ProteomeAccession ScentificName ProteinAccession ProteinName Category ConfidenceScore #NoLS Positions SegmentSeqs PSORT NLS UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CEM4 VWFA domain-containing protein Low 5 1 229-250 EEKNRQEKEKREREEQERKANL mito(15.5),cyto_mito(11.999),cyto(7),cyto_nucl(6.833) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMH6 Uncharacterized protein Low 5 1 400-420 ECTECENKPGRKKVKELSRLW plas(20),mito(3),E.R.(2),mito_nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVF8 Uncharacterized protein Low 5.4 1 17-36 IPHKRVEQLGRQHRRPRLVH mito(13),cyto(6),pero(3),nucl(1),plas(1),extr(1),E.R.(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYY2 HAUS6_N domain-containing protein Low 9.7 1 307-326 QRARLHRWRQYRNSMRKHER nucl(15),mito(6.5),cyto_mito(6),cyto(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZ49 Uncharacterized protein Low 8 1 372-392 STKVFTSTTKRAHRARRGHGH extr(25) RARR (385-388, prob:0.635) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAX2 Glyco_trans_2-like domain-containing protein Low 5.8 1 63-85 AELNRFCNERRRRRLYRLDGASS plas(11),mito(7),cyto(5.5),cyto_nucl(4.5),nucl(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CD05 Zn(2)-C6 fungal-type domain-containing protein Low 8.1 1 59-82 IITACLTCRRRKVKCDHAQPVCSP mito(16),nucl(8),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CE36 Uncharacterized protein Low 8 1 468-488 EEDWKREERNHARRQAHMRTL mito(26) KRRREEEDWKREERNHARRQAHMRTLAAEREKARS (463-497, prob:0.723) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHV9 Uncharacterized protein Low 5 1 19-42 EPSSHNPFKKFRARPRRSSSIQLE plas(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLG0 U-box domain-containing protein Low 8.2 1 181-203 YLLPCFKRISRMQQKFRRTGDND nucl(11.5),cyto_nucl(10.5),cyto(8.5),mito(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLR7 Uncharacterized protein Low 8.9 1 106-127 NDASPSKPKRQKKTPATPVKLE cyto(20),cyto_nucl(12.833),cyto_mito(10.833),nucl(4.5) TPKKGKGKAKKDDATPGAGNDASPSKPKRQKK (87-118, prob:0.946) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CR80 Uncharacterized protein Low 6.7 1 3-35 VRKCTICDRRFKKTEHFKRHERSHTKEKPYECN mito(8.5),plas(6),cyto_mito(5.5),nucl(5),golg(3),cyto(1.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSW0 C3H1-type domain-containing protein Low 8.8 1 377-401 PPTQGRSKKASKSRRLYQPRSHGAV mito(12),nucl(10),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTL0 Uncharacterized protein Low 5 1 192-211 LSKQQRKQSIRRRQLQYTTF plas(18),E.R.(4),mito(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWF3 Arylsulfatase Low 5.8 1 465-485 RDEPEKFMRKPPRFQRVVKQF cyto(15),pero(5),mito(4),nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWL9 Uncharacterized protein Low 5 1 266-289 SGSSSSKSSRRRNAMKKTLKNPAT mito(10.5),extr(10),cyto_mito(8.5),cyto(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZ26 Uncharacterized protein Low 6.9 1 99-120 YVAPPLRATKSRRKPRQQPVQA extr(7),mito(6),nucl(5),plas(4),cyto_nucl(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGN1 Rad21_Rec8_N domain-containing protein Low 7.2 1 345-367 MATASRQKKQNRRQTQAKKNAAF mito(18),nucl(6),cyto(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHQ0 Uncharacterized protein Low 5 1 82-103 LLSLVYKRWRERPQRPLKVWAF plas(21),E.R.(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLS5 Uncharacterized protein Low 8 1 250-278 AVGCFFFIRHRRRQARKRRASGHLHARWN extr(24),plas(2) RHRRRQARKRRA (258-269, prob:0.889) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQU1 PlsC domain-containing protein Low 5 1 702-727 VSSKIRDAMRQRGERRRRYSEDSSGF plas(18),E.R.(5),extr(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRX3 Uncharacterized protein Low 5 1 96-121 FHYDSFSKSTKKRRNQSCRTNERWTT extr(22),golg(2),plas(1),E.R.