRDRQRNLYFSERR	plas(22),nucl(1),mito(1),cyto(1),cyto_nucl(1),E.R.(1),golg(1),cyto_mito(1),mito_nucl(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3H3	Uncharacterized protein	Low	8.6	1	108-127	LLNDYKKKGRHIQRLIRDFN	nucl(13.5),cyto_nucl(12),cyto(9.5),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6Z8	Uncharacterized protein	Low	9.2	1	776-805	SASDVSPTNKHRRRDKQIHIRHRGRRHSKF	extr(13),nucl(4),cyto(4),cyto_nucl(4),pero(4),cyto_pero(4)	KHRRRDKQIHIRHRGRRHSKF (785-805, prob:0.925)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XB67	PALP domain-containing protein	Low	5	1	37-57	LSPEDRQRRQESKHNDPRRDS	extr(9),cyto(7),E.R.(4),cyto_pero(4),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XI61	RING-type domain-containing protein	Low	5	1	201-224	IITLRKTRLYRERRTRVLQRRVDR	plas(13),extr(9),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTK8	Uncharacterized protein	Low	8.3	1	50-70	ATIAISPKYRRKPRDIDRLIE	extr(7),golg(6),plas(4),E.R.(3),vacu(3),mito_nucl(1),cyto_mito(1),pero(1),cyto_nucl(1),cyto(1),mito(1),nucl(1),cyto_pero(1)	KKNKRGPGTGDKKKPISKA (165-183, prob:0.89)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXV6	Uncharacterized protein	Low	9.2	1	58-81	GKMPTPKSKRLWQRRKKSLKEGFT	E.R.(6),mito(5),plas(4),mito_nucl(4),nucl(3),extr(3)	KKERARLGKMPTPKSKRLWQRRKKSL (51-76, prob:0.968)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZ05	Pyr_redox_2 domain-containing protein	Low	5.5	1	88-108	VSTPIPKKQRFRVLRFLWRLT	mito(19.5),cyto_mito(12),cyto(3.5),nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0Z7	TPR_REGION domain-containing protein	Low	5	1	236-263	CPRCTACDTRKEIKRKSRKFDHPYLHFG	plas(11),extr(4),E.R.(3),vacu(3),mito(2),cyto(2),pero(2),cyto_mito(2),cyto_pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4A7	L-type lectin-like domain-containing protein	Low	8	1	276-295	AEKEAKSKNREKKGEKPREE	mito(6),cyto(6),cyto_mito(6),E.R.(4),golg(4),mito_nucl(4)	EAKSKNREKKGEKPREEDIQKRHK (279-302, prob:0.932)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X688	Uncharacterized protein	Low	8.4	1	159-179	WIVNRRRNRAAEKRREEERRV	mito(12),cyto(7),plas(3),extr(2),nucl(1),pero(1),E.R.(1)	RRRNRAAEKRREEERR (163-178, prob:0.815)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7A6	Uncharacterized protein	Low	7.3	1	47-67	LPSAANTTKKRRTLKHEALYL	cyto(13.5),cyto_nucl(12.5),nucl(8.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8R8	Uncharacterized protein	Low	8.1	1	100-119	IRVFAIRKANKRKQMVKAIP	nucl(8),mito(6),cyto(6),cyto_mito(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XC62	F-box domain-containing protein	Low	5.9	1	18-41	VSTIPIKRYHCKTKPKILIAKPVG	mito(21.5),mito_nucl(13),nucl(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XH29	Uncharacterized protein	Low	6.9	1	701-723	FGMERLLRESRRKRKNNDQGWFW	nucl(5.5),E.R.(5),golg(5),cyto_nucl(4.5),extr(4),cyto(2.5),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMK1	Protein kinase domain-containing protein	Low	7.1	1	871-893	YGQVKLARYRKNQNKKVVLKYVT	cyto(9.5),cyto_nucl(9),nucl(7.5),mito(5),plas(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPM8	Uncharacterized protein	Low	9.8	1	50-84	FSSYVRRKNNWVAKSRDRRKFVKWLEKTRSNDYRQ	nucl(13),mito(5),pero(5),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQX1	Uncharacterized protein	Low	6.8	1	400-425	LRWSTLPTRSGKRRNPLRISCHKLSH	cyto_nucl(9),cyto(8.5),nucl(6.5),mito(4),extr(4),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRF1	Uncharacterized protein	Low	5	1	791-814	GLIWYRNWRAQQRDQQRRRAGQAP	extr(15),mito(4),E.R.(4),golg(2),cyto_mito(2),mito_nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XT99	Uncharacterized protein	Low	5	1	30-49	SSPTSLKHHHHPHRVFKVYV	cyto(24),cyto_nucl(15.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5J6	Uncharacterized protein	Low	5.8	1	397-417	TQPFKARQDRNAVRRNRKAAL	extr(22),cyto_nucl(3),nucl(2.5),cyto(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFF8	Uncharacterized protein	Low	9.1	1	25-51	MSPSDRYRLERKYKRRVRIRGQHPVNW	mito(10),plas(9),nucl(3),pero(2),cyto(1),E.R.(1),golg(1)	KYKRR (36-40, prob:0.639)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFH7	Uncharacterized protein	Low	5	1	631-688	TTTSKKTTTTSKKTTTRPTTTKKKTTTRKSTTPTTRKTTTRTKSKTTTAKKSPTLCTS	extr(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XH66	Uncharacterized protein	Low	9.8	1	2-31	VNVPKTRKTYCKGKDCRKHTQHKVTQYKAG	nucl(15),cyto(8),mito(4),cyto_pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHI5	Uncharacterized protein	Low	5	1	303-322	QLCYWPTQYRKLRKRKGDLE	plas(20),E.R.(3),vacu(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPF8	Uncharacterized protein	Low	5	1	297-322	TSVPTVLPSRRNRCRRRLPDPKFVLL	plas(19),E.R.(3),cyto(2),mito(1),extr(1),cyto_nucl(1),vacu(1),cyto_pero(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XT25	Uncharacterized protein	Low	9.6	1	1-20	MPPIRTRNKRKPPPDGFDDI	nucl(16.5),mito_nucl(11),mito(4.5),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXR1	Uncharacterized protein	Low	8	1	310-329	QLGPPQTSKKRKNREDDTIE	cyto_nucl(12),nucl(11),cyto(11),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZK8	PHB domain-containing protein	Low	9.5	1	401-423	ENLNQKWRENYDKKRKETSFKDA	mito(23),nucl(4)	KDKEKKRK (434-441, prob:0.871)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1G1	Peptidase_S8 domain-containing protein	Low	5	1	198-217	PRYLRLRDPNHQKENRRSPA	extr(17),cyto(3.5),mito(3),cyto_nucl(2.5),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2Y7	Uncharacterized protein	Low	5.7	1	291-310	INSTCKSTQKQKQPEEKLKS	mito(20),cyto(4),nucl(2),cyto_pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X361	Uncharacterized protein	Low	6.9	1	384-406	IEKLRCLLFKKKKVNGKYIARDT	cyto(15),cyto_nucl(13.333),nucl(8.5),cyto_mito(8.499)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4I6	TPR_REGION domain-containing protein	Low	9.9	1	1-21	METYDSKRRPPRPPLFTSNST	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5Q5	Uncharacterized protein	Low	5	1	391-410	WYAQCRPVAKNRRRSPSPAA	extr(27)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAC3	KIX_2 domain-containing protein	Low	9.4	1	26-50	GGMQQRRYSRYSKKQERPYPKGDIT	nucl(18),cyto_nucl(11.833),extr(4),cyto(3.5),cyto_mito(3.166)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIS5	Uncharacterized protein	Low	8.4	1	195-218	EENQTQKGKKKQQKQEQEQRPEPS	nucl(12),mito(10.5),cyto_mito(8),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMW1	F-box domain-containing protein	Low	5	1	24-43	QDLSRAKRTCKRFNTIGKLV	extr(7),E.R.(6),golg(5),cyto(4),mito(2),cyto_nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNZ8	WD_REPEATS_REGION domain-containing protein	Low	6	1	1270-1294	TFAVGRLDNKKNQRHERVERSHIIV	plas(10),mito(5),cyto(4),mito_nucl(4),nucl(3),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUT8	Uncharacterized protein	Low	8	1	192-211	ERSAHNKKVRHHNMKRLFQH	extr(9),golg(6),E.R.(5),vacu(3),mito(2)	KRKWEERSAHNKKVR (187-201, prob:0.698)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYQ7	Uncharacterized protein	Low	5	1	781-803	TDYTAHFRPNKERKKVERASEFQ	mito(23),cyto_mito(12.833),mito_nucl(12.833)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1V2	S5A_REDUCTASE domain-containing protein	Low	9.7	1	283-311	QTKWAGQKERRYRKEFGDKYKKKRSVIIP	cyto(8.5),cyto_nucl(7.5),nucl(5.5),mito(5),plas(5)	RRYRKEFGDKYKKKR (292-306, prob:0.704)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8W8	Ribosome biogenesis protein YTM1	Low	9.9	1	253-274	PQSTAFTRKRRRTTTKPPSTIK	nucl(17),cyto(9),mito_nucl(9)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9I7	Rap-GAP domain-containing protein	Low	6.4	1	1367-1386	TDRIHDPRCTNKKRHIGNDF	cyto(10.5),cyto_nucl(8),mito(6),nucl(4.5),plas(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCR5	Uncharacterized protein	Low	6.8	1	228-254	LRKASENSSCRNRNRRRYSFQDEVVRR	nucl(6),plas(5),cyto_nucl(5),mito_nucl(5),mito(4),cyto(4),cyto_mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XD10	Uncharacterized protein	Low	9.3	1	1-21	MAFLFKKNKHHQQQGAGHAPQ	nucl(16.5),cyto_nucl(13),cyto(6.5),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XDC2	Uncharacterized protein	Low	8.8	1	705-725	DPPKEDYKPPEIPKKKKWWEW	plas(16),mito(6),nucl(2),golg(2)	IPKKKK (716-721, prob:0.695)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIA6	Uncharacterized protein	Low	7.5	1	115-137	QSNRPCFQKWKSGVKKNWKKIIW	nucl(9.5),mito(8.5),cyto_nucl(7.833),cyto_mito(7.333),cyto(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XM30	Protein kinase domain-containing protein	Low	8.8	1	301-324	SGEVVPRQRRRFRYQKKAFFKVYD	nucl(14),cyto_nucl(11.5),cyto(7),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMG9	Uncharacterized protein	Low	8	1	310-331	VLTLAGKKPKKERVGRQFEEDE	plas(22),E.R.(2),vacu(2)	KPKK (317-320, prob:0.629)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XP70	Uncharacterized protein	Low	9.5	1	202-221	LHTKNPKGRIWKPREWKKLG	mito(13),cyto(7),cyto_nucl(6.833),nucl(5.5),cyto_pero(4.833)	KGRIWKPR (208-215, prob:0.639)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPZ1	UBC core domain-containing protein	Low	8.7	1	4-24	LCLNRLQEERRQWRKNHPFGF	nucl(12.5),cyto_nucl(9),mito(8),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7B5	Uncharacterized protein	Low	5	1	292-312	LSIWVKKYKWAPLKTRKIVYS	mito(15),cyto(5),plas(3),cyto_pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9F4	Uncharacterized protein	Low	8	1	32-52	AEPIPTRKWRWKPSGRWKSGY	mito(11),plas(9),extr(5)	RKWRWKPSGRWKSGYRGNKYRGGRRHSKE (38-66, prob:0.944)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XD57	Uncharacterized protein	Low	9.8	1	277-296	SVIRYKKYCTWKHQQANGGT	nucl(18),cyto_nucl(12.5),cyto(5),cysk(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XDR1	Uncharacterized protein	Low	7.6	1	81-104	KAKDDEFEHRRKERRERDEEIERQ	cysk(12),nucl(7),cyto(4),mito_nucl(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFX3	Uncharacterized protein	Low	5	1	412-434	DAQATTGKRKRIRRTQTDRIAHL	mito(10),cyto(10),cyto_mito(10)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGF9	Anaphase-promoting complex subunit 2	Low	7.3	1	3-26	ISSFHHPQEPHRQVKKRRIFHGIF	mito(13),nucl(7.5),cyto_nucl(7),cyto(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XK64	Translocation protein SEC62	Low	8	1	230-262	RPVWAWEKTKEEKKKKKKRKHSHSHSHPPMETP	plas(16),E.R.(8),vacu(2)	TKEEKKKKKKRKHS (238-251, prob:0.994)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRB5	Uncharacterized protein	Low	6.7	1	169-191	ACSCQHCTKKTRRPSQTTMSRQA	cyto_nucl(7.5),cyto(7),nucl(6),cysk(6),mito(4),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRL5	Uncharacterized protein	Low	7	2	358-380, 412-435	TDIGKPIKPSPRPPTNRKPTEAE, GKQASQKSSYYKRKLRFRRNADEE	extr(16),cyto(7),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4L0	Uncharacterized protein	Low	8.1	1	455-482	GVTWIDYKSPERKRYPKRSAGVIREHFE	cyto(11),nucl(8),pero(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4M5	Uncharacterized protein	Low	7.1	1	412-432	IIRFWRCKKTQKTRIVCQIGR	mito(12),mito_nucl(11.333),nucl(9.5),cyto_mito(8.333),cyto(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8F2	Uncharacterized protein	Low	6.6	1	262-281	KTLERLAKEKEDKRLRQKVW	mito(21),nucl(4.5),cyto_nucl(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8V8	SHSP domain-containing protein	Low	5.8	1	224-243	EPATEKKEKKQEKTAKYWIS	cyto(12.5),mito(9),cyto_nucl(8),nucl(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X911	Aa_trans domain-containing protein	Low	5	1	603-622	KSGKYSNKVKWEKNIFRFFT	plas(26)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBT5	MFS domain-containing protein	Low	8	1	480-504	LEWKNIKVEERKKTSKEPGIKEKSE	plas(27)	KKTSKEPGIK (491-500, prob:0.642)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE95	Uncharacterized protein	Low	8	1	107-131	GLASNIWIKKRRRRRDMYLPISNQD	plas(17),E.R.(4),mito(3),vacu(3)	KKRRRR (115-120, prob:0.745)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGM8	Calpain catalytic domain-containing protein	Low	8.4	1	40-65	QAWKTCSNPAEKQRRREKFMQLLQKG	nucl(12),cyto_nucl(9.5),mito(5),cyto(5),extr(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQ02	Uncharacterized protein	Low	9.1	1	1-25	MEPRNEGTRRGPRPQRRQPFFSKDL	nucl(11),cyto(8),mito_nucl(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSF0	Uncharacterized protein	Low	5.5	1	196-216	IYDQKKNPYCRLRRDDPSKGV	extr(14),mito(6),cyto(2.5),cyto_nucl(2.5),nucl(1.5),pero(1),E.R.(1),golg(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XU65	Uncharacterized protein	Low	8.9	1	32-65	LHLHQVYTSPPKKKPKQLRRRNAQRQRNRLQSFS	mito(5),E.R.(5),extr(4),cyto_mito(4),mito_nucl(4),nucl(3),cyto(3),cyto_nucl(3),golg(3)	PKKKPKQLRRRNAQR (42-56, prob:0.92)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0T2	Abhydrolase_3 domain-containing protein	Low	5	1	1-20	MNDSCPRRAFRPNSNPREST	mito(12),extr(8),cyto(3),plas(2),cyto_pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X220	Uncharacterized protein	Low	8	1	598-621	RPEFHESKRKKIKKESPNHPIFTF	plas(25)	KRKKIKK (605-611, prob:0.746)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3E6	Uncharacterized protein	Low	5	1	47-72	VLSALYKSTNKNRKDRNPDRVPGTCK	cyto(10),plas(10),E.R.(3),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3J2	Uncharacterized protein	Low	6.9	1	301-324	TGTVQFTKWKFPKKQPPKVFIGLT	cyto_nucl(9),cyto(8.5),nucl(6.5),mito(4),plas(4),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5J1	Uncharacterized protein	Low	5	1	534-553	EEIRLRQRVRAQQRRLLERE	plas(20),mito(4),E.R.(2),cyto_mito(2),mito_nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMV9	Uncharacterized protein	Low	5.7	1	1-22	MAKRLAKKVHKVFKREKVAPST	mito(22),nucl(2),cyto(2),cyto_nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNS7	Uncharacterized protein	Low	7.2	1	80-99	YLKYLTKKFLKKNQLRDWLR	mito(11),nucl(7),cyto(7),cyto_nucl(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQ20	Uncharacterized protein	Low	8.5	1	57-79	ILKAVPKKKQSHSRKRMRQLAGK	mito(22),cyto_mito(13),nucl(2),cyto(2)	PKKKQSHSRKRMR (62-74, prob:0.783)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQW8	Uncharacterized protein	Low	8.1	1	3-22	APPRRHCKPVPSRRYLALRH	mito(9),nucl(8),plas(5),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X054	Uncharacterized protein	Low	9.2	1	214-233	CTRGGVAKRRSRKFRFCCAS	plas(10),cyto(6.5),cyto_nucl(5.5),nucl(3.5),mito(2),pero(2)	KRR (221-223, prob:0.622)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X097	TLC domain-containing protein	Low	8.4	1	61-89	DYATKPQRQASKSRRRKLSKQRQDGQMIP	plas(20),mito(2),E.R.(2),nucl(1),cyto(1),cyto_nucl(1),vacu(1)	SKSRRRKL (71-78, prob:0.755)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0A7	Uncharacterized protein	Low	9.6	2	450-470, 473-494	LENTGRYKKKEEKIRGIQGLH, LKELRERQSKLRRETKKILDEM	cyto(10.5),cyto_nucl(10.5),nucl(9.5),mito(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0F2	NADH:ubiquinone reductase (non-electrogenic)	Low	8	1	87-106	EAKANGKVKKPRGRIFRAVI	mito(15),cyto(6.5),cyto_nucl(4),plas(2)	GKVKKPRGR (92-100, prob:0.74)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0F3	Uncharacterized protein	Low	9.8	1	249-271	IVHFTVRKPKPNPREHCHKGCNE	nucl(13),mito(5),pero(5),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0S9	Uncharacterized protein	Low	8.6	1	18-42	TGVTSPMERRKRQNRLNQRAYREFP	nucl(11.5),cysk(9),cyto_nucl(8),cyto(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2K9	Malic enzyme	Low	7.6	1	129-151	IGHMKNWVRKRPRAEPERRASDL	cyto(10),nucl(7),mito(5),pero(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3S7	Uncharacterized protein	Low	7.3	1	345-371	ERDYWWFKRMKGKWRCGRKPSWWGGEN	cyto(11.5),cyto_nucl(10.5),nucl(8.5),pero(3),cysk(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X463	Nickel/cobalt efflux system	Low	5	1	10-30	SVIQRKPSQYPPQKIQHLQHH	plas(19),mito(4),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X689	Uncharacterized protein	Low	5	1	273-295	VEKIRTVGKEKRHRVFWNKEYKE	cyto(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8M0	Uncharacterized protein	Low	8.3	1	140-164	EVIKKAGKKKKFKLNLPKRPKGKSC	plas(22),nucl(1),mito(1),cyto(1),cyto_nucl(1),E.R.(1),golg(1),cyto_mito(1),mito_nucl(1)	KKAGKKKKFKLNLPKRPKGK (143-162, prob:0.989)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8N8	Uncharacterized protein	Low	9.9	2	30-55, 77-100	RSDQWAKSTFRKRICRKPEHAHLPLA, EPSPQTTKPKSQRRSAKRYNQTDI	mito(13),nucl(9),cyto_mito(9)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJ22	GlcNAc-PI synthesis protein	Low	5.5	1	420-442	IDVARDWPRKRVVRKESPSQTDA	cyto(11.5),plas(7),cyto_nucl(7),mito(2),pero(2),nucl(1.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJP9	Uncharacterized protein	Low	6.1	1	1-21	MTRSQQKRKRTEVPPALSPNR	mito(19.5),cyto_mito(11.5),nucl(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLZ2	ANK_REP_REGION domain-containing protein	Low	8.2	2	241-260, 1178-1197	DCRYCDKTKIFRENNRDMRV, IERLRDKRERIKPPGYETRL	cyto(14.5),cyto_mito(9.5),nucl(4),mito(3.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYE1	Autophagy-related protein 11	Low	6.9	1	1110-1131	EHMARKWQKQCRDYRDKYHRAA	cyto(12.5),cyto_nucl(10),nucl(6.5),mito(4),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0N8	Protein kinase domain-containing protein	Low	9.3	1	300-320	IEPRFKFERHHHHHHHHHKED	nucl(16),cyto_nucl(13),cyto(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2I8	Uncharacterized protein	Low	8	1	63-95	AVNRAKLKSSKLKQVKKKKPKTHFKIWNHAELP	mito(17.5),cyto_mito(13.5),cyto(8.5)	RAKLKSSKLKQVKKKKPKT (66-84, prob:0.969)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XC87	Zn(2)-C6 fungal-type domain-containing protein	Low	7	1	102-126	PTTMACARCKQKKIKCDGNQPSCSA	plas(11),nucl(5),E.R.(4),vacu(3),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XD76	SURF1-like protein	Low	5	1	321-341	YLVIRRPPRDITKKVRLQKDW	mito(17),cyto(4),plas(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEF2	Glutaredoxin domain-containing protein	Low	5.7	1	51-70	DKARSIWTRRKGPKQKLPAL	cyto(16.5),cyto_nucl(10.833),cyto_mito(9.666),nucl(3),extr(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XL95	Uncharacterized protein	Low	5	1	424-444	AGAKVVKAQRKKRQSPTTPAA	extr(26)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XM65	TPR_REGION domain-containing protein	Low	8	1	1-24	MGLFSKLKGDKDKKNNRNSVHGHH	nucl(11.5),cyto_nucl(11),cyto(7.5),mito(4),extr(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5M8	Uncharacterized protein	Low	8	1	90-115	ITTITIHKVRNRRRRKRALARLAELQ	extr(17),mito(3),E.R.(3),cyto(2),mito_nucl(2)	KVRNRRRRKRA (97-107, prob:0.915)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XA90	Plastocyanin-like domain-containing protein	Low	6.4	1	20-39	ISNCRNQKLCRDEPKQLIKP	cyto(10.5),cyto_pero(9),pero(6.5),nucl(5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XG51	Glyco_hydro_63 domain-containing protein	Low	7.7	1	11-33	TEEEKRLKEDKERTKYWKKWGPY	cyto(11.5),cyto_nucl(11),nucl(9.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHJ7	Ras-GAP domain-containing protein	Low	6.8	1	665-684	QSEGKVRKQQKQQVLGPYKF	mito(14.5),cyto_mito(9.833),nucl(7.5),cyto_nucl(6.333),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLR3	PfkB domain-containing protein	Low	5	1	893-912	SHPVRNKNAQESQKRRQEEK	mito(23.5),cyto_mito(12.833)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRJ3	Uncharacterized protein	Low	7.3	1	1154-1175	KNHFQCLTKQEKRKIRHRDGLI	nucl(7),cyto(7),cyto_nucl(7),mito(5),cyto_pero(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0H8	Uncharacterized protein	Low	8	1	72-93	KGKLGGEKRTEKPKKKVYFFAS	plas(27)	KLGGEKRTEKPKKK (74-87, prob:0.81)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0U1	Chitinase	Low	5.4	1	21-44	AIATGPRQYRHRHHAKRYEITDPE	extr(17),E.R.(5),vacu(2),nucl(1),cyto(1),cyto_nucl(1),golg(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2L3	WD_REPEATS_REGION domain-containing protein	Low	9.5	1	233-255	QEPNTFQPKKSKRSDSRSVSNKH	nucl(17),cyto_nucl(12.5),cyto(6),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X393	Peptidase_S8 domain-containing protein	Low	9.4	1	1-25	MDIEFKKKSAYRKRGAKNSGENEEP	nucl(17.5),cyto_nucl(12.333),cyto(6),cyto_mito(4.333)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3I8	Uncharacterized protein	Low	9.5	1	67-86	AELAKRQKARDDQARKQKVS	plas(15),nucl(4.5),cyto_nucl(4.5),cyto(3.5),pero(2)	ERAEASKKEEAELAKRQKARDDQARKQKVSGPKDTGKEGEKKPD (57-100, prob:0.882)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGE7	Uncharacterized protein	Low	7	2	221-244, 327-347	ALAPCWRSNKKFHKKRFAKSEIFE, LVNFCLKKKKGEYRRDDSEAY	plas(26)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XK24	Carn_acyltransf domain-containing protein	Low	5	1	158-180	SYFYSYRDDKKRRDPAKRAAAVV	mito(24.5),cyto_mito(13.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKB4	HEME_HALOPEROXIDASE domain-containing protein	Low	6.7	1	189-209	FAQFRNRRLEQQKRENPKVNF	cyto(14),cyto_nucl(11),nucl(6),pero(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X145	Uncharacterized protein	Low	9.5	1	280-302	DNQRARVFERRKRKIRHLYASLN	plas(9),cyto(6.5),cyto_mito(6.5),mito(5.5),nucl(5)	RRKRK (289-293, prob:0.661)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1D0	SCP domain-containing protein	Low	5	1	38-65	SKRSSFRELLQKRKQCNKGKNRASTIDS	extr(27)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X387	Uncharacterized protein	Low	9.4	1	13-33	DSGPNRSPTRRTPNPPGANYP	plas(14),nucl(11)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X399	Mitochondrial genome maintenance protein MGM101	Low	8.6	1	239-262	FGEHVITKKKKKLWVRKGESLEYP	mito(21),cyto_mito(12.833),cyto_nucl(3.166),nucl(2.5),cyto(2.5)	KKKKKL (246-251, prob:0.724)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X642	O-acyltransferase	Low	8	1	59-87	DAPPSMKSIHQAKKQKRRKLFPTVDYEER	plas(23),E.R.(3)	KKQKRR (71-76, prob:0.668)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAS3	Vacuolar protein sorting-associated protein	Low	9.1	1	2910-2935	TLDKQFQDRRRMSRSRNRPKHALYGV	nucl(13),cyto(7.5),cyto_mito(5.5),pero(3),mito(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCY8	Uncharacterized protein	Low	9.2	2	139-159, 245-271	TWTIVHYRRRKMRRNNAEGNV, LSPAKERYYYRDRYRWKPFKDIGRSSR	plas(10),mito(8),nucl(6),cyto(1),extr(1),E.R.(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGJ1	Uncharacterized protein	Low	9.7	1	31-57	QAYKLHCVPKSSKKNNQPKPLPKPALD	nucl(16.5),cyto_nucl(9.5),mito(9)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJW7	Uncharacterized protein	Low	5.4	1	50-75	KNPSWMPFIRRLPKRRPSASSRIHPS	mito(11),plas(10),cyto(2),nucl(1),pero(1),E.R.(1),golg(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XK78	Uncharacterized protein	Low	8.8	1	519-550	DFQNPELRRIRREQKKQAKELKKKKKAKADMV	plas(21),nucl(2),E.R.(2)	RRIRREQKKQAKELKKKKKAK (526-546, prob:0.994)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKY8	Uncharacterized protein	Low	7.9	1	1-24	MSSPSEPLKKRPRTQSCPPPLPTT	mito(16),nucl(9),cyto_nucl(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPU7	Uncharacterized protein	Low	9.6	1	9-31	SPPFMKEEKKHPHMANRPKVPDF	nucl(17.5),cyto_nucl(13),cyto(7.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSQ1	F-box domain-containing protein	Low	7.6	1	86-108	IYKIQKIREKQRKWEEEQERERQ	mito_nucl(12.166),nucl(11.5),mito(11.5),cyto_nucl(8.333)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSS0	Uncharacterized protein	Low	5	1	256-278	PDEWSLKKVKRNRLQKRDCFFCW	extr(16),cyto(4),mito(3),vacu(2),mito_nucl(2),cyto_pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XT71	Uncharacterized protein	Low	7.2	1	2-23	AKSARASTKKASRSRIRNNVYA	mito(15),nucl(7.5),cyto_nucl(6.5),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1W6	Fe2OG dioxygenase domain-containing protein	Low	6.5	1	915-936	LAEERYRKTKRQYDATIKARKD	plas(12),nucl(4.5),cyto_nucl(4.5),cyto(3.5),E.R.(3),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5Y4	Carboxypeptidase	Low	7	2	53-75, 445-464	RDQILRKKSKFYNKKTKDFWVNG, VWNGKRGFSKRPSRKFVVPY	extr(17),E.R.(7),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X665	Ribonuclease	Low	8	1	1-20	MSTTKRRGRPPRKPAAVGTA	cyto(17),mito(10)	KRRGRPPRK (5-13, prob:0.77)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XET6	Uncharacterized protein	Low	8	1	335-355	VSRFNAKRAMRRRREASRFSR	plas(13),extr(8),E.R.(3),mito(2)	KRAMRRRRE (341-349, prob:0.738)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XH73	Uncharacterized protein	Low	5	1	32-58	TDRELKKAYKQLSKKYHPDKNPENEEA	extr(12),E.R.(8),golg(4),cyto(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKM4	Ubiquinone biosynthesis protein COQ4, mitochondrial	Low	9.1	1	267-293	VPPDLRKTRAEIRKKRREDKGGKVNTV	mito(18.5),cyto_mito(11.5),nucl(4),cyto(3.5)	RKTRAEIRKKRREDKG (272-287, prob:0.905)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XM95	M20_dimer domain-containing protein	Low	6	1	73-101	EYRGKPLGTHGPRNKPRRQNIEKLCPRIE	plas(7),cyto(6),cyto_nucl(5.5),mito(5),nucl(3),E.R.(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQE4	Uncharacterized protein	Low	8.8	1	8-27	ANNAAKNKQKPAKGKPPVLS	cyto(12),cyto_mito(9.833),cyto_nucl(8.333),mito(6.5),nucl(3.5),pero(2),E.R.(2)	KKGKAANNAAKNKQKPAKGKP (3-23, prob:0.855)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXQ3	BTB domain-containing protein	Low	9.8	1	77-97	LNWLYRREVWRPKRHKRFSAE	cyto(13),nucl(12)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZM0	Uncharacterized protein	Low	9.6	1	150-170	EKPKKTQTRRHSEHHPNHRRD	nucl(12),mito(11),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4K3	Uncharacterized protein	Low	7.5	1	33-52	FDNRKLPKKLFSSQKRTIFL	cysk(12),nucl(9),cyto_nucl(8.5),cyto(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5Q8	Uncharacterized protein	Low	8	1	20-42	LDYKGAKKKLKAVRRAIRNAEAA	plas(25)	GAKKKLKAVRRA (24-35, prob:0.808)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X722	PlsC domain-containing protein	Low	7	2	2-21, 696-721	AAPPEKPKTKFPKLNPWSYD, FEEVNRRLVERRKERTRRQSESEELD	plas(15),E.R.(6),cyto(2),extr(1),cyto_nucl(1),pero(1),golg(1),vacu(1),cyto_mito(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBT1	TLC domain-containing protein	Low	8	1	32-60	LQPPNGAPRRPRGLRRKTPQPEPVSRPLT	plas(20),mito(4),vacu(2),cyto_mito(2),mito_nucl(2)	APRRPRGLRRK (38-48, prob:0.823)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCI3	Uncharacterized protein	Low	5	1	130-149	RNPQSKCTRLQPRPFPSRPC	mito(12),extr(7),cyto_mito(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQ65	Fe-S cluster assembly protein DRE2	Low	9.2	1	235-260	VQQPPECRPKPGKRRRACKDCTCGLK	cyto(22),nucl(3)	GKR (246-248, prob:0.621)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0M8	Uncharacterized protein	Low	7.4	1	1080-1104	GSLEKKSMKVNIKKLLKRRNITLED	cyto(8),nucl(7),mito(7),mito_nucl(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2Z8	YL1_C domain-containing protein	Low	9.7	1	22-44	KPFKSTSWKPAARRNKNLKQVLI	nucl(17.5),cyto_nucl(14),cyto(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XA37	Uncharacterized protein	Low	5	1	556-577	GAVLFGRKKKNKENAPYPPDTE	extr(23),cyto(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XC55	Uncharacterized protein	Low	7	1	101-120	WNAQKRKKTFFERKADPEGR	extr(10),cyto(6),nucl(5),mito(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKY3	Uncharacterized protein	Low	5	1	114-138	DFNNRFFTPRNKGHNQKKPVPQTVD	plas(10),extr(6),E.R.(5),mito(3),cyto(1),golg(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLH1	Uncharacterized protein	Low	8	1	119-143	LGDNKETDNKKKKKKDRYLSIDTTL	extr(15),E.R.(3),cyto(2.5),plas(2),cyto_nucl(2),vacu(2)	KKKKKK (128-133, prob:0.8)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPV8	Uncharacterized protein	Low	9.7	1	329-348	GSSAKGPARRGRRMNFQSRY	mito(17.5),cyto_mito(11),nucl(6)	GPARRGR (334-340, prob:0.65)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3Y6	DNA polymerase	Low	8.9	1	505-527	GLDEKRLTGKRKNPNPHRRVDIL	nucl(12),cyto(6.5),cyto_mito(6.5),mito(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCJ6	Chitin synthase	Low	5	1	362-384	TGATERRHRKAQKSQKQVRLING	plas(26)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFJ9	Uncharacterized protein	Low	5.7	1	42-61	SWPDRFSARKKVGERRRIVR	plas(14),golg(5),nucl(2),mito(2),E.R.(2),mito_nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XH53	ANK_REP_REGION domain-containing protein	Low	7.3	1	35-58	NQYSSEKLKSRKHSVLQRLYKTSY	cyto_nucl(8.5),nucl(8),cyto(7),mito(5),pero(3),plas(1),E.R.(1),golg(1),cysk(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XI36	Uncharacterized protein	Low	6.1	1	106-129	AAQLKYKIETRKIRRKPVWVDVGG	cyto(7.5),extr(6),cyto_nucl(6),E.R.(4),nucl(3.5),plas(2),mito(1),pero(1),golg(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJ40	acidPPc domain-containing protein	Low	5	1	368-393	FYNDKGRHGHHGHRRSRSRSMGNNGY	plas(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKF9	Seryl-tRNA synthetase	Low	9.4	2	11-40, 48-69	DFNLARTQRRSYRKTQKPPTPKQTHQMVLR, CRLITCKPRSHRLPITRKHEVC	mito(19),nucl(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKT5	Putative lipoate-protein ligase A	Low	9.2	1	428-448	EKEEERKERREANKKLQGRAA	mito(20),nucl(3),cyto(2)	GGKSMRARAAEKEEERKERREANKK (418-442, prob:0.887)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKY9	ANK_REP_REGION domain-containing protein	Low	6.9	1	54-78	VRDKLNKLGYKKRFCPKQTKAIFRE	cyto(6.5),nucl(6),cyto_mito(6),plas(5),mito(4.5),golg(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XL90	WD_REPEATS_REGION domain-containing protein	Low	7.6	1	91-111	QKEQSRFRYLKRTKWPFVKTG	nucl(9),cyto_nucl(9),cyto(7),pero(4),cysk(3),plas(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZ10	ANK_REP_REGION domain-containing protein	Low	8.8	1	1193-1215	ALDIYSKKGIKNKNKAQEVRDYL	nucl(14.5),cyto_nucl(11),cyto(6.5),pero(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X014	RRM domain-containing protein	Low	7.8	1	78-102	DATDSVTPRNKKRKNEHDNEANQPE	cyto_nucl(14.333),nucl(13.5),cyto(13),mito_nucl(7.666)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6B5	Uncharacterized protein	Low	9	1	24-49	VLTVPDKTKRKTKEPFRREKPVQDDV	mito(15.5),cyto_mito(12),cyto(7.5),nucl(4)	RK (33-34, prob:0.609)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7E9	Uncharacterized protein	Low	8.7	1	674-709	DKPSAPSTPKKSRKRGARGNRKRKKKNSETETEEKK	extr(6),golg(6),E.R.(4),mito(3),vacu(3),nucl(2),cyto(2),cyto_nucl(2)	TPKKSRKRGARGNRKRKKK (681-699, prob:0.997)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XM24	Uncharacterized protein	Low	9.7	1	16-42	PPPPPPPPPPSQPPRPRPPPAQRSPDL	mito(9),cyto_nucl(7.333),cyto(7),nucl(6.5),cyto_pero(5.333),pero(2.5)	PPPPPPPPSQPPRPRP (18-33, prob:0.678)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XM40	Pyruvate carboxyltransferase domain-containing protein	Low	8.5	1	3-28	MLNDPSRKYKPFKPLRLPGRQWPDQT	nucl(12.5),cyto_nucl(10),cyto(6.5),mito(4),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XN57	Uncharacterized protein	Low	7.8	1	1-21	MSSSKIRSRRRGNEDWLWKGV	mito(12),nucl(9.5),cyto_nucl(7.5),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XR81	DNA-directed RNA polymerase subunit beta	Low	7.7	1	1208-1227	KKNLFECRPCRNKTKISQIH	cysk(16),nucl(7),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS17	Uncharacterized protein	Low	8.3	1	247-272	ILIIYCCRAQHQRKKKRNSMSEDLLD	nucl(9),mito(9),mito_nucl(9)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZW1	ArAE_2_N domain-containing protein	Low	5	1	179-198	ATAKQKRKIRSPFSLQKFVQ	plas(24),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCK2	AP complex subunit beta	Low	7	1	20-43	IELNSDKKDKNHVRKKIALKKIVA	cyto(13.5),cyto_nucl(12),nucl(7.5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XL76	Uncharacterized protein	Low	8.4	1	365-387	GQEPRKFRHARLRKKSRAAKEGN	plas(21),vacu(2),nucl(1),pero(1),E.R.(1),golg(1)	EPRKFRHARLRKKSRAAK (367-384, prob:0.96)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMI9	Uncharacterized protein	Low	8	1	230-251	SERAPQVVLNRRRMKKKSNIAA	mito(14),extr(9),cyto(2)	RMKKK (242-246, prob:0.638)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNH0	Abhydrolase_3 domain-containing protein	Low	5	1	76-95	ISPKPNSKPKSKLKDQDAEK	mito(24.5),mito_nucl(13.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPR7	Uncharacterized protein	Low	8.7	1	581-600	HFVSPRRRQRHSTRSHEPSA	cysk(14),nucl(10),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRX6	Protein SSH4	Low	7.4	1	85-107	CEELKSKADKRYKGKVRKLLEVL	nucl(10.5),mito(9.5),cyto_nucl(8.833),cyto_mito(8.333),cyto(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSQ7	Uncharacterized protein	Low	7.5	1	3-26	SEEQNPPVRRHSKRNSTDMRAQGA	mito(9),nucl(8.5),cyto_nucl(7.5),cyto(5.5),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUV0	Peptidase_S8 domain-containing protein	Low	5	1	171-196	DRTVKHESKHVKRQQQQQPQQPQQPQ	extr(13),cyto_mito(6.333),cyto(6),mito(5.5),cyto_nucl(4.333)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYJ5	Uncharacterized protein	Low	5	1	43-75	TTKTTKTKKSTTSKTTKTKKTTTSKTTKTKKTT	extr(24),golg(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3B5	Uncharacterized protein	Low	8	1	88-108	GWGNRRKKTLRRVEARKWETR	plas(23),mito(3)	RRKKTLRR (92-99, prob:0.718)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X979	Uncharacterized protein	Low	6.8	1	103-128	GHTPPITDKHHQKHHQHHQNHDHQHY	cyto(11.5),cyto_nucl(10.5),nucl(6.5),pero(4),cysk(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCJ1	Uncharacterized protein	Low	7.9	1	343-365	VDDSIKRKFSRRKRVVQLVLPTM	nucl(10),cyto_nucl(7.5),plas(6),mito(4),cyto(3),pero(1),E.R.(1),golg(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFP9	Peptidase A1 domain-containing protein	Low	5	1	543-562	GTDSIKKRSLQKRQDSASMQ	extr(26)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGS2	DNA primase large subunit	Low	8.9	1	2-25	LGRDAIRQKKREDRKAAYGNKLDA	nucl(13.5),cyto_nucl(10),mito(6),cyto(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNT3	Uncharacterized protein	Low	8.4	1	419-441	RFIVGRRRKARLRERNIYNHNFG	E.R.(10),extr(6),plas(3),golg(3),mito(2),nucl(1),pero(1),vacu(1),cyto_mito(1)	RRKAR (425-429, prob:0.645)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNU3	Mediator of RNA polymerase II transcription subunit 1	Low	8	1	91-110	DKERSKLKRVLKVLKSRPGK	mito(9),extr(5),mito_nucl(5),cyto(4),plas(3),E.R.(3)	ERSKLKRVLKVLKSRPGKISEEGIKRVAR (93-121, prob:0.845)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRJ0	Uncharacterized protein	Low	9	2	8-29, 330-353	FIKSSTPRSRECKRFLRCSTLW, DLYNPKTILKYKKRYKHLSSLQGT	mito(16),nucl(6.5),cyto_nucl(6),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSC3	Uncharacterized protein	Low	8	1	540-571	TMVRDPNWANQRRRQRQRRRRPLRRDDLGFLI	extr(14),golg(5),E.R.(4),mito(1),cyto(1),plas(1),vacu(1),cyto_mito(1)	RRRQRQRRRRPLR (551-563, prob:0.914)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTS1	AMP-binding domain-containing protein	Low	5	1	662-684	LLTPTLKLKRPQTAKKFRPEIDA	cyto(10),mito(8),cyto_pero(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUR6	DUF1996 domain-containing protein	Low	5.3	1	334-359	ATETGQKRRIGQKSKNSAKLRQRLYA	extr(24),nucl(1),mito(1),cyto(1),cyto_nucl(1),cyto_mito(1),mito_nucl(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXU1	Uncharacterized protein	Low	8.3	1	58-78	INLGSWSRRAKWKRNDEDIDV	nucl(9),cyto(5),extr(3),pero(3),mito(2),vacu(2),plas(1),E.R.(1),golg(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2W0	Chromosome segregation in meiosis protein	Low	8.8	1	53-72	DEEIKIRTRKPKVKLTEDRL	nucl(14.5),cyto_nucl(12),cyto(8.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5P0	CFEM domain-containing protein	Low	5	1	263-338	SSTTSKKTTTKSVPKPTPKKCTTTIKKVTTKKTTTKKTTTKKTTTKKTTKPCTKKASPTPKPYGKPQPAKGSRCGY	extr(23),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCE0	Uncharacterized protein	Low	8.8	1	1-27	MPSRSESKSTRRSRKPSQARTVEDRDD	nucl(14.5),cyto_nucl(11),mito(8),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCX9	Uncharacterized protein	Low	5	1	352-374	LPLLPKGSKFKRQPLPPIPNIKL	cyto(8.5),extr(7),cyto_nucl(5.5),mito(3),vacu(3),pero(2),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XDB4	Uncharacterized protein	Low	7.5	1	258-280	LGDLKEARRRCRKAVKLAREVND	mito_nucl(8.166),nucl(8),mito(8),cyto_nucl(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJ43	Protein SSH4	Low	8	1	354-379	GSASGKRKSKKSHKYTQSQPRNLPPT	extr(14),mito(3),pero(3),E.R.(3),cyto(1),plas(1),golg(1),vacu(1)	GKRKSKKS (358-365, prob:0.77)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQV3	Uncharacterized protein	Low	8.4	1	185-211	KNNNEKLPFRWRNRRSRRGPLPPGPFD	extr(19),mito(2),pero(2),nucl(1),cyto(1),cyto_nucl(1),golg(1),vacu(1)	NRRSRR (197-202, prob:0.649)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XST0	Uncharacterized protein	Low	9	1	109-128	SENTVKLKNKRIDNRFRPLQ	nucl(14.5),cyto_nucl(11.5),cyto(7.5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYL9	Chitinase	Low	8	1	376-400	KAPAEATRRFKRRHVHHRRAGFLSN	extr(20),mito(4),vacu(3)	RFKRRHV (384-390, prob:0.678)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZD8	Protein kinase domain-containing protein	Low	8.3	1	524-547	VLSSRNIYKRKVRRSQSRRSVIFT	nucl(12),cyto_nucl(11.5),cyto(9),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1C4	Phosphoinositide phospholipase C	Low	6.2	1	431-457	LHLSQTLKQKHKTKHGKGVNVRWEKKN	mito(12),cyto_mito(9.666),mito_nucl(9.666),cyto_nucl(6.666),nucl(6),cyto(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4Z0	Uncharacterized protein	Low	5	1	9-33	ATPFTCCAGRRKLKPTKPSNSNGTS	mito(22.5),cyto_mito(13.5),cyto(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7Y4	Uncharacterized protein	Low	8.8	1	362-383	KEEGNKDKKPAEQQKKKEAESD	mito(21.5),cyto_mito(12.5),nucl(3)	DKKEEGNKDKKPAEQQKKK (360-378, prob:0.753)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9E4	Uncharacterized protein	Low	6.9	1	2-28	TFAQKLRDFFHCKKKGNKPRTQNELSA	mito(13),nucl(6),cyto(6),cyto_nucl(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XA89	HET domain-containing protein	Low	6.2	1	31-51	YSPMRTPSPHPPHPHHRNISD	mito(21),nucl(3),cyto(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XC30	Elongation factor 2	Low	8	1	385-412	SSIQNFKQQKREKKFKKKVEKAGKHIDI	cysk(22),cyto(5)	KREKKFKKKVEKAGK (394-408, prob:0.932)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGV6	Uncharacterized protein	Low	9.6	1	78-109	VSPIMDGKTWKRRFKQPRKLKKRHPSEMVEED	mito(20),cyto_mito(11.5),nucl(6)	WKRRFKQPRKLKKRH (87-101, prob:0.956)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIZ8	Peptidase A1 domain-containing protein	Low	8	1	519-552	FYPLLKAANDRRKRQSKRESRRRERSRTSSANDL	extr(20),plas(3),cyto(2)	DRRKRQSKRESRRRERS (528-544, prob:0.954)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKT8	Uncharacterized protein	Low	9.7	1	50-70	AKTVRQLTTRRRYPKPTWEEI	nucl(15),cyto(7.5),cyto_mito(6),mito(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTH2	CAP10 domain-containing protein	Low	5	1	692-713	GGFSRRGGWRRQHRQRVVMHLN	plas(24),mito(1),E.R.(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X165	Uncharacterized protein	Low	5	1	29-51	SRFSTDLLRKKHRNEQTQKFSTI	extr(11),plas(9),E.R.(4),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X532	Mannitol-1-phosphate 5-dehydrogenase	Low	5.8	1	306-329	QDDIKRVCRAPKRKLGRNDRLVGP	cyto(23),nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5X9	Uncharacterized protein	Low	9.1	1	96-121	ADYPETFTKRWKWKREDRERIKFYRG	nucl(11),cyto(9),pero(4),cysk(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9Y8	FAD-binding FR-type domain-containing protein	Low	5	1	39-59	LATTKFKPRSRPSPLSPPPPP	mito(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGL5	N-acetyltransferase domain-containing protein	Low	5.8	1	148-169	AYDMRKPMKRDVKKESIREKGE	mito(10),cyto(5.5),E.R.(5),cyto_nucl(4.5),golg(3),nucl(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIL5	Importin N-terminal domain-containing protein	Low	6.5	1	874-894	EQTTRIMTRAQRKNNPIRYTS	cyto(16.5),cyto_nucl(13.833),cyto_mito(9.832),nucl(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS94	Uncharacterized protein	Low	7.6	1	8-27	ITRRSAKCKRVTSPIPHDRD	mito(17),nucl(7),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYZ3	CAP10 domain-containing protein	Low	5	1	77-98	LTRDQLKKFDRYKRAQPKSFAQ	cyto(8),E.R.(7),plas(4),extr(2),pero(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZV3	Uncharacterized protein	Low	9.8	1	424-445	KYIIERSKPCQQLKKRGFCEDE	nucl(12),cyto(10),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X181	Uncharacterized protein	Low	9.7	1	504-528	AHSFNKSRSASPCKKRKLDDITRER	nucl(17.5),cyto_nucl(11.5),cyto(4.5),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1E7	Uncharacterized protein	Low	9.8	1	15-43	EPPPSRRTESRVQKLRRNPRPMENPCNTK	nucl(19.5),cyto_nucl(14.5),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2G8	IPPc domain-containing protein	Low	9.6	1	1185-1204	VFQLRVKTVNKRKREEVMRS	nucl(18.5),cyto_nucl(14.5),cyto(7.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4D7	Uncharacterized protein	Low	8.7	1	1398-1417	QKEHDKRKRDGKYRESVEKQ	plas(22),nucl(2),cyto(2),cyto_nucl(2)	KRKRDGKYRESVEKQHR (1403-1419, prob:0.752)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8J1	Chitinase	Low	9.1	1	391-416	EGRSTLARGRTPRRRHAIRRRHRHRQ	extr(18),nucl(3),mito(3),mito_nucl(3)	RKGEGRSTLARGRTPRRRHAIRRRHRHRQ (388-416, prob:0.991)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9I6	GPI ethanolamine phosphate transferase 2	Low	8	1	665-688	MCSWMGRKMKEKKAAKKDEGDNSS	plas(19),mito(4),E.R.(2),cyto_mito(2),mito_nucl(2)	KMKEKKAAK (672-680, prob:0.704)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XD09	Protein kinase domain-containing protein	Low	9.6	1	118-139	ANYNPSQHRRRRQSQLRIKGED	nucl(18),cyto_nucl(12),cysk(5),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGU3	Protein kinase domain-containing protein	Low	8.3	1	346-367	QYSQHPQQQHPQHPQQHPQQHP	nucl(10),cyto(7.5),mito(6),cyto_pero(5),pero(1.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLZ3	TPR_REGION domain-containing protein	Low	7.9	1	1230-1261	IASLYKKKGMRNKAMRWYKRCKRLATVEGRGF	nucl(9),cyto(7.5),cyto_mito(6.5),mito(4.5),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUQ7	Uncharacterized protein	Low	6.1	1	139-163	NYMQKECRVTRRKLKNSYKEKIETH	cyto(6.5),extr(6),cyto_nucl(5.5),E.R.(5),nucl(3.5),pero(3),golg(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5H1	Uncharacterized protein	Low	9.4	1	123-149	GAMGCFKKENKGKKKCLGKGRNSKTSD	plas(13),nucl(4),E.R.(4),cyto(3),golg(2),mito_nucl(2)	KGKKK (133-137, prob:0.651)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5V0	Cysteinyl-tRNA synthetase	Low	8	1	832-853	EPVAKSRGKTLKKQWAAQKKAH	mito(18),cyto_mito(13.5),cyto(7)	REKEEKAAERERNKEELRRQKEK (768-790, prob:0.779)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6S1	Uncharacterized protein	Low	7	1	142-166	EVKGEKQRRYFRRIRLEHKKGIEYC	cyto(14),pero(6),nucl(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAA9	CFEM domain-containing protein	Low	7	2	80-101, 169-198	FSGYKCQKSKLQRRSGRGSGSK, GAKSVKCKIHKSSQNKKKCKFNIHHIKFRC	extr(19),E.R.(3),mito(2),cyto(2),cyto_mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFN4	Uncharacterized protein	Low	7.5	1	13-33	VVSTSRKRRRLSPTCDKDSLE	cyto(13),cyto_nucl(12.833),nucl(11.5),cyto_pero(7.833)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XI45	Uncharacterized protein	Low	8	1	85-114	VTSGARPAKWRPPSRSRSRQQQKEQAKLTP	plas(19),mito(3),extr(3)	WRPPSR (94-99, prob:0.62)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIS9	Uncharacterized protein	Low	8.8	1	123-144	QADKDKKLEKKATRRANKEAKW	mito(18.5),cyto_mito(12),cyto(4.5),nucl(3)	KDKKLEKKATRRANKEAKWGARADRKQHR (126-154, prob:0.966)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XP24	Protein kinase domain-containing protein	Low	9.3	1	658-680	PWVIHCRWKKQGYKHTTPPRPSS	nucl(16.5),cyto_nucl(13),cyto(8.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRR5	Uncharacterized protein	Low	8	1	1501-1529	VLRTAHRKPLQVRRRRARRESRPADRDGY	extr(26)	RKPLQVRRRRARRESR (1507-1522, prob:0.906)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSD1	WD_REPEATS_REGION domain-containing protein	Low	5	1	786-811	VSLQPRSQRFRKQKLDHTWRKNRETL	extr(11),plas(4),E.R.(4),cyto(3.5),pero(3),cyto_nucl(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XVA4	PNPLA domain-containing protein	Low	9.9	1	625-645	KECARRMAKLTRDKWKKKIAA	mito(18),nucl(5),cyto(3)	RPRGASKSTKGKAHLGEMERLRRSKNAARS (192-221, prob:0.804)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYN1	Smr domain-containing protein	Low	9.1	1	157-180	SMHLNSSRRKGKKKVNRQSQSGNI	cyto(14.5),cyto_nucl(10.833),cyto_mito(8.166),cysk(6),nucl(5)	RRKGKKK (164-170, prob:0.781)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1S6	Uncharacterized protein	Low	8.7	1	58-81	DLDSPSKSNKPQKPKDVSRDPTLI	nucl(14),cyto_nucl(9.333),mito(7),cyto_pero(3.666),pero(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2J2	Uncharacterized protein	Low	7.8	1	2-21	VTKNTPPPPRERPRGLVQTP	nucl(9.5),mito(8),cyto_nucl(7.5),cyto(4.5),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X612	Uncharacterized protein	Low	9.7	1	823-845	TVDRGEIKRKKHEEKMERRALRK	mito(18.5),mito_nucl(13),nucl(6.5)	IKRKKHEEKMERRALRKAE (829-847, prob:0.905)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XB02	Uncharacterized protein	Low	9.2	1	38-57	ESPLTKRFRKLNIRNTPSKI	nucl(17),cyto_nucl(11.333),mito(6.5),cyto_mito(5.666)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJ72	ZT_dimer domain-containing protein	Low	8	1	65-89	KANISNTGKKRKNPHAKSPSGKELK	plas(14),mito(5),E.R.(3),cyto_mito(3),mito_nucl(3)	KKRKNPHAKSP (73-83, prob:0.781)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XK14	S4 RNA-binding domain-containing protein	Low	6.3	1	31-55	MPQTSRKTFYQQKFRAKQETRRFHG	mito(17),mito_nucl(12),nucl(5),cyto(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPX0	ANK_REP_REGION domain-containing protein	Low	7.7	2	1370-1393, 1504-1526	CGPLAGDDKCKRRKKPDVVAPGTM, LVWGSKKSFTFRKPPKNECTTVK	cyto(13.5),cyto_nucl(8.5),mito(4),nucl(2.5),E.R.(2),golg(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS64	Uncharacterized protein	Low	8.3	1	449-474	KTYQSRSGLAKHRKTRHDINVHQESR	nucl(11.5),cyto_nucl(8.5),plas(6),cyto(4.5),pero(2),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XT85	MYND-type zinc finger protein samB	Low	7.4	1	1131-1153	NVEYCSKECQKKDWKAHKKTHGT	cyto_nucl(9),nucl(8),cyto(8),mito(4),E.R.(3),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WY13	Serine/threonine-protein phosphatase	Low	7.1	1	524-548	DSAALKSHIKKGRNKRNSLYPQSPP	cyto_nucl(9.333),nucl(8.5),cyto_mito(7.999),mito(7.5),cyto(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYN0	Methionyl-tRNA formyltransferase	Low	5.8	1	260-279	HLFCYRRKLKASKKAQHFVR	mito(24),nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3D6	Uncharacterized protein	Low	6.6	1	16-36	YEPWPKSKTPGRECSNPRRHS	plas(7),mito(5),cyto_nucl(5),nucl(4.5),cyto(4.5),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6V4	Uncharacterized protein	Low	7.2	1	422-451	EEKLSTPPKRQSLNKTYKAKASKRRDIGSL	mito(14),mito_nucl(12.833),nucl(9.5),cyto_nucl(6.666)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X814	Uncharacterized protein	Low	5	1	336-357	GPNGRPRTFDPTPRRRRPYGDS	extr(9),plas(8),mito(3),E.R.(2),golg(2),vacu(2),cyto_mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X882	F-box domain-containing protein	Low	8.7	1	8-32	FQNLAPKSKSTTRPKNDSKSPASTS	mito(13),nucl(11.5),cyto_nucl(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAU5	Uncharacterized protein	Low	8	1	188-208	ISRPHSYHSWRKEHNKKRSTD	plas(17),mito(3),extr(3),E.R.(3)	AK (539-540, prob:0.609)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XC66	Clr5 domain-containing protein	Low	8.8	1	51-74	SQLEYQLKKWKIRKNLKKEDYILA	nucl(13.5),cyto_nucl(10.5),cyto(6.5),pero(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEP6	Tyrosine--tRNA ligase	Low	8	1	344-373	EKLAYPPPPAPEKKKKEKKIGTGYVAKKKG	cyto(23.5),cyto_mito(13)	PAPEKKKKEKKIGTGYVAKKK (352-372, prob:0.957)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGP7	H_lectin domain-containing protein	Low	8.9	1	94-113	LSPPGSWRDREKHNRSPFSE	nucl(13.5),cyto_nucl(9),pero(6),cyto(3.5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGS5	CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4	Low	7.3	1	736-756	EFYMKPPRKEVQKPPPPDFGA	nucl(9.5),cyto_nucl(8.833),cyto_mito(7.833),mito(7.5),cyto(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHI8	Threonyl-tRNA synthetase	Low	8	1	24-49	SAPAAAKPKGEKKEKQKKPAAPAAPA	cyto(20.5),cyto_nucl(12),pero(3)	AAKPKGEKKEKQKKPAA (28-44, prob:0.959)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHN0	Uncharacterized protein	Low	6.1	1	1-23	MLSKLKLTNLRRRSRQSLNIASE	mito(18),cyto(4.5),cyto_nucl(4.5),nucl(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJH9	DOC domain-containing protein	Low	9.2	1	373-392	EPTPPRPRPAPKSNLSDRIE	nucl(15),cyto_nucl(11),mito(5),cyto(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQW6	Uncharacterized protein	Low	5	1	635-657	SSSMSKYTRRRMPPQPRSTRSTT	plas(21),E.R.(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XR95	RNB domain-containing protein	Low	7	2	11-30, 46-68	IATLRTWRPRQLPRHTRLIL, RSVTARRRYEKSRQDKEEQTEQH	mito(22),cyto_mito(13.5),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUH3	Uncharacterized protein	Low	5	1	178-198	KSSSPIKAGRKRRYYRCCYCY	extr(18),golg(3),plas(2),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYB3	Uncharacterized protein	Low	5	1	1-22	MEVRKRTAKQEKHPHHHHFSAS	plas(27)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2Q2	Uncharacterized protein	Low	5	1	361-383	GKHGTERKSHANQSRRTNRPPTH	plas(26)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4W0	ANK_REP_REGION domain-containing protein	Low	9.5	1	42-68	FVKNLDAKLQQKQKRRKTLQSSSFTTF	nucl(16.5),cyto_nucl(10.5),cyto(3.5),mito(2),plas(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5G0	Uncharacterized protein	Low	9.4	1	45-66	NELSRPCHRRKLYQPIHKSRSA	nucl(15.5),mito_nucl(10.5),mito(4.5),cyto(3),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7G9	5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase	Low	5	1	477-503	RQNPRVLALKWKKSTKRPEKSNAIDLL	cyto(18.5),cyto_nucl(11.333),cyto_mito(10.166),cysk(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8H1	D-aminoacyl-tRNA deacylase	Low	6.5	1	116-138	LNTPDKKAQLKPQKGNKLSKLKG	cyto(12),cyto_nucl(9.5),pero(7),nucl(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8V0	ZnMc domain-containing protein	Low	6.4	1	212-232	ITRIQKYYKPSGMRRVRRRNM	mito(16),cyto_nucl(4.833),nucl(4.5),cyto(4),cyto_pero(2.833)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XA94	Tyrosinase_Cu-bd domain-containing protein	Low	5	1	37-56	KYPFASPKCRHPLIRKDWRA	extr(19),mito(5),cyto(1),plas(1),E.R.(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFF1	TPR_REGION domain-containing protein	Low	7.3	1	1141-1160	DTNERVRRRDKVTGYFKRWR	cyto_mito(8.5),nucl(8),cyto(8),mito(7),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGW0	Uncharacterized protein	Low	8	1	208-228	DDPASKATPRPKKKITADDYF	mito(11),nucl(8),plas(3),cyto(2),extr(1),pero(1),E.R.(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPA9	U1 small nuclear ribonucleoprotein C	Low	6.4	1	21-46	NSSTKQPPTRRTARWTRPRPRATSSL	mito(16),cyto_mito(10),nucl(5),extr(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUF9	Seryl-tRNA synthetase	Low	8.9	2	15-35, 436-461	PEAIRESQRRRHKPVEDVDAI, TKELPKDTTSEKKKNQQLKVVGKKQA	cyto(15),nucl(5.5),pero(5),mito_nucl(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUW1	Uncharacterized protein	Low	8	1	262-290	GIPLNSPRARRRYRKTWRRTPIRVKFLEA	plas(7),E.R.