(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVE6 Altered inheritance of mitochondria protein 6 Low 8.9 1 88-115 LSATESQSRTPHKRRRKLRLFRCFLYPF plas(10),mito(6),cyto_nucl(3),nucl(2.5),cyto(2.5),extr(2),golg(2) HKRRRK (99-104, prob:0.718) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVQ9 FAD-binding FR-type domain-containing protein Low 8.8 1 824-848 EAMAAKAQKKARRAKRPRTEEASED plas(15),pero(3),nucl(2),extr(2),E.R.(2),cyto_pero(2) RKAKDKLTEKEEAMAAKAQKKARRAKRPR (813-841, prob:0.974) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0X8 RING-type domain-containing protein Low 5 1 711-734 STDGKDEDKSRPNQRKKAVFDCAI plas(24),extr(1),E.R.(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8J9 Atypical serine/threonine protein kinase BUD32 Low 6.3 1 100-122 RGNPGPQQSKTRCKKQNQPGLAA extr(9),cyto(7),cyto_nucl(6.5),nucl(4),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C902 Uncharacterized protein Low 7 2 119-140, 647-667 LIRLYWFRRRFRRAIRDAKALC, QGEWWWKRWLKRRTSISHLFS plas(21),E.R.(3),golg(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCP5 Rhomboid domain-containing protein Low 5 1 534-559 GSVWAFFYKKKERERRQQMGWFERMF plas(16),mito(6.5),cyto_mito(5),cyto(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFL0 AA_permease domain-containing protein Low 5 1 496-515 LFCGWKLLKRTRHVRPHEVD plas(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHA4 FHA domain-containing protein Low 7.7 1 84-104 SATWSSKKKPSRSIWPSSKSE cyto_nucl(11.833),nucl(11.5),cyto(11),cyto_mito(8.333) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHD8 Methyltranfer_dom domain-containing protein Low 9.8 2 6-28, 217-240 NPSPPVRKTTTEQRDRKRWETFY, SCWIRARLMRSRCRRRPGKGTGAC mito(12),nucl(9.5),cyto_nucl(7.5),cyto(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKN1 Uncharacterized protein Low 7.2 1 202-221 YAVERQRRPRREPEPRLCRS mito(18),nucl(6),cyto(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTG4 Probable lysosomal cobalamin transporter Low 8 1 906-940 GEEGEAPRRRTRNRGKKGKKAKKNQKKDAEDEGRL plas(20),extr(3),E.R.(2) PRRRTRNRGKKGKKAKKNQKK (912-932, prob:0.998) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUP0 Patatin-like phospholipase domain-containing protein ATEG_02594 Low 8.7 1 45-78 ALNDWRPVYQRVRKTRGRRKEPRRTKDETREGVL plas(19),nucl(2),cyto_mito(1),vacu(1),golg(1),E.R.(1),pero(1),cyto(1),mito(1),cyto_pero(1) VRKTRGRRKEPRRTK (56-70, prob:0.934) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZ95 Acyl_transf_3 domain-containing protein Low 7.5 2 27-47, 58-77 QWKSLLAQRTHPRRRMPSFSW, GPTNRDTNTNEKQRQRTRST plas(12),cyto(5.5),mito(4),cyto_nucl(4),pero(2),nucl(1.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9B1 DNA-directed DNA polymerase Low 8 1 939-961 KAEEEAARRKRNPNPHRRVDIII plas(23),E.R.(2) KGKGKAEEEAARRKRNPNPHR (935-955, prob:0.859) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGP3 Uncharacterized protein Low 9.4 1 68-88 PETGQRGRRRHACQSVRPLTG nucl(11),mito(6),cyto(4),plas(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKG5 Ppx-GppA domain-containing protein Low 5.8 1 536-560 EWTHTVEKSGKKKNWVRQYGIRVGG extr(10),cyto(6),mito(5),plas(3),nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPE3 Carbamoyl-phosphate synthase, mitochondrial Low 5 1 45-66 SSLRLQQKTPSPWRPQQLRSFS mito(16.5),cyto_mito(12.5),cyto(7.