(6),mito(4),cyto(4),cyto_mito(4)	PRARRRYRKTWRRT (268-281, prob:0.829)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WY21	F-box domain-containing protein	Low	5	1	33-52	AETPERPRSQKHRNIAEIRG	extr(11),mito(3),cyto(3),E.R.(3),golg(3),cyto_mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0J1	Uncharacterized protein	Low	5.8	1	11-37	VEGQDRRPGNTPKRHKKDNSTPLKGLA	plas(23),nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0S5	Uncharacterized protein	Low	6.1	1	7-26	FSTGCFCCRRRKIKVGYYLA	mito(20.5),cyto_mito(11.5),nucl(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X507	alpha-1,2-Mannosidase	Low	9.4	1	501-524	NELLWRKTRSKTDKKPRKNEETCE	cyto(10.5),cyto_nucl(8),pero(6),nucl(4.5),extr(3)	TRSKTDKKPR (508-517, prob:0.688)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7K3	Sm domain-containing protein	Low	5	1	44-64	TEEFRRTKRKATKSNPNAPTT	mito(19),cyto(2),plas(2),pero(2),cyto_pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8X1	Uncharacterized protein	Low	7.1	1	312-336	LDGNRQPRMCRVSRKERRFWERYYM	cyto(10),cyto_nucl(9.833),nucl(8.5),cyto_pero(7.333),mito(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9T6	Uncharacterized protein	Low	9.3	2	291-317, 607-626	AISCISKKLARRCQKMKDKVPPAPLAR, SAGRYKHNRGCEKCRWNKEA	cyto_nucl(8),nucl(7.5),cyto(7.5),pero(3),E.R.(3),golg(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEJ2	Uncharacterized protein	Low	5	1	13-39	SHSFHSSARPLRQPRLKKKSSIGNLVD	plas(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XK30	Uncharacterized protein	Low	5	1	552-576	NPLRALTVPKRRPRWVNNLRRAMHD	cyto(9.5),plas(7),cyto_nucl(5.5),E.R.(3),mito(2),pero(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLQ7	Ubiquitin carboxyl-terminal hydrolase	Low	5	1	67-89	PLALNIRRTKKPKVERDEPPTKL	cyto_mito(12.833),cyto(12.5),mito(11),cyto_nucl(7.166)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRQ1	Peptidase_S8 domain-containing protein	Low	8.9	1	66-88	PDWNVGISRARRKRRISGFDGND	plas(9),cyto(6.5),cyto_nucl(5),nucl(2.5),mito(2),pero(2),vacu(2)	RARRKRR (74-80, prob:0.743)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZ30	Uncharacterized protein	Low	8.2	1	293-318	VTGNRRSCLKFTKRILKSRRKLLTKT	nucl(10.5),cyto_nucl(8.5),pero(6),cyto(5.5),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X332	Pribosyltran_N domain-containing protein	Low	5	1	88-111	VLPYFPYSKQSKKKSHRGAITARM	mito(14.5),cyto_mito(11.833),cyto(8),cyto_nucl(6.833)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5H9	Uncharacterized protein	Low	7	2	40-60, 443-462	PPTVAKFVKKKLNKARPVTFT, KDYVKRIKEKLRICRNIDES	extr(9),E.R.(6),golg(6),mito(3),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X845	Uncharacterized protein	Low	9.5	1	11-36	WWKSIKSWWKSIKSWWKKLETSRQEC	nucl(14.5),cyto_nucl(9),mito(6),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X951	Uncharacterized protein	Low	5	1	38-61	IVSSITTTKRKDRPAREKFSNDTV	mito(12.5),cyto_mito(9),plas(5),cyto(4.5),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9G5	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	22-61	GGEPSKPTRVSKKRTKTGCLTCRKRRIKCGEERPTCNNCV	plas(14),nucl(12)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAC1	ANK_REP_REGION domain-containing protein	Low	9.4	1	450-470	KSASEKRKKMHGKKDSRFRSS	plas(9),extr(6),cyto(5),nucl(4),cyto_pero(4)	ASEKRKKMHGKKD (452-464, prob:0.868)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAD0	DUF2235 domain-containing protein	Low	9.3	1	1264-1294	LRQGRGKVQPCKFKHHRNRDHGHGSNHRHNE	nucl(14.5),cyto_nucl(9),plas(4),cyto(2.5),mito(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLH0	Uncharacterized protein	Low	9.7	1	1066-1102	EDNSEMKFKAKKKKKITKKELKEREVRRRLRHIEWLN	cyto(11.5),cyto_nucl(9),nucl(5.5),mito(4),E.R.(3)	KFKAKKKKKITKKELKEREVRRRLR (1072-1096, prob:0.996)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNA8	Uncharacterized protein	Low	5	1	307-331	GGDQRVPSRRPDPRKTYFPSRNPWE	mito(20),cyto(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WY58	TGc domain-containing protein	Low	9.7	1	458-479	IDEIREKRRKNLSNEDKNRLMR	nucl(18),cyto_nucl(13.5),cyto(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WY61	Uncharacterized protein	Low	9.5	1	1-23	MSYNGRKNPPRRRNYPKGPLTVN	nucl(16.5),mito_nucl(12.5),mito(7.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0I2	Uncharacterized protein	Low	5.8	1	151-176	MYYTGSYRNSQKKRKRSWGWLTGGKE	extr(9),cyto(7),nucl(2),mito(2),E.R.(2),golg(2),mito_nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X892	F-box domain-containing protein	Low	9.8	1	160-181	ICDRCRRPSCRNCKTRNAKPTH	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XB19	Histidine--tRNA ligase	Low	5	1	365-385	ASSSKGKKKSKVNKDDPEADR	mito(20.5),cyto_mito(14),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJN0	DUF5672 domain-containing protein	Low	5	1	293-312	AERFIDSKKCPSKQNWKRDT	extr(9),E.R.(7),golg(5),plas(3),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRA3	Amidase domain-containing protein	Low	5.9	1	1-24	MFSYLQHRKNCKIKQQDRANRIAS	mito(18),cyto_mito(12.166),cyto_nucl(5.166),nucl(4),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZF7	S5 DRBM domain-containing protein	Low	7.5	1	66-89	NGISRTAPLRWKPRRRDSFSLPYF	mito(15),nucl(8),cyto_nucl(6.5),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZT2	TPR_REGION domain-containing protein	Low	8	1	1-24	MAKTKTKSSKKTRRKDAPASLASV	cyto(17.5),cyto_mito(12.5),mito(6.5)	KSSKKTRRK (7-15, prob:0.689)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X780	Uncharacterized protein	Low	8.3	1	2-23	FYIHAPKHYVHRQPIRRPPLEL	mito(14),nucl(10.5),cyto_nucl(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X833	Uncharacterized protein	Low	7.9	1	21-45	KILARNCTKHAKKNTFRDWQRHFRE	mito(12),nucl(8),cyto(4.5),cyto_pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8D7	Uncharacterized protein	Low	8	1	454-480	HASSTRTKIVQPKSYRKKSEPKKVTKS	plas(27)	PKSYRKKSEPKKVTK (465-479, prob:0.814)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9L4	Uncharacterized protein	Low	8.4	1	30-53	RDGGRPQHFKKRRYQDDDDRDYRQ	nucl(12.5),cyto_nucl(11.5),cyto(9.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XA31	Uncharacterized protein	Low	8	1	84-103	EAAPKDKKPKPWPPFRGGRD	extr(21),mito(3),E.R.(1),golg(1),vacu(1)	AAPKDKKPKPWPPFRGGRDIWKR (85-107, prob:0.903)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XA40	J domain-containing protein	Low	5	1	19-42	DIKKAYKKLALKWHPDRNRDNKEA	cyto(13.5),mito(12),cyto_nucl(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEI7	Uncharacterized protein	Low	9.8	1	288-307	YTTTRPRPPRFNKRLEPNTV	mito(14),nucl(13)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEJ6	Peptidase A1 domain-containing protein	Low	9.5	1	355-380	ASLGVLFFRRKRKKKGNRREDCAIME	plas(14),cyto(5.5),cyto_nucl(5.5),nucl(4.5)	RRKRKKKGNRR (363-373, prob:0.955)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFP5	Uncharacterized protein	Low	9.5	1	20-44	HETPADWKPIKKRPRYTPSKESLAY	nucl(15),mito(11.5),cyto_mito(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGR7	WD_REPEATS_REGION domain-containing protein	Low	9.7	1	83-104	AIGSPSTPSKPRKRAPNGELNH	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPV5	Uncharacterized protein	Low	5	1	20-40	PDPSKEPKKYVSKNAKQPEEL	extr(27)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRY1	Uncharacterized protein	Low	9.2	1	514-538	KDENDKTPPKTRKVKKQVKKGDLTV	cyto(20.5),cyto_nucl(13),nucl(4.5)	PKTRKVKKQV (522-531, prob:0.723)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WY86	DNA helicase	Low	8.5	1	821-869	ECEADTQKRSTKRKSDKISDDNLGSQPNQQKVSKKKTDKGKSTNTVTNY	nucl(14.5),cyto_nucl(11.833),cyto(8),cyto_mito(5.333),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7X9	Uncharacterized protein	Low	7	2	67-88, 264-290	EKRDLECRKIHKPKYTDKCAFV, FVVGWHWYTKRQKRKKMIEIRTRGHYT	plas(22),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9U4	Phospholipid-transporting ATPase	Low	8	1	265-288	DILAANKKGKKKARRGSSGNSHSI	plas(23),cyto(1),E.R.(1),golg(1),vacu(1)	KKGKKKARRG (271-280, prob:0.932)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEI2	Uncharacterized protein	Low	8.4	1	388-409	EYSSWEACYNKRRREGRRVWRK	plas(17),mito(4),E.R.(2),nucl(1),cyto(1),cyto_nucl(1),golg(1),vacu(1)	KRRREGRRVWRK (398-409, prob:0.86)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XH20	Uncharacterized protein	Low	8.2	1	741-769	DSPYMRKPVNPYRHMRPKRARPSDYTAVG	nucl(10),cyto(7.5),cyto_mito(7.5),mito(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHH8	Uncharacterized protein	Low	5	1	28-47	ASPKCDKKCAKSLIQRDVRS	extr(13),plas(6),mito(4),E.R.(2),mito_nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHQ9	Uncharacterized protein	Low	7.1	1	10-33	KQTCGFKPQKPSRIPQRVNRSSNP	mito(16.5),cyto_mito(10.5),nucl(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKP8	Uncharacterized protein	Low	9.1	1	356-377	DGNAGKSKKGRPKKDVAPNTND	mito(20.5),cyto_mito(11.5),nucl(4)	KSKKGRPKK (361-369, prob:0.796)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLK4	Uncharacterized protein	Low	8.7	1	232-251	IKGAPRRKCGKGKQVERPAH	plas(10),mito(5),E.R.(3),cyto_mito(3),nucl(2),extr(2),pero(2)	PRRK (236-239, prob:0.635)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLX5	Isoleucyl-tRNA synthetase	Low	7.2	1	894-913	WPTLGKKLKKDVQRVKKALP	cyto(16.5),cyto_nucl(13),nucl(8.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNB6	Uncharacterized protein	Low	8.8	1	76-96	FDSYFRPRSRIRKGTPTRATV	nucl(10),cyto(6),pero(5),mito_nucl(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTU0	Mitochondrial escape protein 2	Low	5.4	1	6-37	TTRAQCLRRAYPRSIRQSWRFQPPRRHATATA	mito(17),cyto(5),plas(2),nucl(1),pero(1),E.R.(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0G9	Dynein heavy chain, cytoplasmic	Low	9.3	1	469-489	KFIPIKVTKRHSKTQERLTYV	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1T6	Uncharacterized protein	Low	9.1	1	743-771	LVRFLKSLSGKKQKKSRKPSVVNERNSPP	mito(13),plas(5),nucl(3),cyto(3),cyto_nucl(3)	SGKKQKKSRKP (751-761, prob:0.84)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5T8	Uncharacterized protein	Low	5	1	60-84	KDKHWVKYTRPHFSHRKKVYIRASQ	extr(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9P7	tRNA dimethylallyltransferase	Low	9	1	428-451	VNGRAHRRLVGRKLKKEQIQLVKV	nucl(13),mito(12.5),cyto_mito(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XA54	Uncharacterized protein	Low	9.8	1	64-83	KMYREVKKKRDILQMRERLS	nucl(13),cyto(7),mito_nucl(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAJ8	Calcium-transporting ATPase	Low	7	2	254-276, 1223-1248	IYQTIQAQKRARRNPNNPESKEA, NSQIPPPSPSSHRRKRSRSNSAFAAA	plas(21),E.R.(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAK6	DAGKc domain-containing protein	Low	5	1	38-59	RVTIADKRKSSKKRDASCCGIA	cysk(24),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XB52	Uncharacterized protein	Low	8	1	82-101	GKLKRISKTGKKSKNILKPG	extr(16),golg(5),E.R.(3),vacu(3)	KRISKTGKKSK (85-95, prob:0.703)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCP2	Uncharacterized protein	Low	5	1	69-94	SKTGSLRKTARNPKSSRDRQPPSIAT	plas(24),mito(1),E.R.(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGZ8	PNP_UDP_1 domain-containing protein	Low	9.5	2	400-426, 447-491	TTTPNPEVSNKPKCKRRRGWVEEEEED, GDKECRLGPKRCKSSSRSRYEESPSSRGWPRSYRRGPSQSRYWEA	cyto(12.5),cyto_nucl(11.5),nucl(9.5),extr(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XH12	Uncharacterized protein	Low	6.7	1	108-128	SVDAKMDKRRKIQREAREIAE	mito(9.5),cyto_mito(9),cyto(7.5),nucl(6),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XL84	Uncharacterized protein	Low	9.9	1	1889-1916	NGALWIIRPRRNRAKARKERIAQCNLTN	plas(16),nucl(5.5),cyto_nucl(4.5),cyto(2.5)	RPRRNRAKARKE (1896-1907, prob:0.85)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XL89	Uncharacterized protein	Low	9.7	1	239-262	WDSTKFGAKKAWKNRKQITECKVT	cyto(16.5),cyto_nucl(12),nucl(6.5),mito(2),pero(2)	GGFKQFAKRREAEEREARRK (211-230, prob:0.77)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQB4	DUF1279 domain-containing protein	Low	8	1	262-286	VKDARANLKERRSKKGKRKNDDDDD	mito(17),extr(3),E.R.(3),plas(2)	GKKGGVRQGVKDARANLKERRSKKGKRK (253-280, prob:0.984)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQQ9	Uncharacterized protein	Low	5	1	1089-1108	FPKTDKRKLRELFKEKDVKG	mito(22.5),cyto_mito(14),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0L4	Uncharacterized protein	Low	7.5	1	10-34	ELDFSFKLKRARRRSQEYIPPQYPF	mito(11),nucl(8.5),cyto_nucl(8.5),cyto(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3I6	Uncharacterized protein	Low	8.3	1	168-211	EGEKKEGEKKEEKKEEKKEEKKEEKKEEKKEEKKAEKRDEHENA	extr(8),E.R.(6),mito(4),plas(3),vacu(3),pero(1),cyto_nucl(1),cyto(1),nucl(1),cyto_pero(1)	ARPKREDKGPRKGGEKKEGEKKEGEKKEGEKKEGEKKEEKKEEKKEEKKEEKKEEKKEEKKAEKR (141-205, prob:0.998)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4E8	Coronin	Low	6.6	1	5-25	VRSSKYRHVFGRPTKKEQCYD	mito(14),pero(7),nucl(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAJ1	WD_REPEATS_REGION domain-containing protein	Low	9.4	1	80-99	AASARKGAKKQKLQPKVTDD	pero(9),cyto(8.5),cyto_nucl(7),nucl(4.5),mito(4)	RKGAKK (84-89, prob:0.648)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIX9	Peptidase_S8 domain-containing protein	Low	6	1	33-52	QHSTRKRSSILKFRRDNRGG	cyto(13),cyto_nucl(10.333),cyto_pero(9.999),pero(5.5),nucl(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XP68	PNP_UDP_1 domain-containing protein	Low	7.3	1	386-406	EESGTNKRKRQREDHCGSRGC	nucl(11),cyto_nucl(10.833),mito_nucl(10.499),mito(8.5),cyto(7.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRS4	PNP_UDP_1 domain-containing protein	Low	7.8	1	147-166	KPIYTEKKRFGRQEQVRERH	cyto(14),nucl(9),cyto_pero(9)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYB9	RING-CH-type domain-containing protein	Low	5.3	1	390-417	DIFTLYYKYKRAKQRRSREILNYQKRIV	plas(21),mito(3),nucl(1),cyto(1),cyto_nucl(1),pero(1),cyto_pero(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZ78	Uncharacterized protein	Low	7.5	1	38-61	ELKAKTQQRKGGQRQTPRKAKEQA	mito(18),nucl(9),cyto_mito(9)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZD4	tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase	Low	9.4	1	256-280	ETPLESKKTRAFRKKAEGMDKGRKL	mito(15.5),mito_nucl(11.666),cyto_nucl(6.833),nucl(6.5),cyto(5)	KKTRAFRKKAEGMDKGRK (262-279, prob:0.793)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1I8	F-box domain-containing protein	Low	7	2	193-215, 1237-1257	LDKEHIWRRCRKIHCPDMPKPAF, VDSRTRSRSRGHRRRDSYDDY	mito(19.5),cyto_mito(12.5),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X274	SRR1 domain-containing protein	Low	8.9	1	19-53	ISNSNSRKSKTQNGKNNNNKKKGSGQKQNSIEKKN	nucl(18.5),cyto_nucl(12.833),mito_nucl(11.166),cyto(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2G1	Uncharacterized protein	Low	8.2	1	77-100	RIIVTWHRRNPHKPKSWTPQWLWK	nucl(14.5),cyto_nucl(13.833),cyto(10),cyto_mito(6.999)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2M9	Plasma membrane ATPase	Low	5	1	899-923	FDNLMHGKSPKQKQKQRSLEDFVVS	plas(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5K9	Uncharacterized protein	Low	5	1	163-185	SSQAHEQKRWYGRKRSNPDDVRA	plas(17),E.R.(3),vacu(3),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5M2	Uncharacterized protein	Low	5	1	273-292	GGTRRMRRKLQRRADETPKF	extr(21),golg(3),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X856	Uncharacterized protein	Low	6.5	1	27-53	HTRGRTYHTTCRPSKRSNRNVRTWDLL	mito(18),nucl(4.5),cyto_nucl(3.833),cyto_pero(2.333),cyto(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XND7	Uncharacterized protein	Low	8	1	65-92	TIEARDPKGRKGRKTRGLHKKINVSGRS	extr(24),cyto(3)	DPKGRKGRKTRGLHKKINVSG (70-90, prob:0.971)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPW4	Uncharacterized protein	Low	8.2	1	94-113	LAFRVEYQKKEKIKRNRPLS	cyto_nucl(14.5),nucl(12.5),cyto(11.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRX0	Uncharacterized protein	Low	8.9	1	340-359	EGSNVRRKRVREPEHEDPYG	nucl(15.5),cyto_nucl(11.333),cyto(6),cyto_mito(4.833),mito(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSM4	Uncharacterized protein	Low	9.5	1	88-111	SPEITKVSSKRRRKTRSFTPSKVF	mito(12),mito_nucl(10.666),cyto_mito(9.666),nucl(8),cyto_nucl(7.666),cyto(6)	KRRRKTR (97-103, prob:0.766)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WY66	Uncharacterized protein	Low	8	1	567-592	SQTIKRATSQSRKRPRRTRQSMEEIP	plas(25)	RKRPRR (578-583, prob:0.712)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYM5	Uncharacterized protein	Low	7.8	2	45-68, 331-351	ALTSLVYKRWRERPQRPVKIWFFD, AIIAQKQKRGHSKKGSTSARI	plas(13),extr(4),E.R.(4),nucl(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZL8	Uncharacterized protein	Low	5	1	172-192	YEEIRRKIYKRKKIDHPSLIQ	extr(9),plas(7),mito(5),cyto(3),pero(3),cyto_pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1M8	WD_REPEATS_REGION domain-containing protein	Low	9.7	1	302-330	RNEKEIQKVISRKKKRKRVKGKDEAAEDV	cyto_mito(11),mito(9.5),cyto(9.5),nucl(6)	KVISRKKKRKRVKGK (309-323, prob:0.987)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2I2	Uncharacterized protein	Low	7.2	1	1034-1053	PPENTRCRTPPPRHFLHSRY	cyto_nucl(11),cyto(10.5),nucl(8.5),mito(2),E.R.(2),plas(1),extr(1),pero(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5G8	Uncharacterized protein	Low	8	1	375-394	EALNSSKKEKRRPDMLNMKS	nucl(10.5),mito(10),cyto_nucl(8.5),cyto(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X978	Uncharacterized protein	Low	9.3	1	54-74	DYNRARRRADQLQKEKDHNRS	nucl(17.5),cyto_nucl(13.333),cyto(6),cyto_pero(3.999)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XD16	Uncharacterized protein	Low	5.8	1	13-34	AIHVPPPHRHHHRESHEPRNLS	mito(11),cyto(8),pero(5),nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XF89	Uncharacterized protein	Low	8	1	328-359	IPAACATRSTRRRRTIRKHKRKKDIDSTIDSI	plas(21),mito(3),vacu(2),mito_nucl(2)	TRRRRTIRKHKRKK (337-350, prob:0.97)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGS7	Exportin-T	Low	6.2	1	895-917	ETILPEDKKKNPQPAQKNVPQEP	cyto(12),cyto_nucl(9),mito(5),nucl(4),E.R.(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHJ6	Uncharacterized protein	Low	9.4	1	1-28	MRRRRRSRTTTTTRTRTRTRMRMRTDGD	nucl(12),mito(10),cyto(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKS8	Uncharacterized protein	Low	9.6	1	30-51	TSEQPRTVPKPQKSTPKQQGST	mito(21),nucl(4)	KKKK (430-433, prob:0.669)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPR2	UBC core domain-containing protein	Low	7.8	1	148-167	RENLPEFKKKVRKCVRDSLE	nucl(13),mito_nucl(10.833),cyto_nucl(9.833),mito(7.5),cyto(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRL8	FAD-binding PCMH-type domain-containing protein	Low	5.8	1	436-458	GKERVQKLMKIKKKWDSENYWGA	cyto(21),pero(3),nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXW9	Uncharacterized protein	Low	9.4	1	68-102	QIENTAPKKLKGKHKPKPRSRSKKRVNPQIFPGPT	cyto(9.5),cyto_nucl(7.5),nucl(4.5),E.R.(4),mito(3),extr(3)	PKKLKGKHKPKPRSRSKKR (74-92, prob:0.996)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3U9	Uncharacterized protein	Low	9.8	1	92-114	KEQGKCVRTWRFKDNRQPVKQSQ	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6P9	Uncharacterized protein	Low	8.5	1	23-44	QLARVRPDVKPGRRPNTKLLSF	nucl(9),plas(7),mito(4),pero(3),cyto_mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6Q7	Uncharacterized protein	Low	8.7	1	724-744	RATPRRCFKHREEVRARAKAG	nucl(13),cyto_nucl(11.5),cyto(8),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8H8	Uncharacterized protein	Low	7.5	1	392-415	YEPGTEPRYKPKKTVKNVLEAVKF	cyto(9.5),cyto_nucl(9.5),nucl(8.5),mito(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XA21	Uncharacterized protein	Low	7.8	1	341-362	QDNLGRFFKKPKPPQIPNSDNV	plas(15),nucl(7),golg(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XDK1	Uncharacterized protein	Low	8.2	1	27-55	VSNSTCPNRPNTPKRRKGPIQIKDLPRGL	cyto_nucl(12.5),nucl(12),cyto(11),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFT4	Uncharacterized protein	Low	6.8	1	582-603	AIKNFVIARCPKRRDRGNQHMV	plas(18),nucl(5),mito(1),cyto(1),golg(1),vacu(1),cyto_mito(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJP3	APH domain-containing protein	Low	9.2	1	20-44	ERETYEKKFPRWQEHYPRKKLLQSC	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJY0	Carboxylic ester hydrolase	Low	8.2	1	482-502	MTFRERYPTHRNKFYQRQSEE	cyto(12),nucl(8),cysk(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XT35	Uncharacterized protein	Low	7.4	1	323-345	VQSQASKKEAQKETKREKTKDSL	cyto_nucl(9),nucl(8.5),cyto(6.5),mito(5),pero(3),plas(1),E.R.(1),golg(1),cysk(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTW6	Uncharacterized protein	Low	9.5	1	103-124	GGKGTKKAKTVKKKPQDANETG	mito(18),nucl(4.5),cyto_nucl(4.5),cyto(3.5)	KPAGGKGTKKAKTVKKK (100-116, prob:0.917)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XU33	S5 DRBM domain-containing protein	Low	8.4	1	21-46	ASRGGDRGPRRGRRGARRGGKPDSEK	cyto(13.5),cyto_nucl(8),mito(6),extr(2),nucl(1.5),plas(1),pero(1),E.R.(1),vacu(1)	SRGGDRGPRRGRRGARRGGKPDS (22-44, prob:0.991)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XVB2	Uncharacterized protein	Low	8	1	45-76	AEWKARRKELLQREKEKRRDERKRAEAHIDRS	plas(24),E.R.(3)	KARRKELLQREKEKRRDERKRA (48-69, prob:0.948)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0I0	Uncharacterized protein	Low	9.6	1	280-305	GDVYNDIKRKKVKRPSEKNVKRLIAM	mito(18),nucl(4),cyto(3)	KRKKVKRPSEKNVK (287-300, prob:0.872)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X346	Fatty acid hydroxylase domain-containing protein	Low	8.4	1	319-344	TEAGPEAQQRRRDKKRAERDAKALAE	mito(11),cysk(8),cyto(2),nucl(1),plas(1),extr(1),pero(1),E.R.(1),golg(1)	RRDKKRA (329-335, prob:0.713)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XA24	Uncharacterized protein	Low	8	1	31-64	AENVKTDLKNVKKNSKKQKRSKVPRKNPITGEPI	mito(22.5),cyto_mito(13),cyto(2.5)	VKKNSKKQKRSKVPRKN (41-57, prob:0.957)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAE3	Uncharacterized protein	Low	8	1	246-266	IIGIRHPRKKGRKPVPGAPGA	extr(23),mito(2)	RHPRKKGRKPVPGAPGAAG (250-268, prob:0.957)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAP7	VASt domain-containing protein	Low	5	1	289-308	LWVWRERSRCRQARTALRNS	extr(11),plas(6),E.R.(5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBA6	Uncharacterized protein	Low	7.3	1	25-45	TQLTTRPKAEKNGRAKQNKEL	plas(9),nucl(7),mito(7),mito_nucl(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCE4	MFS domain-containing protein	Low	5	1	34-57	EQETHPDNTKRQKLKSKAEEDEFD	plas(27)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XDM4	Uncharacterized protein	Low	6.8	1	1-34	MTRRKANHPTSPPQNPRPTHQSHRRQQSHPHTSS	mito(13.5),cyto_mito(9.832),cyto_nucl(8.333),nucl(8),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEQ7	Protoporphyrinogen oxidase	Low	6.4	1	2-21	KPPILRRKLPFRLHHAQNLT	mito(16.5),mito_nucl(11.5),nucl(5.5),cyto(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJ52	Uncharacterized protein	Low	7.6	1	309-332	DAPPIETRRRKKPNTTKQNLENEI	extr(12),nucl(7),mito(4),plas(2),cyto_mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKE5	DDB1- and CUL4-associated factor 13	Low	9.5	1	388-435	MPEIRRIARHRHLPKTIKKMSETKKVQLGSIKRKDENRRKNGEQMSAR	mito(18.5),mito_nucl(12.833),nucl(6),cyto_nucl(3.833)	EIRRIARHRHLPKTIKKMSETKKVQLGSIKRKDENRRK (390-427, prob:0.905)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKM6	Uncharacterized protein	Low	8	1	37-67	MLGKNLGRPRPDRRKKKTPQDPKQSSKDAND	plas(18),E.R.(4),mito(3)	NLGRPRPDRRKKKTPQ (41-56, prob:0.95)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPQ8	Uncharacterized protein	Low	8.2	1	598-620	LAFIYTKRRAWPRPRVLDRWPQL	nucl(13.5),cyto_nucl(12.333),cyto(8),cyto_mito(5.999),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQ99	Uncharacterized protein	Low	8	1	414-445	GFWVAFQKNRKKKSLKVTKKEARSKRHGHSGD	plas(20),E.R.(3),mito(2)	KNRKKKSLKVTKKEARSKRHG (421-441, prob:0.962)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS12	Zn(2)-C6 fungal-type domain-containing protein	Low	5.7	1	3-30	TSTACLQCRTAKRKCTRDQGNGPCNQCH	mito(23),nucl(2),cyto(2),cyto_nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTC8	Uncharacterized protein	Low	5	1	119-138	HEQKKFFRRWEPKPWPWPAD	plas(21),E.R.(3),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXN9	Uncharacterized protein	Low	7.5	1	330-350	FYCTCEVSKYQKKKAERAAGQ	nucl(10),cyto_nucl(9.833),mito(7.5),cyto_mito(7.332),cyto(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0Z1	ANK_REP_REGION domain-containing protein	Low	5.8	1	295-314	SPVFKTTKCTQKKCKGQSQS	extr(15),cyto(4.5),cyto_nucl(4),nucl(2.5),pero(2),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X132	WD_REPEATS_REGION domain-containing protein	Low	5.4	1	309-332	RELLTRLPHREKKERIRAVKCEIK	extr(9),cyto(6),plas(3),mito(2),E.R.(2),golg(2),nucl(1),pero(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3P0	Uncharacterized protein	Low	9	1	21-45	SWWSVKRAPSSRKTGSRKSWIKNTF	nucl(14.5),cyto_nucl(11),cyto(6.5),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5Q3	Uncharacterized protein	Low	5	1	491-510	LFFLWRWRRNKKAQNLEGDG	extr(24),mito(1),cyto(1),golg(1),cyto_mito(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X627	Uncharacterized protein	Low	5	1	522-544	LPTTEPTHRHHRHRQSATNNDNG	plas(15),mito(5),E.R.(4),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCC7	Uncharacterized protein	Low	8	1	86-110	KQAQVAQAKKNRNRFRNPIRPTFEL	extr(27)	KNRNRFRNPIRPTFELRPPRKA (95-116, prob:0.687)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFR3	Protein transport protein SEC31	Low	8.8	1	1141-1167	APPPPPKAATPKPKHPKGDRSHIPEHA	mito(14.5),cyto_mito(9.666),cyto_nucl(4.333),cyto(3.5),nucl(3),extr(3)	APPPPPKAATPKPKHPKGD (1141-1159, prob:0.853)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XH44	Ribosomal_L16 domain-containing protein	Low	6.1	1	1-31	MGRRPARCYRYCKNKPYPKSRFNRGVPDPKI	mito(14),cyto(6),pero(4),nucl(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XI47	Uncharacterized protein	Low	9.6	1	104-123	SSVRLGKKYKWSKNASKLGA	nucl(16.5),cyto_nucl(10.5),mito(5),cyto(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XM82	Uncharacterized protein	Low	8	1	414-437	AHPKEGKPPFVSKKRPPFAPKSDT	mito(10),nucl(8),cyto(4),plas(2),pero(1),golg(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPZ8	Protein kinase domain-containing protein	Low	9.8	1	1187-1206	GLKANKTCLKIERRKRQQST	nucl(19),cyto_nucl(12.5),cyto(4),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XT83	F-box domain-containing protein	Low	7.4	1	375-400	ENVLYLRVRCRHNRQQTRRCEKEFAP	cyto_nucl(9),nucl(8.5),cyto(8.5),mito(6),extr(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZG2	Uncharacterized protein	Low	6.9	1	205-225	PGSSRTPAAGRPKKQKTCKIL	mito(12),cyto_nucl(6.5),nucl(6),cyto(5),extr(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3F1	Uncharacterized protein	Low	5	1	17-45	TGPSLLKYSKQKYSKQKDSKRPSDPSTTW	mito(11.5),cyto_mito(7.5),plas(7),cyto(2.5),pero(2),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4D1	WD_REPEATS_REGION domain-containing protein	Low	9	1	406-429	AYESRNDNKGKKKHQPKEEEEEAD	nucl(14.5),cyto_nucl(11),cyto(6.5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4F1	Autophagy-related protein 17	Low	9.6	2	908-927, 1061-1080	RETVIRKTSHRRDAKFRAAG, LYQLRRGQGRKSKKVEEWAE	mito(13.5),nucl(9),cyto_mito(9),cyto(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X571	Uncharacterized protein	Low	5	1	89-109	YYNHYRPKKHYRFSQNRRTDH	plas(24),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X590	Uncharacterized protein	Low	7.1	1	5-26	TAYAAVHKRKQRPPQNARLLER	nucl(6.5),cyto_nucl(6.5),mito(6),cyto(5.5),plas(4),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6L7	Uncharacterized protein	Low	9.7	1	23-45	SSVTDSRRRQIKRDEAIRRKMEQ	mito(8),nucl(5),cyto(5),cyto_nucl(5),plas(3),pero(3)	RRQIKRDEAIRRKMEQDLGKKKQQSSARSRGSRK (30-63, prob:0.81)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6V3	Uncharacterized protein	Low	9.1	1	39-64	VKRNEAINGPRKSRKRKASGDDDSEE	cysk(16),cyto(5),nucl(3),pero(3)	PRKSRKRK (48-55, prob:0.825)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBU0	Aa_trans domain-containing protein	Low	8	1	30-58	VSSTLGSRSNSRRPMRRRKSTSNPHQGEA	plas(18),E.R.(4),mito(3)	MRRR (44-47, prob:0.621)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XDX3	Uncharacterized protein	Low	5	1	1118-1139	HEGKWWQVWKRFGRKGRDAVAY	plas(23),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE64	Ricin B-type lectin domain-containing protein	Low	6.5	1	132-157	PIVLWTKKPNTGKKVKKNQLWIFQSV	cyto(16),cyto_nucl(11.833),cyto_pero(9.833),nucl(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNA7	MFS domain-containing protein	Low	5	1	83-110	IPECEICKEDTRRRRKYRWKLILTLLLP	plas(27)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSX4	Phosphoinositide 5-phosphatase	Low	7	1	1206-1225	TSTTRVPPPKPKKPSSLAGS	mito(8),extr(6),cyto_mito(6),nucl(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0M0	Uncharacterized protein	Low	8	1	385-410	KESKSKEKDVTPKPKSQKYCGKKVAF	cyto(15),plas(4),mito(3),E.R.(3)	LERAKQKKKDEEAEAKAAKESKSKEKDVTPKPK (367-399, prob:0.901)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0U7	ANK_REP_REGION domain-containing protein	Low	5	1	237-259	DTCRHCDKSKIVKRKARDMRVHF	cyto(19),cyto_nucl(11),mito(3),pero(2),cysk(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0X0	Uncharacterized protein	Low	5	1	342-362	VGDPHRFRQNYRVRRRWSQVR	extr(26)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1Z7	Uncharacterized protein	Low	5	1	915-936	AVPRWRKRDSHQAHGRHSKRHQ	extr(24),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4V3	Uncharacterized protein	Low	5	1	211-236	SRERKETPKAWSKWRKYTPPKALGTG	extr(23),mito(1),cyto(1),E.R.(1),golg(1),cyto_mito(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4Z2	DUF3492 domain-containing protein	Low	8	1	2515-2537	GTDSGRRQSRKEFRRKIDPVTNG	plas(18),mito(5),E.R.(2),vacu(2)	KKKLK (1258-1262, prob:0.663)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7R0	Uncharacterized protein	Low	8	1	14-35	DENGLGRPRPRPRRGASVRSAT	plas(27)	RPRPRPRRGASV (20-31, prob:0.813)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBC8	Uncharacterized protein	Low	8	1	75-125	LAICLWRFIRRRRRRRRRSTDVEIANVSRSRRRTSRRRRRREPPPPYSATA	plas(13),extr(6),vacu(3),mito(2),cyto(2),cyto_mito(2)	RRRRRRRRRSTDVEIANVSRSRRRTSRRRRRREP (84-117, prob:0.987)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIN8	Uncharacterized protein	Low	5	1	289-311	FSRIPFTPAQKKKWYRERQGLLL	plas(19),E.R.(5),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJT7	Cytochrome b5 heme-binding domain-containing protein	Low	6.6	1	16-40	RPAVPSEKTTPPRQRKKSNAEILEE	plas(13),nucl(4.5),cyto_nucl(4),cyto(2.5),mito(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XN16	Uncharacterized protein	Low	9.7	1	21-49	NSPPPPPPPPPPQPQPKRTPPPNPHSDPP	nucl(18),cyto_nucl(12),mito(4),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYA3	Uncharacterized protein	Low	9.2	1	70-89	GTRPEPRKVFRNEKDNKKIS	mito(22),nucl(3)	KPRAKGTRPEPRKVFRN (65-81, prob:0.82)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4A6	Uncharacterized protein	Low	8.5	1	5-28	ADSKGYCCPRCNRRYKPLDALPLI	nucl(16.5),cyto_nucl(13.333),mito_nucl(9.166),cyto(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XH76	Uncharacterized protein	Low	5.5	1	67-86	WAARSPAKRKAESRRWHNAI	cyto(7.5),mito(5),cyto_nucl(5),extr(4),E.R.(3),golg(3),nucl(1.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XK13	Adenylyl cyclase-associated protein	Low	9	1	486-508	PGPQAKPKPAHMKQKKPPKMELD	cyto(21),cyto_nucl(14.5),nucl(4)	RPKSPGPQAKPKPAHMKQKKPPK (482-504, prob:0.937)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQP1	SF3b1 domain-containing protein	Low	9.5	1	200-224	ADKENAPEGRRRKRRWDVSTTDSAS	plas(17),nucl(4.5),cyto_nucl(4.5),cyto(3.5)	RRRKR (209-213, prob:0.706)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XR40	Uncharacterized protein	Low	8.4	1	1230-1249	RNLGTMRKAKEEKRKEAQAE	nucl(12.5),cyto_nucl(11.5),cyto(9.5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSX5	Reverse transcriptase domain-containing protein	Low	8.8	1	811-838	REYSREKEQFEKRKKSRDPKAVKLQGLE	mito(19.5),cyto_mito(11.5),nucl(3),cyto(2.5)	KRKKSRD (822-828, prob:0.717)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYN4	Uncharacterized protein	Low	6.4	1	1-21	MQRGLPQKKKIKNVNKVIAVS	mito(14),cyto(8),cyto_nucl(7.5),nucl(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYP4	Arf-GAP domain-containing protein	Low	6.5	1	21-45	KELLKLPKNKHCADCKRNAHPRWAS	mito(11),extr(9),nucl(4),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0X1	Uncharacterized protein	Low	5	1	109-130	GLAPPAKPSKQKRQLPNGYYNN	extr(27)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3W9	Uncharacterized protein	Low	5	1	98-124	RSAWGWPKRAYIQRQRRCTRRQCLTFV	mito(12),plas(6),mito_nucl(6),golg(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6A3	Uncharacterized protein	Low	8.2	1	47-75	FKEGWLHQRTRKTKNWKRRWYVLRGSAIS	mito(14),nucl(8),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XD95	Palmitoyltransferase	Low	5	1	447-472	VPVKYCKTCRIWRPPRCHHCRVCDNC	plas(17),mito(3),cyto(3),cyto_mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XG68	RING-CH-type domain-containing protein	Low	5	1	51-79	SSSTSQPTQEQPRRRRRPVLKQCRICLDQ	plas(22),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGF8	Uncharacterized protein	Low	5	1	71-90	GIPNPPPKRLGKRQFQQMSV	extr(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHI0	Uncharacterized protein	Low	7.9	1	64-84	LDALRQKRTKRLSIRMRGASN	cyto_nucl(12.5),cyto(12),nucl(11),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIM7	Uncharacterized protein	Low	6.9	1	146-165	EYNPKLQRYKRQRDEYTNSL	cyto(11),cyto_nucl(11),nucl(7),mito(3),extr(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLN0	Uncharacterized protein	Low	5	1	506-525	IFCTPFHKPRPDPRNPGHRG	plas(24),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS83	Uncharacterized protein	Low	5	1	1156-1175	GELPPRPKGQQGRKRAPEST	cyto(21.5),cyto_nucl(12),cysk(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTY2	Zn(2)-C6 fungal-type domain-containing protein	Low	9.2	1	112-140	KPPVGACMSCRKRKVKCDNKKPCGQCVAH	nucl(11),mito(5),cyto(5),cyto_mito(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYH7	F-box domain-containing protein	Low	9.8	1	290-311	FLPVPKTVKKLQYKKVNKLSQG	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZ44	Uncharacterized protein	Low	5	1	256-286	GWSTRQPQPQPTPTRKFRKSLDQNRKKSDTI	plas(22),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X043	Uncharacterized protein	Low	6.7	1	27-54	VNPWLTQTLKRVNKHKRPLNSVPQHLKC	mito(10.5),cyto_mito(8.833),mito_nucl(8.833),nucl(7),cyto(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1L0	Uncharacterized protein	Low	8.1	1	392-414	PTFSSIKKWKKHMIRHHPSWPQH	plas(11),nucl(8),cyto(3),mito(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3L2	FAD_binding_3 domain-containing protein	Low	6.5	1	440-459	GNRKEESKYIPKKQQPVAAH	cyto(9),extr(5),cyto_pero(5),nucl(4),E.R.(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4F8	Tafazzin family protein	Low	7.4	1	205-224	LDRWDKVRQKWRQIRESCRA	mito(14),nucl(6),cyto(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8Y5	ANK_REP_REGION domain-containing protein	Low	8.8	1	297-319	EDRIRSKKLRLGRPRPGKPDMKP	extr(8),cyto(7.5),cyto_nucl(5.5),E.R.(5),nucl(2.5),vacu(2)	RSKKLRLGRPRPGKP (301-315, prob:0.857)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAH1	Uncharacterized protein	Low	5.3	1	409-432	SLEGGMCRRKHPKGFKIDLCCVCT	plas(20),pero(2),golg(2),nucl(1),mito(1),cyto(1),cyto_nucl(1),cyto_mito(1),mito_nucl(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XDJ5	Uncharacterized protein	Low	8	1	42-61	LVGLRVPHRRKLHNEKEDND	plas(17),E.R.(5),mito(2),pero(2)	RRKE (429-432, prob:0.624)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE92	Uncharacterized protein	Low	5.8	1	885-906	AGGVERCRRTWKRNIRFDTVAR	mito(20),cyto(4),nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFR9	Uncharacterized protein	Low	5	1	220-244	VIVTVHTRKQKKTKEKLEAAKRFED	plas(26)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHG9	Uncharacterized protein	Low	8	1	383-416	VTFQTRTTKSKNTRTRKTRTRKTRPSFTRPTSVA	extr(26)	SKNTRTRKTRTRKT (392-405, prob:0.75)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMM8	Protein kinase domain-containing protein	Low	8.5	2	9-30, 452-471	DKNETPKPSSRPPPWPNSRPVG, IKSLKWTKLKHPPPHAEWWH	plas(15),nucl(4),pero(3),cyto(2),mito(1),golg(1),cysk(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTH4	Uncharacterized protein	Low	5.8	1	41-62	VQQAFRKCSNRIRVERNRIASL	mito(18),cyto(5),nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X069	Calcium-transporting ATPase	Low	8	1	1147-1173	VFRNTWRAAKKPFGRSKRKQSDESEEE	plas(23),E.R.(2)	KKPFGRSKR (1156-1164, prob:0.689)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3A0	Uncharacterized protein	Low	5	1	518-541	AGIWYYYRRNIKKHPTPNPPLPEA	extr(16),plas(10)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3Y8	Uncharacterized protein	Low	5.7	1	86-107	PSSSAKPSPKPNNRPTNNNNNN	cyto(14),extr(5),nucl(2),mito(2),vacu(2),mito_nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBD7	Uncharacterized protein	Low	7.6	1	43-65	GLKYTFTSPKKWKKETESHYLRR	cyto_nucl(10),nucl(9.5),cyto(9.5),mito(3),pero(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNJ1	Uncharacterized protein	Low	9.6	1	154-173	PSGHTTPKDHPKQREGERAK	mito(14),nucl(12)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNZ5	ZnMc domain-containing protein	Low	7.4	1	237-257	SQPQQPQQRPQQPQQRPQQGD	nucl(9),cyto_nucl(8.833),cyto(6.5),cyto_pero(5.166),mito(5),pero(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XR08	HECT domain-containing protein	Low	9.9	2	681-701, 1082-1101	NSNIARRPNRRHERTLRDNYL, KMFWRVLKRLRESDKRAVLK	nucl(8),mito(6),plas(5),cyto(3),pero(3),cyto_pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS81	Mitochondrial Rho GTPase	Low	9.6	1	400-427	TTTAALKITKPRKRRRRMHKVERSVVHA	cyto(10.5),cyto_nucl(8.5),nucl(5.5),mito(4),plas(2),E.R.(2),golg(2)	TKPRKRRRRMHK (408-419, prob:0.956)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZ55	Uncharacterized protein	Low	9.6	1	204-226	REEFYRLKKVKNNKKKALDEAEA	cyto(11.5),cyto_nucl(10),mito(6),nucl(5.5),E.R.(2)	K (217-217, prob:0.606)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2H6	Protein-serine/threonine kinase	Low	6.4	1	339-360	PHIWSFSKGPRRQKQLQNISLV	mito(18.5),mito_nucl(12.833),nucl(6),cyto_nucl(4.333)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XB25	MFS domain-containing protein	Low	8	1	567-594	KLESVQPAKARKKSEKAKKAKENVGDGP	plas(25)	AKARKKSEKAKKAK (574-587, prob:0.935)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGV8	Uncharacterized protein	Low	5.8	1	185-208	APKLTDFGRRARRARKNVGNVTPS	mito(24),nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XH17	TRP_N domain-containing protein	Low	5	1	617-639	IVICCKTNYYTKNRHNREKLAEE	plas(17),E.R.(4),extr(3),mito(1),golg(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIV9	Uncharacterized protein	Low	8.3	1	757-778	ILGCDRKQLKSVRRWKERAGGL	nucl(11),cyto(9),cyto_mito(8),mito(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJ12	Uncharacterized protein	Low	9.1	1	211-231	GGTFSRKRCSNKRRHAQEVEF	nucl(11),cysk(9),cyto(4),mito(1),plas(1),pero(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJX5	Signal recognition particle subunit SRP68	Low	9.1	1	22-42	AYRALCSRRISKLRRNVYGKS	nucl(13),cyto(11.5),cyto_mito(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMA8	PNPLA domain-containing protein	Low	5	1	428-452	GAPGVRMSRRRPQTKQPPSDGSHRV	plas(11),cyto(8),pero(3),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMP6	Uncharacterized protein	Low	8.5	1	99-118	SSPASSNFKKRKQWEANILS	nucl(9),extr(8),cyto(5),mito(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNR0	MRP-S28 domain-containing protein	Low	6.6	1	509-530	PFDFRHHKFKPQPSFPKEWRMT	mito(20.5),cyto_mito(11),nucl(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPV9	Zn(2)-C6 fungal-type domain-containing protein	Low	8.8	2	51-77, 811-836	FRSVTACNRCRLRKNRCDQRIPACTQC, SKPEDERRPVSKRKRQHNFDHQFREL	plas(16),nucl(5),cyto(2),mito(1),extr(1),E.R.(1),vacu(1),cyto_pero(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQ04	U-box domain-containing protein	Low	9	1	863-884	GPKCSNLRVKDPKKYRFDPRAL	nucl(10),plas(5),cyto(4),mito(3),vacu(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQE7	Uncharacterized protein	Low	6.2	1	21-42	YKDGKKGGTRFFQKRNGVKKLA	extr(10),cyto(8),cyto_nucl(7),nucl(4),E.R.(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSB0	FAD-binding FR-type domain-containing protein	Low	9.3	1	125-148	RRQRVKFYGKSKRGMRRVEKEKGL	cyto(14.5),cyto_nucl(10),mito(5),nucl(4.5)	GKSKRGMRRV (133-142, prob:0.734)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTQ0	LDB19 domain-containing protein	Low	6.9	1	30-49	STNTKPRSTRTSRSSNRDSA	cyto(9),cyto_nucl(8.833),nucl(7.5),mito(7),cyto_pero(6.833)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUE5	Uncharacterized protein	Low	8	1	121-140	IIRSKHKGPRRKDKLYLFNT	plas(15),E.R.(5),mito(4),vacu(2),cyto_mito(2),mito_nucl(2)	KHKGPRRK (125-132, prob:0.713)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUK8	Phosphoglycerate dehydrogenase	Low	5.8	1	40-60	SSFGRSSRPTRAPRQLKPFNT	cyto(15),cyto_nucl(10.833),cyto_mito(9.999),nucl(3.5),mito(3.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X018	Mediator of RNA polymerase II transcription subunit 16	Low	7.7	1	809-828	DTLRKCLLKKGTPVRRCLRC	nucl(9.5),cyto_nucl(9.5),cyto(6.5),pero(6),mito(2),extr(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4X4	Asparagine-linked glycosylation protein 10	Low	5	1	51-71	SSSSPTDRKGNKQEDRPIVKM	plas(18),E.R.(5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X620	Uncharacterized protein	Low	8	1	383-404	GGEAEMKRREKKAKGDKTKKAE	plas(24),E.R.(1),golg(1),vacu(1)	KRREKKAKGDKTKKAE (389-404, prob:0.962)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCR3	Uncharacterized protein	Low	8.8	1	917-939	VVSVGKSKKKDGRKGWDNARKVE	mito(22),cyto_mito(13),nucl(3)	RESKKVVIEREREGRKERAEREGEKSVVSVGKSKKKDGRKGWDNARKVELPKAGKFAGKKINRVPFKKLAK (891-961, prob:0.992)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCU8	Zn(2)-C6 fungal-type domain-containing protein	Low	9.1	1	17-68	ACTLCQQRKVKCDRKFPCSHCRRVGSQCVPAGLVQRQRRRRFPERELLDRVR	nucl(13),mito(6.5),cyto_mito(6.5),cyto(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE24	DUF1716 domain-containing protein	Low	9.8	1	13-32	IPPSNIKKRKLEPPIESPND	nucl(15),cyto(8),mito(4),cyto_pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XF72	Peptidase S53 domain-containing protein	Low	8	1	180-201	ASSEKQRRLRRLAKRSAFKRTT	extr(25)	RRLRRLAKR (186-194, prob:0.697)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKD7	Uncharacterized protein	Low	9.6	1	11-36	LTNRDVTRTLNPKRTRRPPTYLYTKG	nucl(15.5),cyto_nucl(10),mito(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLQ6	Ppx-GppA domain-containing protein	Low	5.6	1	577-602	LDDIEKVGKKKNCKGFRRKVSVIWET	cyto(20.5),cyto_nucl(12.833),cyto_mito(12.166),nucl(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMT4	Uncharacterized protein	Low	5	1	26-46	LSNPPQRRSVKKFTLAKRQNG	extr(13),plas(7),E.R.(3),vacu(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXQ6	Lysophospholipase	Low	5.4	1	37-56	APRDRTTTGKQPTKRNLETR	extr(17),mito(5),pero(2),nucl(1),cyto(1),cyto_nucl(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3X9	Uncharacterized protein	Low	5	1	232-251	KPSAVRKQKYYNRHTRRQFS	extr(11),golg(8),E.R.(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6D0	MYND-type zinc finger protein samB	Low	7.9	1	589-621	WEEFTRQFAKCRRCRRTKYCSKDCQKNAWVYHR	nucl(10),cyto(8.5),cyto_mito(8.5),mito(7.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8Z0	PALP domain-containing protein	Low	6.7	1	372-391	SPTRPPNPTRWSWRWKLGNK	mito(16),nucl(5),cyto(3),pero(3),cyto_pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAP0	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	1	43-82	SSSNPIKPVPLQKRRRVTRACDCCRRKKIKCDGLQPCTHC	plas(14),nucl(9.5),cyto_nucl(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBJ6	Uncharacterized protein	Low	8	1	19-50	TDSESDTPRRSKRTPRTPNSRRSVSPRKKSVA	plas(26)	RRSKRTPRTPNSRRSVSPRKK (27-47, prob:0.797)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCD3	Exonuclease domain-containing protein	Low	7	1	133-152	HYTPQFKPSGQRKRARKAVS	cyto(14.5),cyto_nucl(11.5),nucl(7.5),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCR8	Cation_ATPase_N domain-containing protein	Low	5	1	1017-1040	VEAWKWLKRAWFRRQAARQRNAAG	plas(23),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XG87	Uncharacterized protein	Low	7.6	1	1318-1341	TSTPRDPYKKPRKIDPTLMWRGRG	cyto(16),nucl(7),mito(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XM45	Chitinase	Low	6.6	1	75-94	GNFKAIYNLKKQKRHLKVLI	mito(9),extr(9),nucl(5),cyto_nucl(5),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNT9	Uncharacterized protein	Low	8.7	1	366-389	LDGEKGEKKKKKKRTAVVLRVWNS	extr(6),cyto(4),plas(4),golg(4),mito(3),cyto_nucl(3),nucl(2),E.R.(2)	KGEKKKKKKR (370-379, prob:0.957)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8E6	Uncharacterized protein	Low	6.9	1	100-125	FKSPSQKTIKKYRRGSKCRRRDTLLA	cyto(12),cyto_nucl(10.5),nucl(7),pero(3),mito(2),cysk(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X987	Uncharacterized protein	Low	7.7	1	334-356	SEWTRARIKKNWSRSPSNPNEGT	cyto_nucl(11.5),cyto(11),nucl(10),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XB89	Uncharacterized protein	Low	5	1	233-252	SSNGAAKRRNPKQHDNHLPS	plas(11),mito(7),E.R.(5),vacu(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XII0	Uncharacterized protein	Low	8.1	1	17-42	ASYIDYKGLKKRIKRILRSTQDETDP	nucl(11),cyto_nucl(10),cyto(7),pero(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIK8	Uncharacterized protein	Low	8.8	1	627-653	EDNVWKSLLKKRKRELLRPETRGPKPR	mito(19),cyto_mito(12),nucl(3),cyto(3)	LKKRKRELLRPETRGPKPR (635-653, prob:0.94)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMZ6	Uncharacterized protein	Low	5	1	209-233	HLTSTYTPSKRRKHWRCKLLVTGQD	cyto(13),mito(7),cyto_pero(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XP88	Uncharacterized protein	Low	9.5	2	313-332, 354-381	PELHRYPRTQARPRLWRVAH, ANHSWYCARTSRKKDCHDWKLLRRYPLL	nucl(8.5),cyto_nucl(8.5),cyto(7.5),cysk(4),mito(3),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XU35	Uncharacterized protein	Low	7.9	1	179-202	VNSVPVRRSRRKTRTRGNSSDKED	mito(11),nucl(10),cyto_nucl(8.5),cyto(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XU99	Uncharacterized protein	Low	8.7	1	46-67	QCRRNFWSKLFGKKKKVEPINP	mito(22),nucl(2),cyto(1),plas(1),pero(1),cyto_pero(1)	KTKKGPIKRR (300-309, prob:0.855)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXJ3	Hce2 domain-containing protein	Low	5	1	84-104	GRYAPKWKKRSTNQDKCRHSS	extr(18),golg(3),E.R.(2),mito(1),cyto(1),plas(1),vacu(1),cyto_mito(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYM4	Pex24p domain-containing protein	Low	7	2	47-66, 480-504	GRRRHFATKIAKHYQRSKES, RGTGEWRRRRWLRTVRRHVVNDNGF	plas(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYT2	Uncharacterized protein	Low	5	1	6-31	VQSFPWYHSSRQKPRRWPLALRFIKG	plas(20),mito(4),cyto(1),pero(1),E.R.(1),cyto_pero(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYZ1	Uncharacterized protein	Low	8	1	322-361	GKSLPAKRDNLKKRDENKGDEDKKRRGQKRPMRGDSKEAA	extr(11),golg(8),vacu(3),mito(2),E.R.(2)	AKRDNLKKRDENKGDEDKKRRGQKRPMRG (327-355, prob:0.965)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0Y7	Uncharacterized protein	Low	8.3	1	4-30	LDMENVKLKPRPRKPRRSQPLLPIALP	plas(17),mito(4),E.R.(2),nucl(1),cyto(1),cyto_nucl(1),pero(1),golg(1),cyto_pero(1)	LKPRPRKPRR (11-20, prob:0.858)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X657	Uncharacterized protein	Low	8	1	6-36	EDEGVDPRDKKKKEKTRRPGNTAFKQQRLKA	plas(24),mito(2)	RDKKKKEKTRRPG (13-25, prob:0.921)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8A9	MHD domain-containing protein	Low	6.2	1	466-485	ATTPAKEKEKEKKSPPSAQV	cyto_mito(8.166),mito(7.5),cyto(7.5),cyto_nucl(7.333),extr(6),nucl(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XC86	Zn(2)-C6 fungal-type domain-containing protein	Low	8.6	1	45-67	LLACDRCRQRKTRCDSNLPSCNA	nucl(9),plas(7),mito(4),cyto(3),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XDR0	Uncharacterized protein	Low	5	1	27-46	VCKAWKTKLFNKFKQRYVQP	cysk(19),cyto(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XED0	Uncharacterized protein	Low	6.1	1	570-592	EIKSRLSKWKAPRLKVNRGHLAK	cyto(14.5),cyto_nucl(11.833),cyto_pero(9.832),nucl(5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEG0	MFS domain-containing protein	Low	5	1	476-497	EITPLKKLRKSLKERVNRTGNT	plas(21),mito(3),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJ14	Polynucleotide adenylyltransferase	Low	7.3	1	85-106	FRRAAHWTYTHRRRRNFYSLPS	cyto_nucl(8.5),nucl(7.5),cyto(6.5),mito(5),plas(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPC9	Uncharacterized protein	Low	8.6	1	24-43	RKSSYAGKYKHSPRHLKICW	nucl(9),plas(6),golg(4),mito(2),pero(2),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPK8	Uncharacterized protein	Low	5.4	1	16-40	VVEVRQTRGQRFKRHCGRRWWIYLI	mito(14),E.R.(5),golg(3),extr(2),nucl(1),plas(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQX2	DUF1996 domain-containing protein	Low	8	1	469-504	GPKTIAPRPRPAAQKKKNCTTRRPVRHYRHHKAGSY	extr(20),mito(5)	PRPRPAAQKKK (475-485, prob:0.727)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRG3	GPI-anchored wall transfer protein	Low	5	1	110-130	QSPLTQSKQRKPPPKDDAAKE	plas(21),E.R.(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYQ2	Alkaline phosphatase	Low	9	1	97-122	NTPNTPNDPKAPKNKKKRNLIFMVSD	plas(9),mito(5),cyto(5),cyto_mito(5),nucl(3),pero(3)	APKNKKKR (107-114, prob:0.735)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X039	Uncharacterized protein	Low	5	1	433-456	GMAISCKSKTIKKKETRSLLNFLP	extr(18),cyto(4),mito(2),cyto_nucl(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X396	MFS domain-containing protein	Low	5	1	460-479	ITLENKKRDQGKHKLSHLSK	plas(27)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5I1	Uncharacterized protein	Low	8.4	1	399-418	WDNWRCKTWGFKNPSFNRTN	nucl(14.5),cyto_nucl(11.333),cyto(7),cyto_pero(5.833),pero(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5L3	Uncharacterized protein	Low	8	1	2-27	GFLELGKRSKHTRRPRLAVVSKKPSS	mito(22),cyto(3)	KHTRR (11-15, prob:0.62)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6A5	Uncharacterized protein	Low	5	1	9-36	SSGNTGSKQLPRKTRQRARSLRKSLLTF	plas(18),mito(5),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7G6	DNA_MISMATCH_REPAIR_2 domain-containing protein	Low	8.9	1	753-772	AELKRMTSKGYRKSERQRLI	nucl(15.5),mito_nucl(13.5),mito(10.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9A5	Uncharacterized protein	Low	8.9	1	117-138	RDKYEHGKFRRDRQQQQDSGRL	nucl(15.5),cyto_nucl(9.833),mito(4.5),cyto_mito(4.333),cyto(3),extr(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJD3	Uncharacterized protein	Low	8.7	1	87-107	DDIHNLSRRRHQPVPKEQFHD	nucl(14.5),cyto_nucl(13),cyto(8.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMD2	WD_REPEATS_REGION domain-containing protein	Low	6.4	1	85-104	QNLQQKLKPRGKARVGRFFV	cysk(8),cyto_nucl(6.833),cyto(6.5),cyto_mito(6.166),nucl(5),mito(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUG4	Cation-transporting ATPase	Low	5.4	1	1303-1329	GKTQATLRPSFQKKRKEYKLLEEEMRF	plas(22),nucl(1),mito(1),E.R.(1),golg(1),vacu(1),mito_nucl(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZW3	HIT domain-containing protein	Low	6.4	1	4-26	YTTSTAKRSRRSRASAHSRHSIR	mito(20),nucl(4),cyto(1),plas(1),pero(1),cyto_pero(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0C5	Uncharacterized protein	Low	8	1	2497-2520	EGVRNLRRGREERKEEREREKEMK	plas(21),mito(5)	GVRNLRRGREERKEEREREKEMKAAEKEKRVVSPRGFGKLPKSPKLGARRGGDR (2498-2551, prob:0.986)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X251	Uncharacterized protein	Low	8.5	1	338-360	YEASRRSQKHRKRSASQTDKPNQ	nucl(12.5),cyto_nucl(10),mito(7),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6L6	TOG domain-containing protein	Low	7.1	1	68-88	VLFRRMASKTVKKPEPRDLFI	cysk(11),cyto_nucl(7),nucl(6.5),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7V6	3'-5' exonuclease domain-containing protein	Low	5	1	161-180	LESPTTRRVRIRRTFRGPDW	mito(22),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9W8	Uncharacterized protein	Low	5	1	81-100	PCPTTTKKPTKTTSKKPCQT	extr(23),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XF59	ANK_REP_REGION domain-containing protein	Low	6.7	1	77-99	GTCEWFTNHRKFRNWRAPAPSRL	cyto(10),cyto_nucl(9),nucl(6),pero(5),mito(2),plas(1),E.R.(1),golg(1),cysk(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHD2	TruB_N domain-containing protein	Low	6.7	1	44-73	YSDHQDRRQSTTRRSRKNRKGDTQVKLGHG	cyto(11.5),cyto_nucl(9.833),mito_nucl(7.333),nucl(7),mito(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJK0	Uncharacterized protein	Low	5	1	505-526	VDSWSAYTRRRRWYRNAELVED	plas(19),E.R.(4),extr(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKT6	Methionyl-tRNA synthetase	Low	8.5	1	798-828	VEEALKQEEKKKKADKKAKRKEAAKKGGDGG	cyto(9.5),extr(6),cyto_nucl(6),mito(5),E.R.(3),nucl(1.5)	KQEEKKKKADKKAKRKEAAKKGG (803-825, prob:0.997)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XN17	Uncharacterized protein	Low	9	1	68-89	AAVKSARKPNPHSKNPRVFRPD	nucl(16.5),cyto_nucl(12.833),cyto(6),cyto_mito(5.999)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XN74	Uncharacterized protein	Low	6.1	1	536-557	PAFVRDSRFNRKQQNIDKDNNG	extr(9),E.R.(8),nucl(3),cyto(2),vacu(2),plas(1),pero(1),golg(1),cyto_mito(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQB8	AB hydrolase-1 domain-containing protein	Low	9.2	1	43-72	FARVVKKFEKPVKPGKRKAKKEDNGEEGER	cyto(16.5),cyto_nucl(11),cysk(6),nucl(4.5)	KKFEKPVKPGKRKAKK (48-63, prob:0.96)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTY4	PIG-P domain-containing protein	Low	9.2	1	294-321	IDKVSGSMSRRKKKRKSKMLFGNQVKMP	plas(17),nucl(3),mito(3),mito_nucl(3)	SRRKKKRKSK (302-311, prob:0.952)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZK2	Casein kinase II subunit beta	Low	8.6	1	1-21	MYAVDCPKEKKDRNRGCGWTC	nucl(12.5),cyto_nucl(11),cyto(8.5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1U5	Uncharacterized protein	Low	8	1	418-445	KEEWETRKRKVRALRTRLIRQNLRNVGQ	mito(6),plas(6),golg(6),E.R.(3),mito_nucl(3),cyto(2),extr(2),vacu(2)	KRK (425-427, prob:0.621)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X498	Phospholipid-transporting ATPase	Low	5	1	1272-1297	MEQFQKAIRKVRQVQRMRKQRGYAFS	plas(24),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4H0	Hsp90 chaperone protein kinase-targeting subunit	Low	8.4	1	22-46	HPNVDKKSFIRWKQRDIHDKREQRS	nucl(13.5),cyto_nucl(11.833),cyto(9),cyto_pero(5.333)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8T1	Uncharacterized protein	Low	7.7	2	154-175, 203-226	IAEHQLRREKRRVKHQRIAMAA, SSSSSEDERRRRHHHHHRHSQGTL	extr(13),plas(5),mito(4),nucl(2),cyto(2),cyto_nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAY0	Palmitoyltransferase PFA4	Low	7.3	2	124-152, 432-456	WGNADCRWCKRCKRWKPARAHHCKTCQTC, TYYDEKKRQEEIKKKWRNEEGERLA	extr(8),plas(7),E.R.(4),golg(3),mito_nucl(1),cyto_mito(1),vacu(1),pero(1),cyto_nucl(1),cyto(1),mito(1),nucl(1),cyto_pero(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCN9	Uncharacterized protein	Low	5	1	276-296	IVPPRSQKRNPLRRSNSPTIS	plas(18),E.R.(5),extr(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCZ8	DNA-(apurinic or apyrimidinic site) endonuclease	Low	9.4	2	517-538, 543-564	HSEPAKKMQTRKPGLNNGRWFW, PVGPSGPKERSRRSNDEWRCDY	cyto(10),cyto_nucl(10),nucl(8),E.R.(4),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFL2	Uncharacterized protein	Low	5	1	21-40	KPTVNRGNFKVKPRWHKSEV	mito(14),extr(7),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIG6	GPN-loop GTPase 2	Low	6	1	305-326	EKLEKEREKEWRMKRREEEEDL	cysk(12),cyto(7.5),cyto_pero(5),nucl(3),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XN59	Tyrosinase_Cu-bd domain-containing protein	Low	5	1	64-86	SKAFCSPRCKPVVRKSWRKLSNS	extr(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRW5	Uncharacterized protein	Low	9.8	1	362-381	HFPKYHQLKRLQRLKRLRLL	nucl(18),cyto_nucl(12.5),cyto(5),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X065	Uncharacterized protein	Low	8	1	213-235	DTPKGAPQKAPKKKPQKGTKEEL	extr(12),E.R.(5),mito(3.5),golg(3),mito_nucl(2.5),vacu(2)	KGAPQKAPKKKPQKG (216-230, prob:0.888)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X385	Zn(2)-C6 fungal-type domain-containing protein	Low	8	1	17-47	ASKLEYFKCTQCRKDRQKCVPRERPWPGVKC	mito(11),nucl(10),cyto_nucl(8),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3F0	Uncharacterized protein	Low	5	1	336-358	GVIRFTRRDKTRRSPPKSLSYTT	plas(21),E.R.(3),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5B7	NDT80 domain-containing protein	Low	9.9	1	181-201	HPENHHHHHHHHHHHHHRSSI	nucl(18),cyto_nucl(13),cyto(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5D9	Uncharacterized protein	Low	5	1	207-230	KEHSGRYSYKSRSQSRNKRDPLGL	extr(23),pero(1),E.R.(1),golg(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XC36	Uncharacterized protein	Low	8.2	1	219-238	ADQMRERRLRHRYNNTMTDA	nucl(11.5),cyto_nucl(11.5),cyto(8.5),mito(3),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJ13	Uncharacterized protein	Low	6.2	1	16-45	MASSTKPPTTPPKKEPPKLFLSPQKRNTPP	mito(17),cyto(4.5),cyto_nucl(4.5),nucl(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJF2	Peptidase_S8 domain-containing protein	Low	5	1	475-494	PSKGSPQKDDPKKDDPKKDD	extr(14),E.R.(5),golg(5),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XR86	Uncharacterized protein	Low	6.3	1	275-295	TKALNRHLRRQQLYNERRKQA	extr(11),mito(6.5),cyto_mito(5.333),nucl(4.5),cyto_nucl(4.333),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSE3	PNP_UDP_1 domain-containing protein	Low	5	1	508-527	NQKARQSRSHPGPRENYRYE	cysk(21),cyto(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XV34	Uncharacterized protein	Low	9.4	1	31-54	PAFVCFVYHRRKERDRLQDVNRRA	extr(6),E.R.(6),nucl(4),cyto(4),cyto_nucl(4),golg(4)	KGVELKKRALERKK (377-390, prob:0.766)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2Q9	Exonuclease 1	Low	6.4	1	9-33	FLKSIQQPTHIKKWKGKRVAVDAYG	mito(15),mito_nucl(11.666),cyto_mito(10.166),nucl(7),cyto_nucl(6.166)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X309	ANK_REP_REGION domain-containing protein	Low	8.8	1	225-249	SQVVRFYKGSEKRRKRMLHAFKATS	nucl(15),cyto_nucl(12),cyto(7),pero(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X484	Aurora kinase	Low	8.7	1	388-419	HPWILKHCSKPQTAREKQRNNHQRRQESDYED	nucl(18),mito_nucl(12.499),cyto_nucl(12.333),mito(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9V3	Uncharacterized protein	Low	7.6	1	423-444	QTLKPAVRSRRLRQHYGFRCNL	cyto(11),cyto_nucl(11),nucl(9),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAC4	Uncharacterized protein	Low	8.3	2	97-128, 161-182	ICGKVCKREDNVVKHKKQKHSIISHQPRQRRG, TQVQEHVKPPKKQPKEPSSEEE	plas(21),nucl(3.5),cyto_nucl(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBQ6	Amidase domain-containing protein	Low	5	1	534-562	AYAFEQKTQVRKNGPKQYKRPTAQIKDFL	extr(23),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFE3	F-box domain-containing protein	Low	8.9	1	334-353	VHYGPWKKVRRIKSADEYDN	nucl(12),cysk(6),pero(4.5),cyto_pero(4.5),cyto(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHN9	Uncharacterized protein	Low	8.9	1	55-79	ETKLRDVCKKLFERKTKPQFQQETL	nucl(14.5),cyto_nucl(12.5),cyto(7.5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XI64	Uncharacterized protein	Low	5	1	400-420	FTTFYVKKRLKDERHFCQRYK	plas(26)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XI78	SET domain-containing protein	Low	7.4	1	243-266	DLFTKISKRESKRVKNESKWTDKE	cyto(16.5),cyto_nucl(13.5),nucl(9.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIQ5	DNA damage-binding protein CMR1	Low	6.9	1	52-71	SSSSSKKRSRAATIKKEVPD	cyto(14.5),cyto_nucl(12.333),cyto_mito(8.166),nucl(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XME3	Uncharacterized protein	Low	8.8	1	137-161	AGSWRNINLKRDKKKQDENGCEGGK	nucl(16.5),cyto_nucl(16),cyto(10.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNZ7	Uncharacterized protein	Low	5	1	380-401	IGLPWRNRKVGKRLASWRKETG	mito(7),plas(7),extr(6),E.R.(4),cyto_mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRU4	Uncharacterized protein	Low	5	1	445-465	QYDLWKQKKKVGKNAALGSKP	mito(9.5),extr(8),cyto_mito(7),cyto(3.5),pero(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXS5	Peptidase A1 domain-containing protein	Low	9.5	1	383-408	IFWLLFRERRQRPRSHVKLPENRSSW	nucl(13),mito(4),golg(4),cyto(2),plas(2),pero(2),cyto_pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXT9	Uncharacterized protein	Low	8.3	1	390-413	DGTPHDNQQSRRRNRNNQNARAGG	nucl(11.5),mito(9),cyto_nucl(9),cyto(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYD8	Uncharacterized protein	Low	9.5	1	20-43	SEKAEKLKTKIKSNNKSNSKSKSS	nucl(17),cyto_nucl(12),cyto(5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZ16	Uncharacterized protein	Low	9.8	1	25-46	DATATAILKKKKKPNSLIVTDA	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X555	Uncharacterized protein	Low	9.6	1	22-44	YLLARNLKTKRPKKLNFQKYGPY	nucl(17),cyto_nucl(13),cyto(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7I5	Uncharacterized protein	Low	9.1	1	155-182	VDENTKRLRRVRRGQKKRKSLTKREDDE	extr(11),E.R.(5),cyto(4),nucl(3),mito(1),pero(1),golg(1),vacu(1)	KRLRRVRRGQKKRKSLT (160-176, prob:0.967)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X881	ANK_REP_REGION domain-containing protein	Low	7	1	850-872	TLNDDRWNKDKKRYDKDKVMTGL	cyto(8.5),cyto_nucl(8),nucl(6.5),mito(6),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X903	Uncharacterized protein	Low	9.2	1	229-254	QATYNLHRARNKRRHRQNRDSICMTI	nucl(15.5),cyto_nucl(12.5),cyto(8.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9A4	Uncharacterized protein	Low	6.9	1	35-56	ISIPSSPTRRNQQPPPPPPPAT	plas(11),nucl(5),E.R.(4),vacu(3),mito(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9V7	Uncharacterized protein	Low	5	1	494-516	VAGFFHYKKKREDKREHQALKSQ	extr(22),plas(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGM4	Uncharacterized protein	Low	8.4	1	408-432	QDVPTFPRVPKLRRRTPPQVTIDFF	nucl(13.5),cyto_nucl(12.5),cyto(8.5),mito(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS86	Uncharacterized protein	Low	8.8	1	157-178	LAPRKRSKVSRACDECRRKKVF	nucl(17.5),mito_nucl(12.166),cyto_nucl(11.333),mito(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYH3	Uncharacterized protein	Low	5	1	1021-1040	QYQQPQPQQQQQPQQQRQPG	plas(24),mito(1),E.R.(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZG0	HIT-type domain-containing protein	Low	9.5	1	37-59	VSSECPTKQQQQQQQQQQQQQQQ	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0N4	tRNA(Ile)-2-lysyl-cytidine synthase	Low	8	1	381-406	GRTETEKEVQKRKKRKDFRPHVGNLG	cyto(9.5),mito(8),cyto_nucl(5.5),extr(4),plas(2),E.R.(2)	KRKKRK (391-396, prob:0.799)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0W4	Uncharacterized protein	Low	8.6	1	29-48	SDQHSDQHPKPKPKVNTMTA	nucl(13.5),cyto_nucl(13),cyto(7.5),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1R1	Uncharacterized protein	Low	5	1	299-320	VFLFRRSKQQSRTKLRGNTPPP	plas(9),extr(9),E.R.(5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5H0	Uncharacterized protein	Low	5	1	198-220	ITKPGKTKTKTIKQTKKVTKTIY	mito(16),cyto(5),cyto_nucl(4.5),extr(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFX5	Uncharacterized protein	Low	9.4	1	186-227	NPYRDERRGRNQYNSPRPRDRSFSPPNRNRRNSPRGYRERSP	nucl(14.5),cyto_nucl(8.5),extr(8),plas(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHG6	Uncharacterized protein	Low	5	1	91-120	AWDICFPRYSHKKRVHKCKKQIKTLEACAH	plas(11),mito(8),extr(3),pero(2),cyto(1),E.R.(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJI8	Uncharacterized protein	Low	6.2	1	476-495	LSKYHDRKDKPRIYNPKNCE	cyto(12.5),cyto_nucl(10),mito(6),nucl(4.5),pero(1),E.R.(1),golg(1),cysk(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKM9	Uncharacterized protein	Low	8	1	47-72	IINFIVTSKKERRPERPKVAIDGRKW	plas(22),E.R.(3)	RRP (58-60, prob:0.621)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPD7	DNA_MISMATCH_REPAIR_2 domain-containing protein	Low	7.8	1	34-57	QLSSSRGTKRPRPISPFRATPKRY	mito(14.5),mito_nucl(13),nucl(10.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXT8	Squalene synthase	Low	7.7	2	345-368, 383-405	CDTFKKYIKIIRKKNTPKDPNFLE, IYPTITKKQKEEKREKELKTGKT	plas(13),mito(5),E.R.(3),nucl(2),cyto(2),cyto_nucl(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0L9	Uncharacterized protein	Low	8	1	485-508	VARQERAEKKKNKLRMGRKNSMTW	plas(17),mito(5),E.R.(4)	QERAEKKKNKLRMGRK (488-503, prob:0.87)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7P9	Uncharacterized protein	Low	8	1	406-427	MFSGRGYHYRRWHYRRARGRRA	extr(19),E.R.(4),plas(3)	RRARGRRA (420-427, prob:0.737)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCS0	Aspartyl-tRNA synthetase	Low	9.4	1	35-58	KPLSKNALKKLQKDKEKAEKAAKR	cyto(16),cyto_nucl(11.5),nucl(5),mito(2),pero(2)	KNALKKLQKDKEKAEKAAKRA (39-59, prob:0.855)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHI9	Uncharacterized protein	Low	6.5	1	242-265	FDPDSKPCKKPFRRLKAYNKSLNK	mito(14),cyto_nucl(5),nucl(4.5),cyto(4.5),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKW8	Hydroxymethylbilane hydrolyase [cyclizing]	Low	6.6	1	259-286	STTTTTTTATKKKRRYKCCSIGPTTKDF	cyto_nucl(11.333),cyto(10.5),cyto_mito(10.332),mito(8.5),nucl(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLU3	Phospholipid-transporting ATPase	Low	5	1	8-29	ESEGKKRRSLWGRKEEKPQLDS	plas(26)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPR4	Uncharacterized protein	Low	8	1	527-558	TDPAIKRRSSRGNRKRVYKTIKGKFRGRRTVP	extr(23),vacu(2)	KRRSSRGNRKRVYKTIKGKFRGRR (532-555, prob:0.954)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTC6	Uncharacterized protein	Low	8	1	477-498	AMISVLRRKKRKESDGQEKGQE	plas(16),extr(8),E.R.(2)	RKKR (484-487, prob:0.642)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XV32	Uncharacterized protein	Low	8.4	1	3-26	SVFSCFGRIFKRRKNMKISSPMET	nucl(11.5),mito(11),cyto_nucl(8),cyto(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYR4	Carboxypeptidase	Low	8	1	81-107	LDQISVKSSPKKHTKRPKSHWDFHVSG	extr(18),mito(3),pero(3),vacu(2),mito_nucl(2)	KKHTKR (91-96, prob:0.624)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2Y2	Uncharacterized protein	Low	9.7	1	549-569	SNPERFVSKSKGKPQGPKPEI	nucl(16.5),cyto_nucl(9.5),mito(9)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X724	Uncharacterized protein	Low	9.2	1	93-112	QASVKRHKTNRRVSVPRASA	nucl(16.5),cyto_nucl(13),cyto(6.5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XC02	MYND-type zinc finger protein samB	Low	8.2	1	60-79	AEYRKLKRFSGNRKCPSQPF	nucl(11.5),cyto_nucl(11.5),cyto(10.5),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XF00	Uncharacterized protein	Low	9.7	1	232-252	HKALRRWTRFWRKKYEPHALE	nucl(17.5),cyto_nucl(12.5),cyto(4.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFL9	Uncharacterized protein	Low	5	1	263-283	LQEKYRNFCRRWRHQGYRGPH	plas(18),cyto(4),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XI15	Uncharacterized protein	Low	8.7	1	138-162	GSWRNIINLKRDKKKQDENGCEGGK	nucl(15.5),cyto_nucl(15),cyto(11.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJQ2	Uncharacterized protein	Low	5	1	47-74	SLNRNLGSPKPKLNRRKNVPLRYPDSNA	mito(21.5),cyto_mito(12),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XM84	Uncharacterized protein	Low	5	1	40-61	STKPFGTCKSIQKRKEWRSLSN	extr(21),E.R.(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XV87	Uncharacterized protein	Low	7.8	1	445-471	TDAAAIKKVKDKKKWGCRNEINCSKVD	nucl(11.5),cyto_nucl(10.833),cyto(9),cyto_mito(6.333),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0Z9	CHAT domain-containing protein	Low	6.7	1	1471-1490	LHQATKKLTRQGRYRKHYLA	cyto_nucl(9.833),cyto(9),nucl(7.5),cyto_mito(7.499),extr(6),mito(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8I7	Uncharacterized protein	Low	8.7	1	14-34	TNSSRDRSPKNPQQQEHHLEQ	nucl(10),cyto(6),mito(4),cyto_pero(4),plas(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9K6	Maintenance of mitochondrial morphology protein 1	Low	9	1	110-142	DSSSSRSKRNNSSSRKLHKKKSTSVLRNPPPLT	plas(20),nucl(3),mito(2),cyto(2),cyto_mito(2)	RKLHKKK (124-130, prob:0.67)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGF4	Uncharacterized protein	Low	9.6	1	70-90	TTNARKLKKRSQLAAQLKKRA	mito(16),nucl(4.5),extr(4),cyto_nucl(3)	RKLKKRSQLAAQLKKRAVLARARK (74-97, prob:0.902)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XH18	Uncharacterized protein	Low	5	1	73-97	VVPPCCKSFWHKQKRHRVWMEQGCG	extr(22),cyto(2),mito(1),cyto_nucl(1),E.R.(1),vacu(1),cyto_pero(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLK9	Ferrochelatase	Low	5.7	1	394-413	CTNAKCREQKAFFKRHQSAL	mito(20),cyto(3),nucl(2),cyto_pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMA6	Uncharacterized protein	Low	9.6	1	53-75	FMDLFRRKDKKGRAPIPRRGSDA	E.R.(7),extr(5),nucl(4),pero(3),golg(3),mito_nucl(3)	RRKDKKGRAPIPRR (58-71, prob:0.881)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRW0	Uncharacterized protein	Low	9.1	1	107-127	TGKPFKPSSKRTKSWDYRDKR	nucl(15.5),cyto_nucl(12),cyto(5.5),mito(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTB3	Uncharacterized protein	Low	9.9	1	78-105	PWAGKRPPPKDGKRPERKKPAAKTEEKT	mito(10),cyto(6),nucl(5),extr(5)	TGSGHVRGAWKGKEGWKKGEKPAGTWVRGPRPSGVSKDGKGPWAGKRPPPKDGKRPERKKPAAKTEEKT (37-105, prob:0.998)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XU29	Uncharacterized protein	Low	5	1	42-61	PDSWKSKLPPPQQDEPPPKK	extr(18),golg(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXV4	Uncharacterized protein	Low	7.3	1	137-159	ARVSNMRSTRRERWRRWRMSSSA	mito(7),nucl(6),plas(6),extr(3),cyto(2),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZU3	RNase H domain-containing protein	Low	7	1	132-151	NSKPDIRKRKHQNISRSSPQ	nucl(8),mito(7),cyto_nucl(7),cyto(6),pero(6),cyto_pero(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6F5	DUF5745 domain-containing protein	Low	9.9	1	129-149	VTKLRKAYLEKRERYRQQQVA	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X725	Uncharacterized protein	Low	8.3	1	9-28	SSKPQAPNPRSRRPAQQPTS	mito(15),nucl(10.5),cyto_nucl(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7H9	Uncharacterized protein	Low	6.6	1	70-91	QGAPHFKHWKRFNPYRKHCLRV	mito(16),cyto_mito(11),nucl(6),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8G2	IFRD domain-containing protein	Low	9.7	1	372-395	NLSKSSTKSVSKKNRRTQHATFAN	mito(12),nucl(5.5),cyto_nucl(5),cyto(3.5),golg(2),plas(1),pero(1),cysk(1),vacu(1)	GGKTPSKRAS (11-20, prob:0.67)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEI9	Uncharacterized protein	Low	8	1	299-322	DIERNKRLEREKKERLSRRRSQSG	extr(19),E.R.(3),golg(3)	RNKRLEREKKERLSRRRSQSGGR (302-324, prob:0.939)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKB8	Uncharacterized protein	Low	9.5	1	130-149	STAEKKERRQGIKKADTDKC	nucl(14),cyto(8.5),cyto_mito(5.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XP95	Uncharacterized protein	Low	5	1	198-217	VSLVYRRRWREKQAAITKAR	extr(18),golg(4),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS44	ANK_REP_REGION domain-containing protein	Low	9	1	13-36	EGDSSHLPRRQKTRHYLEDRVYES	nucl(13.5),cyto_nucl(10),cyto(5.5),mito(3),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYD4	Uncharacterized protein	Low	7.2	1	10-29	TMFSRFPLRHSKPKEPEIGF	mito(18),nucl(6.5),cyto_nucl(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYF4	DUF2428 domain-containing protein	Low	8.9	1	503-524	DLAADIKKSKKKQNEREHIVLP	nucl(15),cyto_nucl(12),cyto(7),cysk(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3L3	Uncharacterized protein	Low	5.7	1	484-504	WAGHKIAKRRIRQQRFARVLE	plas(19),nucl(2),mito(2),extr(2),mito_nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3U5	Uncharacterized protein	Low	5	1	173-194	FQAPSKLKSRRRATKLPPNNDE	extr(17),cyto(5),E.R.(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X403	Uncharacterized protein	Low	8.1	2	8-28, 34-55	HGNISKRRPARTQKPAASDQF, EAQPQVQTRRAKRIKKLADFDE	mito(15),cyto(6),nucl(3),cyto_pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X458	Uncharacterized protein	Low	8.7	2	792-811, 947-969	GNTPHKPWGRKKPEEPYANN, HDDERLKRSKRNDGKKQVVVVRK	cyto(13),cyto_nucl(10.5),nucl(6),mito(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4V0	Uncharacterized protein	Low	8	1	336-359	NYVGRKVTRIDKKKEAERRKIMGL	extr(19),golg(3),E.R.(2),mito(1),plas(1),vacu(1)	DKKKEAERRK (346-355, prob:0.726)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5S2	Uncharacterized protein	Low	6.9	1	204-223	SVPNSPPQKNEKREERRQET	mito(18),nucl(5),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8P1	Uncharacterized protein	Low	5	1	225-244	PDKVPIRHKRPRTSRAHSGG	plas(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XC05	Uncharacterized protein	Low	9.9	1	146-167	LLFGCRHRYKHKYKYNYRYDGI	nucl(19),cyto_nucl(13.5),cyto(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJF1	Uncharacterized protein	Low	8.8	1	93-124	SDPVDTNNEKKKKKKKNPKKNPHKGKIKTVTI	cyto(11),cyto_mito(9.166),cyto_nucl(8.166),mito(6),mito_nucl(5.666),nucl(4),extr(4)	KKKKKKKNPKKNPHKGKIK (102-120, prob:0.998)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJW3	Uncharacterized protein	Low	9.7	1	126-147	QHDHSNKSTKNKNKADQQLPHD	mito(14),nucl(5),cyto(5),cyto_nucl(5)	GGKGKPRAAPSPSSIPPTKPTSRQIASGKKGNFAKLKANAKKG (73-115, prob:0.844)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XK97	Uncharacterized protein	Low	7.1	1	836-856	AGSPNHTHKSRRQQEPETIEV	mito(14),nucl(6.5),cyto_nucl(6),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLH7	Septin-type G domain-containing protein	Low	6.2	1	1-23	MSGLSATRKKKNIKKGIQFCLMV	mito(18.5),cyto_mito(11.333),nucl(4.5),cyto_nucl(4.333)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XP34	Uncharacterized protein	Low	9.9	1	333-356	HRARDCPEERKQRRNPNACRNCGE	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQ00	37S ribosomal protein S25, mitochondrial	Low	9.1	1	58-85	DNSKAVGKNVKKKSKRFFRPRNIQYPED	mito(14.5),cyto_mito(11),cyto(6.5),nucl(4)	KNVKKKSKRFFR (65-76, prob:0.83)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRD6	Nudix hydrolase domain-containing protein	Low	7.6	1	6-26	AISLSPKIKRHKQYTLVIPLD	mito_nucl(10.166),nucl(10),mito(10),cyto_nucl(9)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0G7	Uncharacterized protein	Low	7.6	1	43-62	QDSKYHPKFRKSAYARRRLF	plas(9),nucl(7),cyto(4),mito(2),pero(2),E.R.(1),golg(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X411	Uncharacterized protein	Low	9.2	1	36-65	VIGFCLFKRKFRRRRRKARRQEYLKGRNTS	mito(7),extr(6),E.R.(5),mito_nucl(5),nucl(3)	KRKFRRRRRKARRQ (43-56, prob:0.99)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X791	PNPLA domain-containing protein	Low	8.9	1	105-125	ELRKLGVYPRRKNYRRILSRF	nucl(14.5),cyto_nucl(9.333),mito(5.5),cyto_mito(4.833),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9D3	Uncharacterized protein	Low	8	1	483-505	VFSDLPRRRRARRSKSGETYTKN	extr(22),mito(2),cyto(2),cyto_mito(2)	RRRRARRSK (489-497, prob:0.786)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEI4	Uncharacterized protein	Low	6.2	1	74-94	TTAPKPRQSTCPKKHDPKCAY	mito(9),extr(6),cyto(5.5),cyto_nucl(5),nucl(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFW9	WD_REPEATS_REGION domain-containing protein	Low	6.6	1	1027-1050	STSKGTVKRKLRLPTRPRDPSPST	mito(20),nucl(4.5),cyto_nucl(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHE2	Uncharacterized protein	Low	8	1	422-444	IEEGRDEKGRKKGGKRRLETGEE	cyto(12.5),mito(12),cyto_nucl(8)	DEKGRKKGGKRRLETGEEGRGKRVR (427-451, prob:0.986)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKZ1	Uncharacterized protein	Low	7.7	1	337-365	ANSTLKRRSLNTPNTKKRRRIYSLFDDKG	nucl(13.5),mito_nucl(10.999),cyto_nucl(9.666),mito(7),cyto_mito(5.999),cyto(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNQ1	Uncharacterized protein	Low	6.1	1	415-434	APVEKQQKMKRVKLRIPYDS	mito(21.5),cyto_mito(12),nucl(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSA9	Uncharacterized protein	Low	9.4	1	341-362	VSLVCKKLYKISRRNVRKHLTL	nucl(15.5),cyto_nucl(10.5),pero(5),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XV16	Valyl-tRNA synthetase	Low	8.1	1	29-53	WEKEGYFKARWRRPQHPLSSRPSEE	nucl(11),cyto_nucl(10),cyto(7),pero(5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXY2	Uncharacterized protein	Low	5	1	16-35	LLTVRFFRYRRRNEITAKFS	mito(17),cyto(5),cysk(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X067	Uncharacterized protein	Low	5	1	332-353	FWETPNWPTRRRHNIWRQLLDV	extr(11),mito(6),golg(3),vacu(3),cyto_mito(3),mito_nucl(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0F4	Histone acetyltransferase	Low	8	1	89-120	EKPTPPKKEQSYPNLKNQKKDKKLPRDSIAST	cyto(10.5),nucl(10),cyto_mito(7),pero(3),mito(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2H7	Ubiquitinyl hydrolase 1	Low	7.5	1	1058-1077	TKLRLQKRTGLKGKNFEKIR	cyto(15.5),cyto_nucl(13),nucl(9.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X465	mRNA-capping enzyme subunit alpha	Low	9.4	2	324-345, 369-391	DEEGRWRFKRFRNDKKDGNHIS, AVRTEWKSRHPPQQAQARPPQGR	cyto_nucl(9),nucl(8.5),cyto(8.5),pero(5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X700	APH domain-containing protein	Low	7.4	1	288-312	NPGNTLWTTKQQKKKDGKVTQGTLF	cyto(9.5),cyto_nucl(9.5),nucl(8.5),mito(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8X2	Uncharacterized protein	Low	7.5	1	300-322	AAKYDPVRKNYWRYRKRLLGSNE	cyto_nucl(10.5),nucl(9.5),cyto(8.5),pero(5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAS5	Uncharacterized protein	Low	5.7	1	344-363	KLQPDRTKGVWKFDRKKADL	extr(9),cyto_mito(6.833),mito(6.5),cyto(6),cyto_nucl(4.833),nucl(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBR4	Uncharacterized protein	Low	9.2	1	309-328	AEETKAKRERREKRLGAGKV	mito(17.5),mito_nucl(11.833),nucl(5),cyto_nucl(4.833),cyto(3.5)	KAKRERREKRLGAGK (313-327, prob:0.894)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFC4	Uncharacterized protein	Low	5.8	1	163-189	MMIWLCYRHRCEKKKFQQKYISNDHPD	mito(13),cyto(10.5),cyto_nucl(7),nucl(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHX9	Chitinase	Low	7.4	1	23-42	AGRRLFTRVRFSRQKRDICF	nucl(10),cyto_nucl(9.833),cyto(7.5),cyto_pero(6.666),pero(4.5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XM29	Uncharacterized protein	Low	9.7	1	6-27	LIPGSNKKKYYNPPRRAPEHLY	nucl(19),cyto_nucl(13.5),mito(4),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XN04	Uncharacterized protein	Low	9.2	1	428-452	RKGLKCTIDRSRKKGKTQYLCRATV	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPX7	Uncharacterized protein	Low	7.5	1	294-313	AESGAKQKPRKRLENLPEET	cyto(13),cyto_nucl(12.833),nucl(11.5),cyto_mito(7.833)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPZ9	Type 1 phosphatases regulator	Low	8.6	1	114-147	TERPKGHSCQNHKSRGQRRKNAYEKDPNRQKPSS	nucl(14.5),cyto_nucl(13),cyto(8.5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQ08	Uncharacterized protein	Low	5	1	298-323	LYLAYRFGRRMNRPPKQHKGQGVEVT	extr(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRX3	Uncharacterized protein	Low	9.8	1	1026-1059	IEVTKKKKLTSSELRKKKKDRMARRKRGEEVFSD	cyto(17.5),cyto_mito(9.5),nucl(6)	KKKKLTSSELRKKKKDRMARRKRG (1030-1053, prob:0.993)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3T6	Uncharacterized protein	Low	8.7	1	14-37	IAIAHPTKSCVRPRNPRGCWIIRR	mito(13),nucl(11.5),cyto_nucl(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X431	Uncharacterized protein	Low	8	1	360-380	NYDRIRPEPKDTRPPKPRPTK	plas(8),extr(6),E.R.(5),golg(3),vacu(3)	KDTRPPKPRPTK (369-380, prob:0.763)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X713	Uncharacterized protein	Low	8.8	1	1278-1302	EMGIFVDRRSRQKRPKLKTVALAVL	nucl(19.5),cyto_nucl(14.333),mito_nucl(10.666),cyto(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7E7	WD_REPEATS_REGION domain-containing protein	Low	7.5	1	2-23	ATLVPPKSKRIKLAEQKKTAEQ	mito_nucl(11.333),nucl(11),mito(10.5),cyto_nucl(7.333),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBN4	Uncharacterized protein	Low	8.5	1	430-452	WGTKEEKREYSKQFRRSVQRSIE	cyto(10),nucl(9),mito(5),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XD53	SMP-LTD domain-containing protein	Low	5	1	1038-1059	RESGSVKQKEKEKEKEKDKLDL	extr(12),golg(6),E.R.(3),vacu(3),plas(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHV9	FAD-binding FR-type domain-containing protein	Low	5	1	376-395	VADHKARKVKTQKIELHWIL	plas(21),E.R.(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XI98	General transcription and DNA repair factor IIH subunit TFB4	Low	8	1	335-363	LENIGKPVVLPPKKKKKKKAIDSLPESGV	cyto(12.5),extr(7),cyto_nucl(7),E.R.(3),pero(2)	PPKKKKKKK (345-353, prob:0.968)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKR3	Uncharacterized protein	Low	7.7	1	2-25	SENRTLTRFKAKRPYTRPKFARMV	mito(15),nucl(9),cyto_mito(9)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRC3	Uncharacterized protein	Low	6	1	452-471	VDYDGGQKRHPKKSARVIGD	cyto(14.5),cyto_nucl(10.5),nucl(3.5),mito(2),extr(2),pero(2),cysk(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZW2	Cyclin N-terminal domain-containing protein	Low	8.2	1	446-465	KYADKKFKKASIKVRSWAKS	nucl(11.5),mito(11),cyto_nucl(8.5),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3Y3	Uncharacterized protein	Low	8.8	1	194-222	ASPLSKSQKLKAKKKARKARQKAEADAAA	cyto(17),cyto_nucl(11),nucl(3),mito(3),plas(1),pero(1),E.R.(1),cysk(1)	KSQKLKAKKKARKARQK (199-215, prob:0.982)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X476	Palmitoyltransferase	Low	7	2	436-460, 652-676	CMVRMPLRSKHCRRCSRCVARHDHH, KDGVADNKNRSRRRQNPWNRGIITN	plas(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X818	Uncharacterized protein	Low	8.5	1	6-42	RPPDSLSKTKQSSKPDKIKIKRNTSTTQNNNNNKNTN	nucl(12),cyto_nucl(9),mito(5),cyto(4),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAW2	WD_REPEATS_REGION domain-containing protein	Low	8.4	1	926-946	DGEPRISRRRMRLRDVNMDNL	nucl(14.5),cyto_nucl(12.833),cyto(10),cyto_mito(5.833)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XB96	PX domain-containing protein	Low	9.5	1	814-833	KWQFDRKRWHEGKTRQKMAS	nucl(16.5),cyto_nucl(11.5),cyto(5.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBL3	VWFA domain-containing protein	Low	7.2	1	236-255	EENSRQERERKEKEEKEKAA	cyto(17),cyto_nucl(15),nucl(9)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEX0	Uncharacterized protein	Low	7.5	1	11-33	TGLKSIKSAFRNRSRRRSTSSKA	mito(18),nucl(8),cyto_nucl(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJB3	Carboxylic ester hydrolase	Low	5.5	1	63-82	RPPTGPRRFRPPQHHTHPLG	extr(23),mito(2),nucl(1.5),cyto_nucl(1.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMA9	Uncharacterized protein	Low	9.3	1	21-40	RIRQRSCRLNIRLPKNRQEP	nucl(17),cyto_nucl(14.5),cyto(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMW7	Uncharacterized protein	Low	5	1	333-357	DSWGVCRRARNMRRVVRDMKRRGVD	plas(8),E.R.(6),mito(4),extr(4),golg(2),mito_nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XN05	Uncharacterized protein	Low	9.6	1	371-395	LGLACKIKRLCQRKGRKFWLCQVEV	mito(12),cyto(9.5),cyto_nucl(8),nucl(5.5)	EARGRGRGAKK (406-416, prob:0.772)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQT0	Uncharacterized protein	Low	6.9	1	175-200	VRLRGHLRCHPRWRPRSRRLSNHTTW	cyto_nucl(7),nucl(6.5),cyto(6.5),E.R.(4),extr(3),mito(3),plas(1),pero(1),golg(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WY44	Uncharacterized protein	Low	6.4	1	228-253	TTMSVAPKFNNKRRNAKKRDTYVWSV	cyto(18),cyto_nucl(12.833),cyto_mito(10.333),nucl(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZ81	ANK_REP_REGION domain-containing protein	Low	5.8	1	1785-1805	FSFLCKRRKMKMLAKEYRKYI	plas(16),vacu(3),nucl(2),E.R.(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZZ9	Inclusion body clearance protein IML2	Low	5.9	1	480-504	LETFTDRKVKKWQRFAKERKCTLVE	mito(19),nucl(2.5),cyto_nucl(2.5),E.R.(2),cyto(1.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XA17	Uncharacterized protein	Low	8	1	28-51	QYDKYAARKAYKKKHKKHYGAAGE	mito(21),cyto(3.5),cyto_nucl(3)	RKAYKKKHKK (35-44, prob:0.846)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBM0	Uncharacterized protein	Low	8.7	1	12-35	RTPSPRKLDARQAQRTHRERKEAY	nucl(14.5),cyto_nucl(13),cyto(8.5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIC5	tRNA wybutosine-synthesizing protein 2	Low	8.9	1	5-30	TNDATPITRPPRPPKPPKPHPSIAAL	mito(20),pero(3),nucl(2.5),cyto_nucl(2.5)	RPPKPP (16-21, prob:0.636)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNH2	Sphingomyelin phosphodiesterase	Low	7	2	511-531, 599-624	IPYGSTKKPQWKKLYNAKATL, ELTCYKPKITSLKKKNKRDTFEDYMV	extr(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRY4	Uncharacterized protein	Low	7.5	1	7-30	FKSYDGSKVRKRGYRKNEVWDEHR	cyto_nucl(9),nucl(8.5),cyto(8.5),mito(5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTF3	Uncharacterized protein	Low	7.4	1	605-629	GAYWRRLIEWRRRVRDPRMKNKGVD	cyto(11.5),cyto_mito(9),nucl(8),mito(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXL6	Uncharacterized protein	Low	9.8	1	329-350	QPPPPPPPPQHQQPPPNHHNNH	nucl(20),cyto_nucl(16),cyto(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZP9	Translation machinery-associated protein 20	Low	6.1	1	7-27	SSSGKTKIKSSVQRNIRQKIC	mito(17.5),cyto_mito(11.666),cyto_nucl(5.833),nucl(5),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAV2	Uncharacterized protein	Low	7.8	1	464-486	GERSWKMGSKKWGNRKIPCNFGE	cyto(12),cyto_nucl(12),nucl(10),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XD87	Uncharacterized protein	Low	9.3	1	266-288	AVKACQKYIDRKKEKAAKPSPLK	cyto(17),cyto_nucl(12.333),nucl(5.5),mito_nucl(4.666),mito(2.5)	RKKEKAAKPSPLK (276-288, prob:0.737)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEK2	Histone deacetylase	Low	6.2	1	503-527	EEMERFIANKRNRRRHKDVDLDTPG	cyto(16.5),cyto_nucl(11),mito(5),nucl(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEW7	Uncharacterized protein	Low	8.9	1	65-87	HIPGVKVRKGKRQRLIEAGKKTS	mito(16.5),cyto_mito(11.333),cyto(5),cyto_nucl(4.833),nucl(3.5)	KVRKGKRQRL (70-79, prob:0.789)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGC0	F-box domain-containing protein	Low	7	1	510-535	VRYSHEFERDRPRRGRRVERDLNDEL	cyto(14),cyto_nucl(11.5),nucl(7),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGL7	Uncharacterized protein	Low	9.2	1	175-197	GSWSGSQRRKRERDPSRGRKMTD	mito(9),plas(8),nucl(3),cyto(3),cyto_nucl(3)	RRKRERDPSRGRK (182-194, prob:0.789)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHF8	Uncharacterized protein	Low	8	1	213-245	VEKDRSSKRHRTSRSGDRHRHSHSSSKRRRSSH	plas(18),E.R.(4),vacu(3)	SSKRHRTSRSGDRHRHSHSSSKRRR (218-242, prob:0.854)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXR4	Uncharacterized protein	Low	9.9	1	14-33	GSGPHRTGPRPQSHNPQQLQ	nucl(17.5),cyto_nucl(11),mito(4),cyto(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZV5	tRNA ligase	Low	8.1	1	318-338	IISGKQPKVRKHKQITEKYIA	nucl(11.5),cyto_nucl(11),cyto(9.5),pero(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X655	Uncharacterized protein	Low	5	1	257-277	AFFVWRRRTRHQSPPVYEKNS	extr(17),plas(7),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE59	AAA_23 domain-containing protein	Low	9.9	1	1287-1307	EYYYRVSRNERQKSQIHRQSI	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLM6	Uncharacterized protein	Low	9.3	1	310-343	PVVIVKKEKKEKKEPKEKKPTKKPSPKSSKMSEH	cyto(11),cyto_nucl(9.666),cyto_mito(9.666),mito_nucl(7.666),nucl(7),mito(7)	KKEKKEKKEPKEKKPTKKPSPKSSK (315-339, prob:0.997)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMQ1	Uncharacterized protein	Low	8.8	1	253-274	IPERYNRLKKLRDYVRKHLRDS	nucl(14.5),cyto_nucl(12),cyto(8.5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPQ0	Uncharacterized protein	Low	5	1	393-413	VYSQSTRRVRRPSDKDIKQLE	plas(20),E.R.(4),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WY98	Isoleucyl-tRNA synthetase	Low	8.9	1	660-684	AKVAQKPEKAKKQKAEKKPKVVAES	mito(15.5),cyto_mito(11.666),mito_nucl(10.999),cyto_nucl(5.999),cyto(5.5),nucl(5)	QKPEKAKKQKAEKKPK (664-679, prob:0.946)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0Q7	Uncharacterized protein	Low	7	1	19-39	PPSIPAKRRIRLTKLKVWRVD	plas(7),nucl(6.5),cyto_nucl(6),mito(5),cyto(4.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1B0	Uncharacterized protein	Low	5.8	1	167-188	IELEHQKKEKERKSQLKLSAEM	mito(12.5),cyto_mito(12),cyto(10.5),nucl(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3E0	Uncharacterized protein	Low	8.7	1	147-169	VPVLLTRWKKNRVIRPQQRRGLR	nucl(14),cyto_nucl(10.5),cysk(8),cyto(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X545	Beta-lactamase domain-containing protein	Low	8	1	9-33	EFAAKRSPKIEGRKRMKSNLIFNAC	plas(11),mito(7.5),cyto_mito(5),E.R.(3),extr(2),cyto(1.5)	RK (21-22, prob:0.607)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAP3	Uncharacterized protein	Low	6.9	1	154-176	KCEICSKSFKRPQDLKKHIKTHA	extr(13),nucl(5.5),cyto_nucl(4),mito(3),pero(2),cyto(1.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XC74	Probable electron transfer flavoprotein subunit beta	Low	9.2	1	195-220	ASLPNIMKAKKKKLEKKKLEDFEFRA	mito(14.5),cyto_mito(11.333),cyto(7),cyto_nucl(6.833),nucl(5.5)	KAKKKKLEKKK (202-212, prob:0.925)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XI09	Uncharacterized protein	Low	5	1	403-422	ITEEEKKKLKKQVGQKNESP	extr(16),cyto(6),E.R.(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XN97	Uncharacterized protein	Low	8.3	1	440-459	EEPWPLHKVGRNRKVPKFIW	cysk(10),nucl(9),cyto(5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQ64	Uncharacterized protein	Low	9.7	2	26-46, 50-72	NTSFSTQSRRRPRPVPSSQNS, ASNSLHPTKKVRQRSVSAQRELN	cyto_nucl(9.5),nucl(9),cyto(8),plas(4),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0J6	Uncharacterized protein	Low	8	1	313-341	QYQKRDVHGDKHKNMKKRNSEILARRIRR	extr(22),mito(2),plas(2)	KKR (328-330, prob:0.636)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1J2	Uncharacterized protein	Low	8.6	1	404-426	TWEKHVPPYRKGAKQRKVKYLYT	nucl(14.5),cyto_nucl(14.5),cyto(11.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1Y2	Uncharacterized protein	Low	5	1	46-65	KPYTTGKQFIKSERRKRTCF	extr(26)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6T5	J domain-containing protein	Low	5	1	245-264	YEEKRDRKNRDIQRDLWRIR	mito(10),extr(6),cyto(3),pero(3),golg(3),cyto_pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7Q7	Uncharacterized protein	Low	9.1	1	236-258	CGVLTEKERRSRRWRSHGGGGGP	cyto(10.5),cyto_nucl(7.5),pero(7),nucl(3.5),mito(3)	RRSRRWRS (244-251, prob:0.663)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XB92	Uncharacterized protein	Low	8	1	306-331	KEGAYGKKVKRDIERKKIRRAANAET	cyto(9),extr(9),mito(7)	GKKVKRDIERKKIRR (311-325, prob:0.865)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCJ8	Uncharacterized protein	Low	5	1	819-841	AMYFLAKRYRRNRLSHRRSQSLA	extr(23),E.R.(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XDW0	ANK_REP_REGION domain-containing protein	Low	8.2	1	101-120	LYGLKEKRKDAPRRPIVFIG	nucl(11.5),cyto_nucl(9),mito(6),cyto(5.5),plas(1),pero(1),cysk(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE37	Zn(2)-C6 fungal-type domain-containing protein	Low	7.1	1	120-146	ARRECIFTVPTRKRQKRTDSRVAELER	cyto(8.5),cyto_nucl(8.5),nucl(7.5),extr(3),E.R.(2),mito(2),plas(1),pero(1),golg(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE66	Suppressor of SUA7 protein 2 homolog	Low	6.5	1	21-40	YPPARTTKPRTPPPPPGIPG	mito(16),cyto(6),nucl(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHD4	Uncharacterized protein	Low	6.2	1	380-404	VKEGVKVRWYKKDTKWKNRELAMGE	mito(15),cyto(6),nucl(3),cysk(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XI89	WD_REPEATS_REGION domain-containing protein	Low	5.6	1	193-213	LTELNKARRREEERKRPLVFM	plas(18),mito(2),cyto_nucl(2),pero(2),nucl(1.5),cyto(1.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMD5	Uncharacterized protein	Low	9.9	1	224-251	QDPAEILKKKMRRKKRIPRRFAKSNVDD	mito(21),nucl(5)	KKKMRRKKRIPRRFA (231-245, prob:0.989)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMF3	Nudix hydrolase domain-containing protein	Low	7.8	2	29-48, 89-109	TEAANRKLCRRHQRFLQDLT, CTLLHCRSSRKEPYRKCHAGD	cysk(17),cyto(7),nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQ94	Uncharacterized protein	Low	6.1	1	88-109	LSGLKSRLSTRQKSKGKRSFTS	mito(16),cyto(4),extr(4),nucl(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS69	Uncharacterized protein	Low	9.8	1	421-440	FKTNRNKGKKSKFKTGNELF	nucl(19),cyto_nucl(14),cyto(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTS5	Uncharacterized protein	Low	8.7	1	743-767	HPWFPIPRISSKKRPPLPAVPPTGR	nucl(13.5),cyto_nucl(11.5),cyto(8.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XV56	Abhydrolase_3 domain-containing protein	Low	9.7	1	22-42	LSHYLTKSKHRGKPTYHLGYH	cyto(14.5),cyto_mito(10),nucl(6),mito(4.5)	KKVWDGKYAKAKKRVQERRA (650-669, prob:0.849)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3R1	Uncharacterized protein	Low	5	1	9-31	RSSISSRSGRLPRRRSRDLEAAR	mito(15),plas(10)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBN3	Uncharacterized protein	Low	9.8	1	182-215	TSEPMRIKEKTKRRQRRVKKVKSKHRYTVLRICE	mito(18),nucl(5.5),cyto_nucl(4.5),cyto(2.5)	RIKEKTKRRQRRVKKVKSKH (187-206, prob:0.985)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCH1	Uncharacterized protein	Low	8.7	1	129-162	AQRFYERPGVKKKRLRRERFRRRFKESFKRMVST	mito(20),cyto(4),nucl(2),cyto_pero(2)	PGVKKKRLRRERFRRRFKES (136-155, prob:0.988)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XH16	Uncharacterized protein	Low	5.8	1	415-435	EKLDAHQKAQKKPKIQNLWGL	cyto(9),mito(5),extr(3),pero(3),nucl(2),E.R.(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIR6	Uncharacterized protein	Low	9.4	1	1-20	MPPSRRSRHVSRVTKPKSTA	mito(14),nucl(11)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLW5	Uncharacterized protein	Low	5	1	34-59	ASAPLYRRHAHHHQRKHLTPKTDKAG	extr(21),E.R.(3),mito(1),plas(1),golg(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPT9	FAD-binding FR-type domain-containing protein	Low	5	1	59-85	AAIHFFRKRYVKSRPLRLKLQNFSNRG	plas(24),pero(1),E.R.(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XR14	Uncharacterized protein	Low	5	1	66-85	GSVSEQRKSRFRSLCRRYKF	plas(26)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1A7	Carboxylic ester hydrolase	Low	5	1	650-674	IEATGRWQKFNRHNRKMRWLQWNGG	extr(26)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X834	Uncharacterized protein	Low	8	1	244-267	MNNMSLRESKRRQRWSVCGAERRS	mito(12),nucl(10.5),cyto_nucl(8),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBB7	Uncharacterized protein	Low	5	1	1-24	MRRVRLVLKRERWMRKKTQSDIVL	mito(16),cyto_mito(13),cyto(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XD33	ANK_REP_REGION domain-containing protein	Low	8.9	1	1062-1091	NLVYKLVPHCRRHPHYRRRLQYKTTYKYDL	nucl(15),cyto_nucl(13.5),cyto(10)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XDB6	UBA domain-containing protein	Low	8	1	688-707	AATRPQSYSKKRPHDQEWNT	nucl(11.5),cyto_nucl(11),cyto(9.5),pero(3),cysk(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEP4	Uncharacterized protein	Low	6.2	1	348-372	CGITMLVKRVRSKRKGYREVQAGLC	extr(8),mito(5),E.R.(5),nucl(3),cyto(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFR2	Helo_like_N domain-containing protein	Low	7.8	1	97-117	GSTAGKKSKTIRTWKKFKLIF	nucl(11),cyto_nucl(10.333),cyto(7.5),cyto_mito(5.166),pero(4),mito(1.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRM3	Uncharacterized protein	Low	5	1	470-490	CGSKATWKKGSVRLKKKQTTE	mito(14),plas(6),extr(3),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRY0	Uncharacterized protein	Low	9.4	1	120-144	LDKEEMKARKDKKKQDKEIQTDTDD	mito(18.5),mito_nucl(13.999),cyto_mito(10.832),nucl(7)	RKDKK (128-132, prob:0.624)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTZ9	Uncharacterized protein	Low	7	2	115-135, 463-482	ICEVTKKRTKFPRPVKSFVKV, PEPYRFKPSRWYQTQKQEAL	cysk(10),cyto(9),mito(6),cyto_nucl(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X127	Uncharacterized protein	Low	7.8	1	305-324	ALDRRGFTRKRPSEKVPLGF	cyto(12.5),cyto_nucl(12),nucl(10.5),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2G3	Uncharacterized protein	Low	8.7	1	340-363	QGQYNKQDRQQNKQHYNNHHYNNN	nucl(13),cyto_nucl(9.5),mito(9),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6A0	Urb2 domain-containing protein	Low	9.4	1	147-172	LRTTYARANRHRIKREWTRRGQQVEV	nucl(12),cyto(9),mito(3),plas(1),pero(1),E.R.(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHD0	Uncharacterized protein	Low	8	1	284-303	DGELKKKKTKSSLRRQGSKL	mito(23.5),cyto_mito(13.333),cyto(2)	KKKKTKSSLRRQGSKLVKSLR (288-308, prob:0.87)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XI40	Uncharacterized protein	Low	9.6	1	258-281	EARRGNARAKKGKYKRGRSTDSSK	mito(8),nucl(4),plas(4),cyto(3),extr(2),pero(2),golg(2)	KRASMRRRARSKSEGIETSSLRRFGELEARRGNARAKKGKYKRGR (231-275, prob:0.973)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIJ4	Uncharacterized protein	Low	8.9	1	56-81	TFSQVLRGCRKKKKDYNRKPVSPQLT	mito(24),nucl(2.5)	KKP (99-101, prob:0.624)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLL4	Uncharacterized protein	Low	5	1	376-400	NMRIYREDQEKKQKERLKKMGIHQV	extr(12),mito(5),E.R.(5),cyto(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNH1	Glutamate decarboxylase	Low	8	1	476-506	LVKRTVTHTGRKKSHSRHYKGEKHSLAKHGK	cyto(16),cyto_pero(10.333),cyto_nucl(9.333),cysk(5),pero(3.5)	RKKSHSRHYKGEK (486-498, prob:0.695)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZN6	Uncharacterized protein	Low	9.5	1	2-24	GCAPSKHTMGKKLKNGRKQDVQI	nucl(17),cyto_nucl(11),pero(4),mito(3),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X192	Uncharacterized protein	Low	7.5	1	68-90	PATTFFRRYRHHRHRHRRVSTII	mito(12),nucl(8),cyto_nucl(7.5),cyto(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X835	Uncharacterized protein	Low	7.5	1	524-547	DTNFCPPAKRTKSNESQKAARRGL	mito(13.5),nucl(9.5),cyto_mito(8.833),cyto_nucl(6.833)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFP0	Cyclin N-terminal domain-containing protein	Low	7.3	1	63-82	LYLHKYRKFIRDSKNRPDPV	cyto(10.5),cyto_nucl(10),nucl(8.5),mito(4),plas(1),pero(1),cysk(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGJ6	Uncharacterized protein	Low	8	1	63-171	FSFPTIPNRWCKKCVKRYKPKCGSCLSSCWKKKYGKKGRARRLLRRTNAKKKQAAKKQPAAKKKATAKKAKTVKKKTTTKKKKTVKAKVKAKKTGKCLKYIKNCKKCPV	extr(15),E.R.(4),golg(4),vacu(3)	KKKYGKKGRARRLLRRTNAKKKQAAKKQPAAKKKATAKKAKTVKKKTTTKKKKTVKAKVKAKKTG (93-157, prob:0.999)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHU3	DUF1752 domain-containing protein	Low	9.2	1	476-497	IEWEPKWTNRRNNISLNRNRFG	nucl(16.5),cyto_nucl(13.5),cyto(9.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XST7	Uncharacterized protein	Low	8	1	536-560	GCIAFFCIRRRKQRKAAKDAGNEQF	extr(24),mito(1),plas(1),vacu(1)	RKQRK (546-550, prob:0.641)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYG7	Uncharacterized protein	Low	8.7	1	583-615	EGIRKSLKEMWRNRKARRKEERLRKERLRNPSL	plas(16),mito(3),vacu(3),nucl(2),E.R.(2),cyto_mito(2)	IRKSLKEMWRNRKARRKEERLRKERLR (585-611, prob:0.988)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1M5	Vezatin domain-containing protein	Low	7.1	1	54-73	LVPKTRKKALRPLQIQNPGW	plas(12),nucl(6),E.R.(4),cyto(2),pero(1),golg(1),vacu(1),cyto_mito(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5J3	Uncharacterized protein	Low	8	1	275-295	AEGRLPPRPARKPKIRKNDGV	extr(13),E.R.(4),golg(4),vacu(3),mito(2)	PPRPARKPKIRK (280-291, prob:0.859)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBV4	Uncharacterized protein	Low	8.9	1	4-24	PTFTNPPRAGQRKKLYPHALD	nucl(14.5),cyto_nucl(9.333),mito(5.5),cyto_mito(4.833),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEV4	AP_endonuc_2 domain-containing protein	Low	9.8	1	254-298	EKEEKEAKKKEKVEKKAAKDKLKDDKTKKKTPKKTTTAAKKGGKA	cyto(14.5),cyto_nucl(13.166),nucl(9.5),cyto_mito(9.499),mito_nucl(6.999)	EKKEVEKEEKEAKKKEKVEKKAAKDKLKDDKTKKKTPKKTTTAAKKGGKA (249-298, prob:0.997)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFC8	F-box domain-containing protein	Low	7.7	1	56-75	PTNMKKFKSRHDTRLLRDFS	cyto_nucl(11.5),cyto(11),nucl(10),cysk(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGK4	Uncharacterized protein	Low	6.8	1	749-768	EDSKELWKHPTTCKCRRSKS	cyto(12.5),cyto_nucl(11),nucl(6.5),pero(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLK2	Uncharacterized protein	Low	7.3	2	67-88, 569-589	KDKVKASIVKHRKRSHHTIVFI, FMCSKGWKMKRFNPARIPIKT	plas(19),mito(3.5),cyto_mito(3),cyto(1.5),nucl(1),E.R.(1),golg(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XN93	Golgi apparatus membrane protein TVP38	Low	5	1	23-43	YEPFDWKKFFTKKRYIPWWIL	plas(23),mito(1),pero(1),E.R.(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XU40	DUF1996 domain-containing protein	Low	6.2	1	458-479	ATEYVPHHARHRRFFRRGARHF	cyto(8),mito(7),extr(6),nucl(3),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XV40	Uncharacterized protein	Low	9.2	1	123-155	QYPTGIVKQERKQQKKKKRQKQKTDIIQKPGDL	mito(18),mito_nucl(12.333),cyto_mito(11.333),nucl(5.5)	RKQQKKKKRQKQ (133-144, prob:0.938)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7F0	CCT-beta	Low	5.6	1	11-34	SINFGDKRPSKTEKKLQRSDSTKL	mito(14.5),cyto_mito(11.833),cyto(8),cyto_nucl(5.833),nucl(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCN2	FAD-binding PCMH-type domain-containing protein	Low	6.2	1	43-64	YASTSKSKTNSNYRQNPNPGSY	mito(17),cyto(6),nucl(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFI1	ANK_REP_REGION domain-containing protein	Low	7.4	1	259-278	CDPLCKCVCHRRRNIQSPSI	nucl(8.5),cyto_nucl(8),cyto(6.5),extr(6),E.R.(2),mito(1),plas(1),pero(1),golg(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGU5	Dolichol phosphate-mannose biosynthesis regulatory protein	Low	8	1	60-81	VMINSAKKKKAKKAAAAAKKTS	plas(11),mito(6),cyto(5),extr(2),E.R.(2)	AKKKKAKKAAAAAKKTS (65-81, prob:0.972)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGZ9	Aldedh domain-containing protein	Low	5	1	112-133	QKEWARTTFKQRRKVLRTLMRW	plas(19),E.R.(8)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHJ8	Uncharacterized protein	Low	6.2	1	577-601	GWILNNKFEEKKKQRKANNFQFYLR	mito(7.5),cyto_mito(7),cyto(5.5),nucl(4),E.R.(3),golg(3),plas(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIU6	Uncharacterized protein	Low	5.8	1	23-47	EFWAGPSRPQPRRYNKSTDWQPHKS	cysk(15),cyto(4.5),mito(4),cyto_nucl(4),nucl(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XL77	Uncharacterized protein	Low	8.4	2	50-74, 326-347	SFWPLRQPRTTKPHPKFFRRMFWDC, VSGNIGSRVRKNRKYGDRYELV	plas(5),golg(5),mito(4.5),nucl(4),cyto_mito(4),pero(3),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMT2	Uncharacterized protein	Low	9.7	2	1-20, 342-363	MSNNKNKKKLSRDSNTASDP, SWKTNFRQLPRPKKLTKLRTFT	nucl(12),cyto_nucl(9.833),mito_nucl(8.333),cyto(6.5),mito(3.5),pero(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XP87	Uncharacterized protein	Low	9.7	1	76-107	SSGERQDGSIRKKKKKSKKTKKDDTEKGENAA	cyto_nucl(6),nucl(5.5),cyto(5.5),mito(4),E.R.(4),golg(4),extr(2),vacu(2)	IRKKKKKSKKTKK (85-97, prob:0.992)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZI8	MoCF_biosynth domain-containing protein	Low	7.3	1	103-122	DETRQRMRKLWKSKRNEATF	cysk(10),nucl(7),cyto(7),cyto_nucl(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2Z7	Brr6_like_C_C domain-containing protein	Low	9.3	1	162-200	FLPPKKTSKGEKKAHKFSDKAAKKVERRRRKQGSGQNVF	plas(19),nucl(3.5),cyto_nucl(2.5),E.R.(2)	PKKTSKGEKKAHKFSDKAAKKVERRRRKQ (165-193, prob:0.989)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE82	MFS domain-containing protein	Low	8	1	571-593	ELEGECKKVKGRRRRLSMGSVGE	plas(25)	KGRRR (580-584, prob:0.645)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFX4	Uncharacterized protein	Low	7.5	1	7-26	CSGGRPTKTQIRKTTQQLQA	mito(9),nucl(7),cyto_mito(7),cyto(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XG02	2-(3-amino-3-carboxypropyl)histidine synthase subunit 1	Low	9.6	1	12-34	QPESAPVQKQPRRRFIGKRAAAE	cyto(15),cyto_nucl(11.5),nucl(6),pero(5)	RRRFIGKR (23-30, prob:0.638)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLW2	Uncharacterized protein	Low	7.5	1	937-957	LEENVKKYKLRLKKLGEEVTD	cyto_nucl(10.5),cyto(10),nucl(9),mito(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMH0	Uncharacterized protein	Low	7	1	32-55	VATEKKSDTKHHHHHHFHFHHHSN	cyto_nucl(12),cyto(11.5),nucl(7.5),pero(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XP55	Uncharacterized protein	Low	8	1	450-475	LLGRLKLKLAKPKDTPKPKPKRVFES	mito(23.5),cyto_mito(13)	LKLKLAKPKDTPKPKPKR (454-471, prob:0.896)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPZ5	Uncharacterized protein	Low	9.7	1	11-32	ARKDRLAKLRSLKRKQEHDVSS	nucl(17),cyto_nucl(13.5),cyto(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSE5	Uncharacterized protein	Low	8.4	1	693-725	EDDDKFDSRNPKRKPVVKRTPHAQSQPRNVWGF	nucl(14),cyto_nucl(12.333),cyto(8.5),cyto_mito(6.166)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X116	Zn(2)-C6 fungal-type domain-containing protein	Low	6.9	1	5-32	NVALRACSACRKQKRKCTKELPDCSLCL	mito(14),nucl(5),cyto(3),pero(2),plas(1),extr(1),E.R.(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4I9	Biotin carboxylase	Low	7.6	1	2156-2176	WYNARRFLYWRLRRRLNEEYI	cyto(12.5),cyto_nucl(11.5),nucl(9.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6F1	Uncharacterized protein	Low	9.1	1	172-191	FMRKDTPRDNLPRPRPKVRA	nucl(15.5),cyto_nucl(11),pero(6),cyto(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8L0	Phosphatidylserine decarboxylase proenzyme 2	Low	8.8	1	192-225	GLPKQEGEEKKKSKKRLKLKGRGKGTKSKKNDTS	cyto(10.5),cyto_nucl(7),E.R.(4),mito(3),extr(3),nucl(2.5),plas(2)	EEKKKSKKRLKLKGRGKGTKSKK (199-221, prob:0.997)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9U5	NACHT domain-containing protein	Low	8.5	1	661-684	EKIEKAYHSIRKNKKNLKNSDYQE	nucl(12.5),cyto_nucl(10.5),cyto(5.5),pero(4),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XB18	Uncharacterized protein	Low	9	1	198-224	ISNVLGRKPKLQKKYKQPDPNYNRLYK	nucl(16.5),cyto_nucl(16),cyto(8.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XC40	PINc domain-containing protein	Low	8.7	1	1115-1141	TSLLRRDMSMKKRRARAQMERYRQHGV	nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE83	Uncharacterized protein	Low	5.4	1	208-228	MTYYRTSIKRLRRNIRDDLIR	plas(18),cyto(2),E.R.(2),vacu(2),nucl(1),pero(1),golg(1),cyto_mito(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XL85	Peptidase_S8 domain-containing protein	Low	5	1	178-198	SLLNRRSKTKRPSLNETRPSS	extr(24),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPC2	Uncharacterized protein	Low	6.8	1	84-103	PGCWLDKKGKKVCHKEKYLV	mito(10),extr(6),cyto_nucl(6),nucl(5.5),cyto(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XR67	Uncharacterized protein	Low	9.7	1	68-87	IRPLNFSRRRQTEHRRQSPS	nucl(19.5),cyto_nucl(12.833),cyto(5),cyto_mito(3.833)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTG0	PAN2-PAN3 deadenylation complex catalytic subunit PAN2	Low	7.8	2	1003-1022, 1270-1292	TVDIYFKKVRQRKLSLRFLA, IASPPPPQQQQQQQKRNMQGRWR	cyto(9.5),cyto_nucl(6.5),mito(5),plas(5),nucl(2.5),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X090	Uncharacterized protein	Low	6.1	1	704-723	FKSIWKRKPSTDKVKPHEPF	plas(16),nucl(3),E.R.(3),cyto(2),vacu(2),mito_nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5X3	MFS domain-containing protein	Low	5	1	477-497	GSWWKAWKKKDASSRLDRQIA	plas(24),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X694	Uncharacterized protein	Low	6.6	1	211-231	EKNPIRRYKAYKKAGKNHGNL	plas(17),nucl(4),mito(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6Q5	Uncharacterized protein	Low	5	1	789-813	INNDYCKKPSPPFPKPPKAGGKPAD	extr(19),E.R.(3),vacu(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFX7	Uncharacterized protein	Low	9.2	1	858-880	KTGKVDPDSKSRQKKTPLSQAAE	nucl(15.5),cyto_nucl(12),cyto(7.5),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGT8	Uncharacterized protein	Low	9.9	1	1-25	MPKRPHPPPTRRKKTPKAPETADEY	mito(14.5),cyto_mito(9.666),nucl(8),cyto_nucl(6.833),cyto(3.5)	KRPHPPPTRRKKTPK (3-17, prob:0.866)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XI13	Uncharacterized protein	Low	7.4	1	182-205	TYEFTARTRKKSHKGGNRLSETRE	cyto(11),cyto_nucl(11),nucl(9),pero(3),mito(1),plas(1),golg(1),cysk(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XL83	Uncharacterized protein	Low	8.6	1	18-42	DDEKHFPPCRCKRVRGTRHLDRACN	nucl(16.5),cyto_nucl(14.833),cyto(8),cyto_mito(6.165)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XN18	Tyrosinase	Low	5	1	444-465	TAVRAAKHKRSNMRRQDAKPAD	extr(14),mito(4),cyto(4),cyto_mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNQ4	Serine/threonine-protein phosphatase 2A activator	Low	7.9	1	8-35	NTTSSPLKLPTPRKPRQDRTPAIPPKPT	nucl(13),mito_nucl(10.333),cyto_nucl(9.833),mito(6.5),cyto(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XP82	Uncharacterized protein	Low	6.4	1	341-364	PESANEWKRKGWKEKARWRFLGSF	cyto_nucl(12.166),cyto(11.5),cyto_mito(9.498),cyto_pero(7.998),nucl(7.5),mito(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRF6	Uncharacterized protein	Low	8.9	1	6-25	DTETRKLKRLASNRPEKLSR	nucl(12.5),mito(11),cyto_nucl(8.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRV0	Uncharacterized protein	Low	8.9	1	3-24	NEIPHAQRTRKRAPRCKELDNP	nucl(15),cyto_nucl(13.5),cyto(10)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XV05	Protein-serine/threonine kinase	Low	8	2	6-30, 61-81	SRYICSRCFPCPRNRNTNLYRRLDF, CQSRSQSRSSNRSQHNRNVTS	mito(18),cyto_nucl(4),nucl(3),cyto(3),extr(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0I6	CAP10 domain-containing protein	Low	5	1	112-134	ADAVKNYKKRYNRSPPHGFNKWF	golg(10),extr(7),E.R.(6),mito(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0K6	Uncharacterized protein	Low	8.4	1	431-455	IAYLVIRKKRIEKRKSMPQLSLKPG	plas(21),E.R.(2),nucl(1),cyto(1),cyto_nucl(1),golg(1),vacu(1)	RKKRIEKRK (437-445, prob:0.738)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X179	Uncharacterized protein	Low	8	1	183-202	GQKVRKIKMKMRRREHEQDT	plas(21),mito(2),E.R.(2),vacu(2)	RKIKMKMRR (187-195, prob:0.665)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2F4	WD_REPEATS_REGION domain-containing protein	Low	6.6	1	845-866	LLSTPKTSAKQQQDKTKPKLLM	cyto(8.5),cyto_nucl(8.333),cyto_mito(6.666),nucl(6),extr(5),mito(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X727	Uncharacterized protein	Low	9.2	1	232-251	EESLGPKKDKKKWMNSSFDS	nucl(11),plas(6),mito(4),cyto(3),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7S8	Eukaryotic translation initiation factor 3 subunit B	Low	7.9	1	630-649	LSKEQQKQVRKNLREYSRQF	cyto(13.5),cyto_nucl(12.5),nucl(10.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7Y2	Presequence translocated-associated motor subunit PAM17	Low	5	1	58-77	LDWNTFLKLRKQKRRYNLAG	mito(15),plas(8),extr(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAK2	Uncharacterized protein	Low	7.3	1	10-33	TASLSPKNLRLRKRKSSNASTTVS	mito(16),nucl(7.5),cyto_nucl(6),cyto(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEM2	Uncharacterized protein	Low	5	1	91-110	LNFPCFRRSRCPRKDPAFAA	plas(27)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGM9	Phosphodiesterase	Low	9.6	1	194-220	LSMHCYRLARKAQKRRTERKRSWVGVD	mito(12),cyto_nucl(6.5),cyto(6),nucl(5),golg(2)	RKAQKRRTERKR (203-214, prob:0.76)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJ74	Uncharacterized protein	Low	9.1	1	282-303	GSSGLRPRTKKKFRTTEEEMQE	cyto(12),nucl(11),mito(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLC3	Glucanase	Low	5	1	23-53	AGKTKEKHPKLETYKCTKKGGCKKQTNYVVL	extr(19),E.R.(4),cyto(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLV8	Uncharacterized protein	Low	9.2	1	355-374	LTKKEQKKTRLQTRMAKLKE	nucl(11),mito(8),cyto(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUM1	Ribosomal_L2_C domain-containing protein	Low	5	1	181-200	KASRAMWKARTKRNNWPRTR	mito(18),cyto(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXS9	F-box domain-containing protein	Low	8.5	1	1-20	MPNKIFKRALRKLHIVRSCD	mito(13),nucl(11),cyto_nucl(7.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1H8	Peptidase A1 domain-containing protein	Low	7.3	1	273-295	VVIFITCRKQRKSKPMPDIPSVD	nucl(7),plas(7),cyto_nucl(7),mito(5),cyto(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1K4	Uncharacterized protein	Low	5	1	284-308	IQFPKIPRKKLYFPSRGRPKEQQGL	plas(20),E.R.(2),golg(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X386	Glycine dehydrogenase (aminomethyl-transferring)	Low	5	1	48-72	SAENLKLPPKQKERKTYPLPKIELP	mito(23.5),cyto_mito(14.333),mito_nucl(12.666)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9F5	Thioredoxin domain-containing protein	Low	5	1	654-676	LGGAYLWRSRRHRRGFGPHPGLG	mito(7),extr(6),golg(6),cyto(3),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAL0	tRNA (guanine-N(7)-)-methyltransferase	Low	9.9	1	2-26	ESSPALNPVKRQKRIDFRKTEQQEV	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XB81	Uncharacterized protein	Low	9	1	118-137	EAPHKHRRFEHIHHHKRKLN	extr(13),nucl(3),mito(3),cyto(3),cyto_nucl(3),cyto_mito(3),mito_nucl(3)	KPKK (186-189, prob:0.633)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XD42	Uncharacterized protein	Low	9.3	2	364-383, 454-473	DPTVERTKTKKMKNFKAEDI, VGAFLRRQPRDWGRRRSSFG	cyto_nucl(10.333),cyto(10),nucl(9.5),cyto_pero(7.333),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLB9	Uncharacterized protein	Low	6.4	1	279-301	AGYFLFSWKRKRSRQQNGGFGDL	plas(11),mito(5),nucl(4),E.R.(2),vacu(1),golg(1),pero(1),extr(1),cyto(1),cyto_pero(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPT0	Uncharacterized protein	Low	7.9	1	570-591	EKEELPRIPKPRRPQSEEDFIR	mito(11.5),nucl(10),cyto_mito(7),cyto(1.5),plas(1),extr(1),golg(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQD3	Uncharacterized protein	Low	7.7	1	29-49	VDKLWGKYKFQPKPKLPMGRL	cyto_nucl(10.5),nucl(10),cyto(9),pero(4),cysk(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQK2	Nuclear protein localization protein 4	Low	7.4	1	140-159	KQDGKIHRPKDQKMCRHGSK	cyto(15.5),cyto_nucl(14),nucl(9.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZ83	Uncharacterized protein	Low	5.7	1	2-21	VRYHHPLNRRRYARNAYLNS	mito(8),plas(6),golg(3),nucl(2),cyto(2),extr(2),cyto_nucl(2),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X398	Uncharacterized protein	Low	9.6	1	130-158	LVDSSTSTTKQRRKKKKKGLKNSEPGAYQ	mito(19),nucl(4),cyto(2)	KQRRKKKKKGLK (139-150, prob:0.975)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X653	C2 NT-type domain-containing protein	Low	9.8	1	1-21	MHSFVVPKSRRPRFNLKLQVH	nucl(12),mito(10),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XI19	Uncharacterized protein	Low	9.1	1	30-59	NLSKKFAKLYDQKRSKAQRKYRVPPTPSDP	nucl(15.5),cyto_nucl(13.5),cyto(8.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XK28	Uncharacterized protein	Low	8.9	1	444-467	SPPTCSYTWKPPRDSRSRARGHTA	nucl(15),cyto_nucl(11.5),mito(6),cyto(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKT3	NACHT domain-containing protein	Low	6.7	1	102-122	AGPSNSRLKRHRKFFDSLKNA	cyto(9),cyto_nucl(8.5),nucl(6),E.R.(6),plas(2),mito(1),extr(1),golg(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XP48	Aldehyde dehydrogenase	Low	5	1	28-52	TFQSHKTRPVEWRKQQLRKLWWGLH	cyto(21.5),cyto_nucl(12.333),cyto_pero(12.166)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQR8	Uncharacterized protein	Low	5	1	21-40	NPTKPCKSSTTKKPSRCTTT	mito(15),extr(12)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XR05	Glycerol kinase	Low	6.1	1	482-508	RKFSAQTTPTQRTRRFRQWERAVAMSK	cyto(11),pero(7),mito(6),nucl(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYY5	Uncharacterized protein	Low	9.4	1	478-503	ALDMIRGRKRSPKQRRSTVDSTRMQF	cyto(10),cyto_nucl(8.5),mito(6),nucl(5),extr(5)	RKRSPK (485-490, prob:0.669)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZ64	Phosphatidylethanolamine N-methyltransferase	Low	5	1	15-42	NSTPQVRERTKSSKKQQKPSPKLTTETL	plas(22),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZQ5	Uncharacterized protein	Low	5.7	1	398-417	KDSKGKPKVKDACRIKCEKL	mito(10),E.R.(9),golg(3),nucl(2),plas(1),extr(1),cyto_nucl(1),pero(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1W3	Golgi apparatus membrane protein TVP38	Low	5	1	51-71	ITNVWKLKRKAHQYWNKLSLA	plas(23),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1X1	Uncharacterized protein	Low	5	1	288-307	TEQKASYPRPWKKNAFFMKD	plas(23),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCL7	Uncharacterized protein	Low	9.9	1	106-137	YSGRGTIKEARNKRRKPWKKLMWVKQNYPDNY	plas(16),nucl(5),E.R.(3),mito_nucl(3)	KEARNKRRKPWKK (113-125, prob:0.911)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEQ5	Protein-tyrosine-phosphatase	Low	9.5	1	144-165	RKPSNERKKLLQPRRPSQRTKL	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEZ2	Uncharacterized protein	Low	5	1	280-310	GRTTHAPVPQRYKDRPKSKYFRGPRWSPIPL	plas(19),mito(2),extr(2),E.R.(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIV3	MFS domain-containing protein	Low	5	1	525-548	TIPMIKWGKRIRKWTAPSYRRFLE	plas(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQH7	Uncharacterized protein	Low	5	1	217-237	CPLGPTCAKKHVRKNICKFYF	extr(20),E.R.(3),golg(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS04	Rieske domain-containing protein	Low	7.7	1	1082-1106	KMDGYLKGRTSKKPRDRTIMKTQEP	plas(10),nucl(8),cyto(4),pero(4),cyto_pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSU9	Uncharacterized protein	Low	9.4	1	66-85	EEEKEKEKEKEKEKEKEKLS	cyto(9.5),cyto_mito(8.333),cyto_nucl(8.166),nucl(5.5),mito(5),pero(4)	EKEKE (74-78, prob:0.62)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYD5	Uncharacterized protein	Low	8.6	1	1-27	MGRVAKCYYCRRDKKKCTWSRIEATTT	mito(13),nucl(9),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYL1	Peptide hydrolase	Low	8	1	499-520	EVKAERKESAKKWKYRGSKLVM	cyto(16),cyto_mito(11.833),cyto_nucl(8.833),mito(6.5)	KK (509-510, prob:0.609)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0S4	Uncharacterized protein	Low	8	1	222-253	TSTPAPKATKGKYKPKPKNKTPSKGGCKDSKY	extr(20),golg(4),E.R.(2)	APKATKGKYKPKPKNKTPSK (226-245, prob:0.945)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3N1	Uncharacterized protein	Low	7.2	1	2-21	SSPVMKKQKKGEPVKGTFER	cyto(11.5),cyto_nucl(10),nucl(7.5),mito(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X723	Peptidase S59 domain-containing protein	Low	8.4	1	1834-1853	IPKVRGIPKHNSKRDVAKRL	nucl(12),cyto_nucl(10),cyto(6),mito(5),plas(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X855	14_3_3 domain-containing protein	Low	5.7	1	36-61	STILSKKLVRARKQRKLDPTRTTKSL	plas(12),E.R.(5),vacu(4),nucl(2),cyto_mito(1),golg(1),pero(1),cyto(1),mito(1),cyto_pero(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8B7	Opy2 domain-containing protein	Low	5.8	1	98-118	AAFFLIRRNKKKQKEAYEASV	extr(9),mito(7),cyto(5),nucl(2),plas(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAL4	Uncharacterized protein	Low	9.9	1	53-82	DAGRPRNSYKHGNPPKKRRQQPNNPNLNSA	mito(10),nucl(5),extr(4),plas(3),cyto(2),pero(1),golg(1),vacu(1)	PPKKR (66-70, prob:0.668)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XEY2	Uncharacterized protein	Low	8	1	322-346	ADYFCERAKKRIKNTPKKNIPPETG	cysk(18),cyto(4.5),cyto_nucl(3.5),pero(3)	KKRIKNTPK (330-338, prob:0.677)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XF68	Uncharacterized protein	Low	5.4	1	149-170	DFGYRNYKKQKRFNGTSRSKID	extr(15),mito(5),cyto(4),nucl(1),E.R.(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJH4	ANK_REP_REGION domain-containing protein	Low	6.4	1	196-222	DDRLYRADYQHRTKKRKNCEDCENDGL	cyto(12.5),cyto_nucl(9),nucl(4.5),mito(4),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKS0	S5A_REDUCTASE domain-containing protein	Low	9.4	1	292-312	GVEFYKRKFGRKLPERKAVVP	cyto(15),nucl(4),pero(3),plas(2),cysk(2),mito_nucl(2)	AKR (194-196, prob:0.611)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XL92	BTB domain-containing protein	Low	8	1	11-30	LCPRCQRDCLCPNCKKCHFC	nucl(9.5),cyto_nucl(8),mito(7),cyto(5.5),plas(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XM20	RNase III domain-containing protein	Low	6.4	1	241-260	GSETMKRRKLARPKFAPLAF	cysk(17),cyto(5.5),cyto_nucl(5.5),nucl(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPA7	Uncharacterized protein	Low	9.2	1	445-467	TYESPEDRKKREKEEQRRIDEAR	mito(14.5),cyto_mito(10.5),cyto(5.5),nucl(4)	KKREK (453-457, prob:0.64)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPY8	Uncharacterized protein	Low	5	1	259-283	NVPPPPPNKHVPKPKPIKEVERPEA	extr(19),E.R.(3),pero(2),mito(1),cyto(1),vacu(1),cyto_mito(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQK1	ANK_REP_REGION domain-containing protein	Low	8.6	1	9-31	FGDSKECKKSKDKLEQIREWLEP	nucl(13),cyto_nucl(11),cyto(7),pero(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXR9	AAA domain-containing protein	Low	8.6	1	938-957	LDKNIKKLAKHNLNGRQIRN	nucl(9),cyto(5),plas(3),pero(3),golg(3),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WY15	Uncharacterized protein	Low	6.2	1	172-197	KPTATPVKKHQSWKWPAKVRPPYYRP	mito(12),extr(7),cyto(4),nucl(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2I1	Uncharacterized protein	Low	6.9	1	427-448	QPTKWGGKERWIRKNTPKIKAA	mito(13.5),cyto_mito(10.5),nucl(7),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7F9	Uncharacterized protein	Low	7.8	1	42-65	SNSISSRTRNNSKPKPNVAQHPAT	cyto(11.5),nucl(9),cyto_pero(7),mito(3),cysk(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGL1	Uncharacterized protein	Low	8.9	1	82-105	IKALKEPPRDRKKEKNIKHTKSIP	cyto(23),nucl(2.5),mito_nucl(2.5)	KEPPRDRKKEKNIK (86-99, prob:0.82)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJE4	zf-Mss51 domain-containing protein	Low	9.2	1	151-175	MQSHERRKERIKQVKESWKNPKPAK	cysk(17),cyto_nucl(4),nucl(3.5),cyto(3.5)	RKERIKQVKESWKNP (157-171, prob:0.673)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLJ4	Protein kinase domain-containing protein	Low	6.1	1	654-675	GVKKLHQHLPPKTPKKTLHHEV	mito(17),mito_nucl(11.999),cyto_mito(11.499),cyto_nucl(6.166),nucl(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQC6	Uncharacterized protein	Low	7.5	1	473-513	IGAIKPAKPNQQKSNQQKSNQQKSNQQKSNQQKQQNQHVQR	cyto_nucl(12.666),nucl(12.5),cyto(10.5),mito_nucl(7.999),cyto_mito(6.999)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQR9	Uncharacterized protein	Low	8	1	111-132	ATSVSSKPAYRPRPKPFKKVEN	mito(14),extr(12)	RPK (123-125, prob:0.612)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTM1	Uncharacterized protein	Low	5	1	199-223	TAMVINQRKEQRRYRRIDEKRGLGA	plas(17),E.R.(5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7K4	Uncharacterized protein	Low	6.7	1	129-148	CIMSRRGQRVAKRRRCTSRV	mito(13),cyto(8),cyto_nucl(8),nucl(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9G0	Very-long-chain 3-oxoacyl-CoA reductase	Low	8	1	309-328	MHEDIRRRSLKKQEREAKKQ	cyto(9),extr(9),mito(5),E.R.(4)	RRSLKKQEREAKKQ (315-328, prob:0.747)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XED3	F-box domain-containing protein	Low	6.5	1	982-1001	CSPHPYTKTWKSKDEKHSPE	cyto(11),cyto_nucl(9.333),cyto_pero(9.333),nucl(6.5),pero(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHS5	Uncharacterized protein	Low	9.6	1	12-35	SEPGPSRAQRQKPPYIPKPKTLKH	nucl(12),cyto(7),mito(5),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLY8	Uncharacterized protein	Low	8	1	1478-1504	SPEAKKKSVKVALRRLRDGRRIGKRFF	plas(23),E.R.(3)	AKKKSVKVALRRLRDGRRIGKR (1481-1502, prob:0.877)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPU5	ANK_REP_REGION domain-containing protein	Low	6.8	1	167-191	ISATFDRWPRLRKKYQQPDPSSDRL	cyto(14),cyto_nucl(11.5),nucl(7),mito(1),extr(1),pero(1),E.R.(1),golg(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQH4	BTB domain-containing protein	Low	6.2	1	202-226	GGCSRCRETKTARPHKSKKIIVRVD	cyto(12.5),cyto_nucl(10),mito(9),nucl(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XR50	DRBM domain-containing protein	Low	6	1	58-77	DPIVPPKNPKPPARNIPPPT	cyto(19),cyto_nucl(12.5),nucl(4),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3M7	Uncharacterized protein	Low	5	1	884-903	YRVHRVKIGMRRPQWPCRHK	plas(24),mito(1),cyto(1),E.R.(1),cyto_mito(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4Y5	Peptidase A1 domain-containing protein	Low	5	1	445-465	GLIFWQAKKRRKAADQPVPTP	extr(24),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCF8	Uncharacterized protein	Low	6.8	1	1-22	MPPKTRVRINRRTQCNRRAGNA	mito(10),nucl(5),plas(4),golg(3),cyto(2),pero(2),cyto_pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKV7	Uncharacterized protein	Low	8	1	119-145	DLTTTVKAPLRRRRRKRQAKSIPASAA	extr(23),vacu(2)	PLRRRRRKRQAK (127-138, prob:0.951)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLA8	Uncharacterized protein	Low	6.2	1	49-71	GSCKNAYCRYRHQRDGNGKPLQA	mito(11),cyto(4),nucl(3),extr(3),pero(3),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRQ0	Peptidase_S8 domain-containing protein	Low	8	1	104-130	ANRLPNQPKPSRPKSKPEKPDYRWELG	cyto(9),cyto_pero(6.833),plas(6),cyto_mito(5.833),pero(3.5),extr(3),golg(2)	KHAGKLKFGSMANRLPNQPKPSRPKSKPEK (93-122, prob:0.827)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WY36	Uncharacterized protein	Low	5	1	33-58	LSNSQPSLQWRKRIFKRERIQGIQLS	cyto(12),cyto_mito(8.333),extr(8),cyto_nucl(7.833),mito(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5G2	Glucanase	Low	8	1	456-480	DGPAAIKQRMARRKRGMKRLSSMSA	extr(24),vacu(2)	QRMARRKRGMKR (463-474, prob:0.828)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7M5	Ricin B-type lectin domain-containing protein	Low	7.5	1	1-24	MDDIQDRKRRRSRSPSVDVEKRAT	cyto(9.5),cyto_nucl(9.5),nucl(8.5),pero(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7V9	Uncharacterized protein	Low	7.9	1	223-247	DDDMLVRRQRLKKKRNLGSDEEQQR	nucl(8),plas(8),mito(3),cyto(3),golg(3),cyto_mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X950	Uncharacterized protein	Low	5	1	36-57	HPPTHIPNRSRHHQYRHQFSSV	plas(26)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAE9	Nuclear pore complex protein	Low	9.1	1	6-27	FSPTKFTSKKARYPVKAVPRNQ	mito(12),nucl(11),cyto(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XC75	Uncharacterized protein	Low	7	2	45-68, 246-266	LAPLRIWQLRRRPKRVFEKSFAGS, QSYSHSKRKYKLARSSFRALI	plas(22),E.R.(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFS3	Uncharacterized protein	Low	9.7	1	737-759	VPPPPKVKASPRTGNANKRQKQA	nucl(19),cyto_nucl(12.833),cyto(4.5),cyto_mito(4.166)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMC5	Uncharacterized protein	Low	5	1	470-493	GALVWLYFRKKKRNQNLPDLPFAQ	extr(11),cyto(10),plas(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMQ9	Uncharacterized protein	Low	5	1	210-229	WLQNFFKKFKKQKIENQEES	plas(27)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRE4	FAD-binding PCMH-type domain-containing protein	Low	5	1	602-629	RMDPQTVEKDRWKRNKPAQHNPLVKEEE	mito(25.5),cyto_mito(14)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XV97	Uncharacterized protein	Low	9.7	1	707-726	EMERRRIKERLEKSEKRAIR	mito(15),mito_nucl(11.833),cyto_mito(8.833),nucl(7.5)	RRRIKERLEKSEKRAIR (710-726, prob:0.824)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1U7	Uncharacterized protein	Low	6.1	1	242-265	GRTTRDQPQKEIDRRRRRDESFEV	cyto(7),extr(6),nucl(3),mito(3),plas(3),E.R.(3),mito_nucl(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJY8	Alpha-1,4 glucan phosphorylase	Low	7.8	1	16-38	DILSQTFAKRPRHKRTATGFGSR	cyto(13),nucl(7),pero(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLR8	Uncharacterized protein	Low	5	1	418-437	NEDRKAKSTKVRELRQQIID	extr(16),golg(4),E.R.(3),plas(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XPD8	Uncharacterized protein	Low	8	1	1-29	MTTTLSVYRHPPRRRPRKTWLQRRFLLFE	mito(13),plas(7),cyto(3),vacu(2),cyto_pero(2)	PRRRPRK (12-18, prob:0.702)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS88	Copper-fist domain-containing protein	Low	9.1	1	41-60	QCQHCRSLRKSRSSHVKCDC	nucl(16.5),cyto_nucl(14.5),cyto(9.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSR4	Uncharacterized protein	Low	9	1	22-46	ESVTASGQTRKRKRTKSLATNASEN	nucl(14.5),cyto_nucl(12.5),cyto(9.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYQ3	TPR_REGION domain-containing protein	Low	9.1	1	852-880	RTRSLMHKWWLRNVRKKNKMKRELTELML	mito(20.5),cyto_mito(12),nucl(4)	RKKNKM (866-871, prob:0.682)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZW7	Uncharacterized protein	Low	6.2	1	1608-1628	ADQPLRGRTPQPRCQRKEIVY	plas(10),cyto(6.5),cyto_mito(5),nucl(4),mito(2.5),pero(2),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X106	Uncharacterized protein	Low	8.2	1	61-84	KFCENRRWEIWRHRSRRRKVYDLI	nucl(8),cyto(6),mito(5),golg(3),cyto_pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1E2	Uncharacterized protein	Low	9.5	1	192-216	VECRHERCPDKGKRFPRRDNFVDHF	nucl(15.5),cyto_nucl(10.5),cyto(4.5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1S5	Uncharacterized protein	Low	9.5	1	1074-1104	ESLSPPQKPRAQKWTKPRSRDIFTKNNQQRA	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4L2	MFS domain-containing protein	Low	5	1	516-543	ETKGVHPVKMSKKLQKAKKDLHEIENEG	plas(27)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5R7	Uncharacterized protein	Low	9.6	1	112-132	GDGEEHKHRHRHHFHRREPSD	nucl(16.5),cyto_nucl(11),cyto(4.5),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9Z2	WD_REPEATS_REGION domain-containing protein	Low	6.7	1	94-117	DFTQHPNGKGRRRDKLLRPFKISS	plas(14),nucl(5),E.R.(2),vacu(2),cyto_mito(1),golg(1),pero(1),cyto(1),mito(1),cyto_pero(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCV4	CP-type G domain-containing protein	Low	9.5	1	659-678	KDGKMHFKSARVKRRTNTVD	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE21	DRMBL domain-containing protein	Low	7.8	1	676-697	HSDSTHPPSPNKKQSIRKVGYN	nucl(11.5),cyto_nucl(10.833),cyto(9),cyto_mito(6.333),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJD2	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial	Low	6.6	1	40-62	EEDPNDPQKKRRIRPTGPWQVQI	cyto(9.5),cyto_nucl(9),cysk(7),nucl(5.5),mito(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMP0	Uncharacterized protein	Low	9.2	1	1091-1110	CVQGTRRKVKDPDQHRHLNE	nucl(16),cyto_nucl(12),cyto(6),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XAW1	ENTH domain-containing protein	Low	9.7	2	135-156, 164-188	DEERLRNERKDRKSWKARVAGL, GSHNQKEQQQHARRRQQRPARNDDE	mito(9),nucl(8.5),cyto_nucl(8),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCE2	Calpain catalytic domain-containing protein	Low	9.4	1	79-103	GSAQKQLNKFWKKFRSNRAGRPTIV	mito(15.5),cyto_mito(10.333),nucl(5.5),cyto_nucl(5.333),cyto(4)	KKKEGKESKEPKP (640-652, prob:0.709)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XD13	Uncharacterized protein	Low	9.4	1	373-392	DSYRGRKRYKAIACRVNRDD	nucl(17.5),cyto_nucl(13.5),cyto(8.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFW0	Uncharacterized protein	Low	8	1	257-276	PTPTPKPKPPSKPIDAKKPE	extr(17),E.R.(4),cyto(3),vacu(2),cyto_pero(2)	PTPKPKPPSKPIDAK (259-273, prob:0.759)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XL58	Goodbye domain-containing protein	Low	9.4	1	178-199	SERVNLLKKKRTIRAPISKDGR	cyto(14),cyto_nucl(10.5),nucl(5),mito(4),pero(2)	KKRTIR (186-191, prob:0.639)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XN60	Uncharacterized protein	Low	6.5	1	122-141	GRKPCRYLRCPKTGHRESIC	cyto(7),extr(7),mito(6),nucl(4),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XR87	UTP--glucose-1-phosphate uridylyltransferase	Low	7.5	1	13-32	NPESFPTSRRHPKSQSAFAF	nucl(10.5),cyto_nucl(8.833),mito(8.5),cyto_mito(7.833),cyto(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2K4	Uncharacterized protein	Low	5	1	426-448	EQMKNSSEEKKHKEYERRAKEED	plas(18),mito(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2R9	F-box domain-containing protein	Low	9.7	1	37-59	TNDPLLWRGRCRRFKYWESSWHQ	nucl(18.5),cyto_nucl(12),cyto(4.5),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3A4	Uncharacterized protein	Low	8	1	36-66	SPESPPKSPTASKRKKGKTRSRLRNLFTSSD	plas(23),E.R.(3)	SPTASKRKKGKTRSR (43-57, prob:0.93)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9M0	Uncharacterized protein	Low	5	1	488-510	LRSPSLERKHTYKRKYREAMGMD	cyto(17.5),cyto_nucl(9.5),cysk(9)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9Q5	Uncharacterized protein	Low	8.9	1	45-64	ISKSDPLKRQRYTPNRPWKS	nucl(15.5),cyto_nucl(11.333),cyto(6),cyto_mito(4.833),mito(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQF5	Uncharacterized protein	Low	8.8	1	96-124	GGGVLVVKRKRQRVRRRKALKAANGARKE	plas(15),cyto(6),nucl(2),E.R.(2)	KRKRQRVRRRKALKAANGAR (103-122, prob:0.981)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS50	Uncharacterized protein	Low	9.3	1	327-351	DEAINKADAKRRRRRLARRKYLGYE	cyto(14.5),cyto_nucl(10),mito(6),nucl(4.5)	AKRRRRRLARRK (335-346, prob:0.957)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XT16	Lon protease homolog, mitochondrial	Low	5	1	1103-1122	ASNLWKEQLKKKPRGASGEE	mito(23),mito_nucl(13.833),cyto_mito(12.333)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XA47	Uncharacterized protein	Low	5.8	1	28-48	HSNTHIRRKDYQEQSRCQFKP	mito(10),extr(9),cyto(5),nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XFL0	Uncharacterized protein	Low	8	1	529-553	GNKRGGSGKKRTMARYKKHLPQSEM	extr(12),mito(10),cyto(2),vacu(2)	KRGGSGKKRTMARYK (531-545, prob:0.797)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMA7	Uncharacterized protein	Low	9.2	1	27-54	FCEGCFSQKHLKRRPDHRRGGTSKTENF	nucl(11),cyto(8),pero(5),cysk(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQC4	Zn(2)-C6 fungal-type domain-containing protein	Low	7.2	1	8-34	SNIQLSCTKCRSRKVKCDRVQPCQSCC	mito(12),nucl(6),cyto(5),plas(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS72	Tyrosinase	Low	5	1	522-542	IKNARDGSRRQKRQETNPVAS	extr(10),mito(6),cyto(4),pero(3),vacu(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYA5	Methionine aminopeptidase	Low	5	1	37-58	CSQDCFKKSWSNHKQVHKTASE	cyto(23),cyto_nucl(14.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZN4	Clr2_transil domain-containing protein	Low	9.5	2	137-156, 524-545	SDKSKACTCRHCNRPPEPTP, AATTRKTTTKRVSTKTKQTAQT	cyto_nucl(10.5),cyto(9.5),nucl(8.5),pero(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZR1	Mitochondrial import inner membrane translocase subunit TIM54	Low	6.9	1	47-67	IVYDRREKKKAQQYWCDRVSH	cyto(14.5),cyto_mito(8.833),cyto_pero(8.833),nucl(7.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X265	Uncharacterized protein	Low	5	1	260-284	IVSTKTTKREKMKMMKRAKAQEGND	extr(17),E.R.(4),golg(2),mito(1),cyto(1),plas(1),pero(1),cyto_mito(1),cyto_pero(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X4C5	Uncharacterized protein	Low	8.4	1	379-406	SGSPNKASSKRLFKRENKLRLRKMAQVN	cyto(17.5),cyto_nucl(10),extr(5),nucl(1.5)	KRLFKRENKLR (388-398, prob:0.652)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X7C8	Rab-GAP TBC domain-containing protein	Low	9.2	1	164-187	LAPPARSSRRKKSTPTQVHPSSRH	nucl(15.5),cyto_nucl(10.5),mito(6),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X896	DNA-directed RNA polymerase subunit	Low	9.7	1	146-166	LRRVQICKKINEQCRKTKACF	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCR7	Uncharacterized protein	Low	6.5	1	155-174	APPNKRSNQNSKKRDVRIKL	plas(15),cyto(5),nucl(4),mito(1),E.R.(1),golg(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIV8	Uncharacterized protein	Low	9.7	1	1011-1034	ISTPRRPSKPPPVKIQKVADRKPS	cysk(14),nucl(5),cyto(5),cyto_nucl(5)	RRPSKPPPVKIQKVADRKPSSKRPR (1015-1039, prob:0.856)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XM46	MFS domain-containing protein	Low	5	1	504-524	LYIYGHRMRKKSKWARSEVGV	plas(27)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNF0	3-phytase	Low	5	1	490-512	NDKTMELKACKKDKKGRCAVSAF	plas(13),E.R.(8),extr(3),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNY6	F-box domain-containing protein	Low	7.3	1	364-386	GWDFDSKKEKKNEDKEGKGKDEE	nucl(7.5),cyto_nucl(7.5),mito(7),cyto(6.5),extr(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSG5	F-box domain-containing protein	Low	6.2	1	21-42	PFAPLFYRRRRLSQRGSEESGS	mito(15.5),mito_nucl(10.833),cyto_nucl(5.333),nucl(5),cyto(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSW2	Uncharacterized protein	Low	7.1	1	1-20	MDRGRKGRRHSVPHVQMRED	plas(16),nucl(6),cyto(2),pero(2),cyto_pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTW5	Uncharacterized protein	Low	9.2	1	114-139	ETPVKVKPNPGPKKRNPPKGKVAKGT	mito(19.5),mito_nucl(12.833),nucl(5),cyto_nucl(4.333)	KVKPNPGPKKRNPPKGKVAKGTPKSSGGRGRRSKA (118-152, prob:0.996)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XTX9	Uncharacterized protein	Low	7.4	1	276-295	ADIRRKKIEMRRQSKQQRIE	mito(13),nucl(8.5),cyto_nucl(8.5),cyto(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUQ0	Uncharacterized protein	Low	7.7	1	1-25	MGIKGKRKQQRRQQQHQQIQLQENT	nucl(12),cyto_nucl(9.833),mito(9.5),cyto_mito(8.166),cyto(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXX6	WD_REPEATS_REGION domain-containing protein	Low	9.7	1	692-713	EANKGGDKKRRRVVPTFVRNVG	nucl(18),cyto_nucl(13.5),cyto(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WYZ6	USP domain-containing protein	Low	8.7	1	69-93	EESGDDKDKKKPDQKPAPSRPNADP	nucl(13.5),cyto_nucl(11.5),cyto(8.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1B8	Uncharacterized protein	Low	7.8	1	65-87	SDVSNYRKYDNRRITNRQTFKSN	nucl(10.5),cyto_nucl(8.833),mito(6),cyto(6),cyto_pero(4.333),extr(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2A0	Uncharacterized protein	Low	8.9	1	66-90	RRQPAASARRKPVSKKKVDTEPTED	mito(13.5),cyto_mito(11.166),mito_nucl(9.999),cyto(6.5),cyto_nucl(6.499),nucl(5)	ARKRRASGRRQPAASARRKPVSKKK (58-82, prob:0.976)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3S2	Uncharacterized protein	Low	5	1	258-277	SNIFRKMMLREKKRMREEGQ	plas(23),E.R.(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8S1	Uncharacterized protein	Low	8	1	339-361	GSNTVTPTKKHKRKNSNPSFKDL	extr(17),plas(5),E.R.(3)	RKRERMARSRSWSRMPSNRTGSRK (207-230, prob:0.752)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XK35	F-box domain-containing protein	Low	8.1	1	22-43	SIFYARQVCRRWRQVNESKFYS	nucl(11),cyto_nucl(8.5),cyto(4),mito(2),plas(2),extr(2),pero(2),E.R.(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQT9	F-box domain-containing protein	Low	8.8	1	18-41	RVANYIKKRMRGGKGKRQGRGQGG	mito(18.5),cyto_mito(11.833),cyto_nucl(4.333),cyto(4),nucl(3.5)	IKKRMRGGKGKRQGR (23-37, prob:0.934)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSB1	Uncharacterized protein	Low	8	1	814-834	LAVARRRYKGMKEREKKGYAV	plas(21),E.R.(4)	KKDSKRRRLAALAKRRK (385-401, prob:0.909)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XT78	Uncharacterized protein	Low	7.8	1	190-212	VRLLRKQRQSSSRKPYARRDDAP	nucl(13),cyto_nucl(11.833),mito_nucl(9.499),cyto(7.5),mito(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUA5	Uncharacterized protein	Low	8	1	792-817	DDLKRWVDEKREKRRRHGHEDANIDW	plas(19),E.R.(3),vacu(3)	KREKRRR (801-807, prob:0.718)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUJ7	Uncharacterized protein	Low	8.8	1	124-153	VKRPERWRTRLSWLRRSRKKIGHQKTGAVT	cyto(6.5),extr(6),plas(5),cyto_nucl(5),nucl(2.5),mito(2),pero(2),E.R.(2)	RPERWRTRLSWLRRSRKKI (126-144, prob:0.809)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0I7	Flavodoxin-like domain-containing protein	Low	8.2	1	1237-1260	MLVQRDHGDRKNRKHARLKYTIDD	cyto(12),nucl(8),pero(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X462	Uncharacterized protein	Low	9.4	1	940-965	SPSRGERNRSRDHHHNRDHHHNQHQS	nucl(18.5),cyto_nucl(11.833),cyto_mito(4.333),cyto(4),mito(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9J0	Thymidylate synthase	Low	6.5	1	283-302	VEPLKKQLSREPRKFPKMKI	cyto(10),cysk(8),nucl(4),pero(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XB76	ANK_REP_REGION domain-containing protein	Low	5.6	1	177-204	IESVLQKNRKLNRKYKRPQASSDRLYRS	cyto(20.5),cyto_nucl(12.833),cyto_mito(11.166),nucl(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBZ5	Uncharacterized protein	Low	9	1	561-588	PKSPSGKILRRLLRDKEREKRKKEGAKL	cyto(14.5),cyto_nucl(10.5),mito(4),nucl(3.5),E.R.(3)	KSPSGKILRRLLRDKEREKRKKEGAKL (562-588, prob:0.982)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XUF0	Uncharacterized protein	Low	5	1	21-40	EANPHRYRHHHLRRATTPSY	extr(24),cyto(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0Q2	Uncharacterized protein	Low	7.4	1	221-243	AYEMSKCLQKRKRGKWDEGTVVE	mito(14),nucl(6),cyto(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5B2	Kinesin-like protein	Low	9.9	1	10-33	QVYLRLRPPYQQSPRKSHRENFLT	nucl(16.5),cyto_nucl(10.5),mito(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X5X6	Uncharacterized protein	Low	8	1	245-268	LESDLHKKRRSAARRKRRTGAEAP	plas(21),vacu(3),E.R.(2)	KKRRSAARRKRRT (251-263, prob:0.964)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X621	AB hydrolase-1 domain-containing protein	Low	5	1	33-53	FFIPVGKKKKQARLQAQSELW	extr(9),cyto(6),mito(4),plas(2),E.R.(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCG2	Uncharacterized protein	Low	9.9	1	626-646	ETNTLRKHPMKTRSQKKGEEE	cyto(14),cyto_nucl(12.5),nucl(7),pero(3)	RKHPMK (631-636, prob:0.619)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHI3	Amidase domain-containing protein	Low	5	1	397-418	QEVWYDKKGQRRQKPSRIIVPS	extr(15),plas(8),E.R.(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHV3	PNPLA domain-containing protein	Low	9.5	1	905-933	QSQKRKSYFPIAQANKKRKRMREASATIP	cyto(9),plas(7),cyto_nucl(7),nucl(5),cyto_pero(5)	KKRKRM (920-925, prob:0.731)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XI31	Uncharacterized protein	Low	5	1	62-82	GQPFPWRRHKLTIRQRLQHFT	plas(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XKL8	Uncharacterized protein	Low	9.2	1	211-234	LKRLSHPSRKTTPRRKLTNREVLK	nucl(17),cyto_nucl(14),cyto(9)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQU3	Uncharacterized protein	Low	8.6	1	147-169	PYLQVKFPKRDPRTYKKPQTAEP	nucl(10),cyto(8),cysk(5),mito_nucl(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRB3	Uncharacterized protein	Low	8.4	1	481-505	IVFAFFFMRRRKKRNLPPVPVPGPA	mito(8),cyto(7),extr(5),plas(2),golg(2),nucl(1),E.R.(1),vacu(1)	RRKK (490-493, prob:0.646)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSP6	Uncharacterized protein	Low	9.6	1	335-359	LEYGITSPRKQRPQRKTAQVGNYYD	nucl(21.5),cyto_nucl(13.833),mito_nucl(11.666)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XT01	Uncharacterized protein	Low	8	1	146-168	KPDLPGRFRRRNGEEKRDRRFNP	extr(13),mito(3),plas(3),pero(3),E.R.(3)	AAAKTAPPGAKGIKPSALKLGGVAKPDLPGRFRRRNGEEKRDRRFNPESFPSRKSIKAA (122-180, prob:0.965)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XT51	Uncharacterized protein	Low	8.7	1	82-108	VMKAFGKKDLPKRDKKNLQKYCEQFKD	cyto(12.5),cyto_mito(11.666),mito(9.5),cyto_nucl(8.833),nucl(3)	GKKDLPKRDK (87-96, prob:0.666)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X2C6	Glycogen [starch] synthase	Low	6.7	1	557-581	FMYDFTTKTRRQRINQRNRTERLSD	cyto(11),cyto_nucl(9.5),nucl(6),mito(5),pero(2),E.R.(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X391	Protein SSH4	Low	6.9	1	135-154	DSFCRSWQSQHKKDERDDPQ	cyto_nucl(10.166),nucl(9.5),cyto(9.5),cyto_pero(8.666),pero(6.5),cyto_mito(6.166)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X3U6	Vacuolar calcium ion transporter	Low	8	1	67-87	QEKHERRLRKGAQPKPARFNP	plas(26)	ERRLRKGAQPKPA (71-83, prob:0.755)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6S9	tRNA-dihydrouridine synthase 3	Low	8	1	381-400	VERAERQKKLADFKRKKTEA	cyto(24.5),cyto_nucl(13.5)	FKRKK (393-397, prob:0.682)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X830	Uncharacterized protein	Low	7.6	1	572-593	TNPTPPARYQWRRRSNYHAPVQ	cyto(12.5),cyto_nucl(11.5),nucl(9.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XCG5	Uncharacterized protein	Low	5	1	876-896	FPAHKYKPPPLPKRVPEPRLF	cyto(15),cyto_pero(11.333),cyto_nucl(8.833),pero(6.5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XD46	Uncharacterized protein	Low	9.6	1	92-115	VWLTCSRTYQRRPAKKRFCGEDCD	nucl(17.5),cyto_nucl(13),cyto(7.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XI04	Uncharacterized protein	Low	9.8	1	362-382	KSHPHHYKTKDIQRHRCHVCS	nucl(17),cyto_nucl(11.5),cyto(4),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLE0	GMC_OxRdtase_N domain-containing protein	Low	5	1	71-92	AQTTTFHKSKKSEKLNNREAIV	cyto(22.5),cyto_nucl(13.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XN76	Uncharacterized protein	Low	8	1	457-480	LYGIEPKKNDRKERSKSSLRKFGS	extr(17),E.R.(5),golg(2),vacu(2)	RKER (467-470, prob:0.633)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0G0	Uncharacterized protein	Low	6.8	1	83-102	GKKMRICCTQLKRSPRCRSL	mito(13),cyto_nucl(6),nucl(5.5),cyto(5.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X288	F-box domain-containing protein	Low	6.5	1	119-140	ITHPTKKGVRVTKKYCKRCAVD	cyto(11.5),cyto_nucl(9),pero(6),nucl(5.5),cysk(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X9K2	Uncharacterized protein	Low	8.8	1	280-305	EVMAMKAPKKTNKKLKRTSTMPQDED	plas(13),cyto(6.5),cyto_nucl(5),E.R.(3),nucl(2.5)	KTNKK (289-293, prob:0.615)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XHP7	Uncharacterized protein	Low	8	1	30-50	DIPFTRQHKRDTQRRRCLGIH	plas(9),nucl(8),cyto(4),mito(3),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIJ5	Uncharacterized protein	Low	7.2	1	15-40	TVAGHNIVKRKSRPKRQTLELGQNSV	mito(16),nucl(7),cyto_nucl(6),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XK96	GPI inositol-deacylase	Low	8	1	86-108	GGKSGRSRIGRRPRLRSVWHCGF	plas(23),E.R.(2)	RSRIGRRP (91-98, prob:0.652)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XSL5	Uncharacterized protein	Low	5	1	402-423	GIGCRNKAVRSRHMQRHVRTTG	extr(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XT96	Uncharacterized protein	Low	7.8	1	235-257	FASALSRSGKWKRSKREWVWTLG	nucl(9.5),mito(9),cyto_nucl(8.5),cyto(6.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZE7	Uncharacterized protein	Low	6.2	1	479-498	QRNMRGNRRKGSRQNNVDYD	extr(10),mito(9),cyto_nucl(4),nucl(3.5),cyto(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X096	MYND-type zinc finger protein samB	Low	5	1	46-66	ADRPRHKTGCKTVKKARETYE	mito(9),cyto(6.5),cyto_nucl(4.5),extr(4),plas(2),pero(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0J4	Uncharacterized protein	Low	5	1	449-475	EEEWILLRQKQKQKQKQEQEQEQEQEQ	mito(25)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6Q6	Uncharacterized protein	Low	9.6	1	1722-1744	SVSKGWKVTKWPFKPNRQEVDPE	nucl(18.5),cyto_nucl(11.333),cyto_mito(3.833),mito(3.5),cyto(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8F9	Uncharacterized protein	Low	6.5	1	295-314	TTEYNKRKQRSKAPSPQSEQ	cyto(17),cyto_nucl(13.833),cyto_mito(10.499),nucl(7.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XG32	Xanthine dehydrogenase	Low	6	1	265-285	LAFGNKRKKWYRPTTIQQLLE	cyto(15.5),cyto_nucl(10),cysk(5),nucl(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XLA6	Uncharacterized protein	Low	5	1	26-51	QQTIRSLLRKRLPRNQNNPHHHLHNR	extr(9),golg(7),plas(5),E.R.(3),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XN83	Uncharacterized protein	Low	7	2	2066-2094, 2344-2368	TSYSTKHVPGTKRRSSKKPTSTSKSTSKP, EFLHHGKNLKQNLPRRNRRFLRTTW	extr(22),E.R.(2),plas(1),golg(1),vacu(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQQ7	Uncharacterized protein	Low	7.6	1	1412-1437	RAQLKAMARFQQRRRPKPGDIRSWAG	nucl(8),mito(8),mito_nucl(8),extr(7)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XRZ6	Uncharacterized protein	Low	8.1	1	1-25	MSSTTDTRSRKRELRKLNQDIWEGK	nucl(10.5),cyto_nucl(7.5),pero(7),mito(5),cyto(3.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XV31	DUF4097 domain-containing protein	Low	8.3	1	18-40	EVELQQPKPKRPLWRRCIRVFLT	nucl(14),cyto_nucl(12.333),cyto(8.5),cyto_mito(7.166)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZ95	Uncharacterized protein	Low	5	1	40-64	LVIAGFDRRRRWKQQDEEQKRGREL	mito(16),cyto(4),golg(3),plas(2),cyto_nucl(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X8D6	Uncharacterized protein	Low	5	1	387-411	VANGPGCKRFKYRRVGQPLKRGLLG	extr(22),mito(2),plas(1),E.R.(1),vacu(1),cyto_mito(1),mito_nucl(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBV7	Uncharacterized protein	Low	5	1	1-21	MLSTRISRRLPRVFPRPDKLI	mito(24),cyto(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XGC4	Uncharacterized protein	Low	8.7	1	466-491	SAEDSYWNDKRKRRKRGPVEEVHAPI	extr(11),E.R.(5),golg(3),nucl(2),cyto(2),plas(2),cyto_nucl(2)	KRKRRKRG (475-482, prob:0.877)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIH5	Uncharacterized protein	Low	7.8	1	21-42	NGPVIFRKRPHQFQRIRKLIVN	cyto_nucl(11),nucl(10),cyto(10),mito(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJV8	Fatty acid hydroxylase domain-containing protein	Low	5	1	384-405	ESTTVTEPPRQRRRTRTITLAD	plas(20),mito(3),E.R.(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XK85	Uncharacterized protein	Low	6.8	1	69-89	AITPRSTTRRRSRYSKAPEDE	cyto(9.5),cyto_mito(9.5),mito(8.5),nucl(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMM1	Metallophos domain-containing protein	Low	6.1	1	6-26	DEPSMSTKKTRKTRFICMGDT	cyto(14),cyto_nucl(9.833),cyto_pero(8.833),nucl(4.5),mito(4)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XMM2	XPG_I_2 domain-containing protein	Low	9.2	1	511-541	ITYHPKGMSKSAKKRAKKRPKVSEGQQQGTS	cyto(17),mito(6),nucl(3)	GMSKSAKKRAKKRPK (517-531, prob:0.974)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XNI5	Uncharacterized protein	Low	9.1	1	218-237	IEPPRFKSANLQKYKRRRGI	nucl(16),cyto_nucl(12),cyto(6),mito(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XQA5	MFS domain-containing protein	Low	5	1	567-590	PCPFIFYKYGKQLRQKSKYAPTFG	plas(27)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WXN0	Uncharacterized protein	Low	8.2	1	16-35	PENIRRTRRSRSSSQSNGNG	nucl(9),cyto(7.5),mito(7),cyto_pero(4.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1WZ23	Vacuolar membrane-associated protein IML1	Low	6.4	1	593-613	LTSHTRQKKSSNFKPRCKMYE	mito(13.5),cyto_mito(10.5),cyto(6.5),nucl(5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0B5	Uncharacterized protein	Low	5.3	1	62-84	STYRPPSPSKHPHSKPTYNPTDS	plas(19),golg(4),nucl(1),mito(1),cyto(1),cyto_nucl(1),vacu(1),cyto_mito(1),mito_nucl(1)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0V2	Uncharacterized protein	Low	8.7	1	99-135	SSTSKPRTLRPHTSNSRISKPRTAKPRMPEPRARTAE	plas(13),mito(3),cyto(3),cyto_mito(3),nucl(2),E.R.(2),vacu(2),cyto_pero(2)	KPRTAKPRM (118-126, prob:0.674)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X0W1	Uncharacterized protein	Low	5	1	129-148	VWNKVKRTCKTKKPLSEQIL	extr(22),E.R.(2),golg(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X1P2	DAO domain-containing protein	Low	6.1	1	424-444	RVPTKVSTRNQPKKGKTEKGV	cyto(10.5),mito(8),cyto_nucl(7.5),nucl(3.5),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X674	Protein kinase domain-containing protein	Low	7.1	1	155-177	AEYYSPRSKRHRLNQAKEKRVKY	mito(11.5),nucl(9.5),cyto_mito(9.333),cyto_nucl(8.333),cyto(6)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X6J5	Uncharacterized protein	Low	9.6	1	276-299	SVDEGRGRTKHKQQRPPRSHDLDA	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XET1	Uncharacterized protein	Low	7.4	1	85-105	GEQQREPRKRVVRKIVFRTSS	nucl(10.5),cyto_nucl(9.833),mito_nucl(8.166),cyto(7),mito(4.5),extr(2),pero(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XH89	Uncharacterized protein	Low	8	1	354-376	LFSETFRPVRRGKRRRLFAAYGF	plas(21),E.R.(4)	RRGKRR (363-368, prob:0.682)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1X452	Uncharacterized protein	Low	8.8	2	233-256, 295-316	QKFSPTCLGERKKKCKTPCTSTVT, QFPAACKTLKPKPPPKPTMDDE	extr(9),cyto_nucl(6),nucl(5.5),cyto(5.5),E.R.(3),mito(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XBT6	Terpene synthase	Low	7.7	1	169-188	KYAPPDERRRHKRLNRDYML	cysk(15),nucl(8.5),cyto_nucl(6),cyto(2.5)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XDT2	Uncharacterized protein	Low	5	1	52-72	EEVFRKRNAAKHLRLKRHDDD	extr(17),mito(5),pero(2),vacu(2)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XE12	Peptidase_S8 domain-containing protein	Low	8	1	645-666	ITFAHRGPKKPKEGRRGQKSGC	extr(20),plas(3),E.R.(2)	RGPKKPKEGRRG (650-661, prob:0.865)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XG15	Uncharacterized protein	Low	6.2	1	1-21	MPPVGPHRRTHQRTPALTRSP	mito(19),nucl(3.5),cyto_nucl(3),pero(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XIW6	Uncharacterized protein	Low	8	1	228-249	AVTVAARKKRGRKIPGRGVNGE	plas(21),mito(2),E.R.(2),vacu(2)	ARKKRGRKIPGR (233-244, prob:0.912)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XJT6	40S ribosomal protein S25	Low	8	1	3-28	GAASGGKKPKKKWSKGKVKDKSVHAV	cyto(10),mito(9),cyto_nucl(9)	GGKKPKKKWSKGKVKD (7-22, prob:0.976)
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XK58	Elongation factor 2	Low	8.4	2	268-287, 848-871	NPFTKKWTKNDKHEGKPLNR, IFTKVIQPARKRKGLKENIPDVNE	cyto(15.5),cyto_nucl(11.666),cyto_mito(10.333),nucl(6.5),mito(3)	
UP000008784	Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)	G1XS76	Peptidase_M14 domain-containing protein	Low	5	1	234-254	QTTNRLWRKSRQKHPSNSCAG	extr(26)