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQE4 Uncharacterized protein Low 8.9 1 276-299 YWNDRPQRFHTRRHADARRRPSAA nucl(14.5),cyto_nucl(10),mito(8),cyto(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CS07 MFS domain-containing protein Low 5 1 1-24 MKFSLPKKPHLKPKPESHFQNGAP plas(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTE4 Uncharacterized protein Low 8.6 2 2-29, 95-117 VLPHLFFARHKSSKKNKPSISEDQRPPS, RSSSTPSKPAKPSKSKSSPHPFS mito(14.5),cyto_mito(10.666),cyto_nucl(7.333),nucl(7),cyto(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CX39 Uncharacterized protein Low 5 1 1-21 MTNKARTVSKRRSKPALSVTT plas(23),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZT3 Uncharacterized protein Low 5 1 639-659 ILSELKSNNTKRHHRRAGHHA extr(24),mito(1),cyto(1),vacu(1),cyto_mito(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAY5 Uncharacterized protein Low 5 1 525-545 FFPPWIKRLAKGKKDFWREDD plas(24),mito(1),E.R.(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBU7 NACHT domain-containing protein Low 8.8 1 601-623 WEHVERRLKKARKQLYRRCRGLL nucl(14.5),cyto_nucl(11),cyto(6.5),pero(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFU3 Prenylated Rab acceptor 1 Low 9.1 1 467-492 TGTPSRKTPSRQSTHRGSRQRSNRPR mito(8),cyto(5.5),cyto_nucl(5),extr(4),nucl(3.5),plas(2),pero(2),E.R.(2) SRQRSNRPR (484-492, prob:0.628) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIW0 Uncharacterized protein Low 9.6 2 7-26, 39-62 EQDSAVKRGKRPQREPSGLN, IGPIHSLTSRKRRRRVIVDSDDDS nucl(8.5),cyto_nucl(7.5),cyto(5.5),plas(5),mito(3),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJY9 AMP-binding domain-containing protein Low 5 1 445-469 GGYASPPRGRDRRRCLRRLRRCTGD cyto(12.5),cyto_nucl(7.5),plas(5),mito(3),E.R.(3),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CK25 SSD domain-containing protein Low 5 1 276-300 LSSFFTYRERRYRKPERVRLLQDPA plas(17),extr(5),E.R.(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLB4 Zn(2)-C6 fungal-type domain-containing protein Low 9.8 1 33-58 VTTARACTSCRHRKIKCDGERPCEAC plas(13),nucl(12) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMH4 Protein SUR2 Low 5 1 388-409 PTDSNTRSRLRRKTATLSPRVD cyto(7.5),mito(7),cyto_nucl(5.5),plas(5),pero(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CR21 PLCXc domain-containing protein Low 6.8 1 13-38 STPITLKRIERFRPPQKPKDDMKSLA mito(10),cyto(7.5),nucl(6),cyto_pero(6),pero(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAD9 Protein PBN1 Low 5 1 447-468 LAARSSEPNTRKQKNQKRSKAE mito(8),cyto(8),cyto_mito(8),plas(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJ83 Uncharacterized protein Low 5 1 44-65 VAKFHERRIKRNVERRWHGHNT extr(11),mito(8),cyto(5),mito_nucl(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMK2 MFS domain-containing protein Low 5 1 26-49 FAHREFPRVPWWKRKNMRNLYIYI plas(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNI9 Uncharacterized protein Low 9 1 64-96 PAQSQSQSQRKARRSQRSKPSTKSTQTRKNTTV nucl(10),cyto(5),mito(3),plas(3),pero(2),golg(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNU2 Uncharacterized protein Low 8 1 428-450 YLVYLNKKHAKKRREMGKSAQIV plas(24),vacu(2) KKHAKKRR (434-441, prob:0.755) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPB6 Zn(2)-C6 fungal-type domain-containing protein Low 5 1 20-45 RFYSFTCKARHTRCDEKKPVCSNCER mito(23),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTP4 40S ribosomal protein S26 Low 9.7 1 81-116 GKIVRVRSREGRRNRAPPPRIRYNKDGKKLNPPQAA mito(14.5),mito_nucl(11),nucl(6.5),cyto(6) RVRSREGRRNRAPPPRIRYNKDGKKLNP (85-112, prob:0.946) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8K0 Zn(2)-C6 fungal-type domain-containing protein Low 6.9 1 1-30 MPQKCTLGPYDQRKKVRRCGNCASRKVKCV mito(11),cyto(6),nucl(5),cyto_pero(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9K6 HET domain-containing protein Low 9.2 1 398-427 KGQGRKHRTLLDSRRGRRRFDRSAPYRCAL plas(17),cyto_nucl(4),nucl(3.5),cyto(3.5) RRGRR (411-415, prob:0.645) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAS0 Glycogen [starch] synthase Low 7.6 1 564-588 FMYQFVQKSRRQRINQRNRTERLSD cyto_nucl(10),nucl(9),cyto(9),mito(5),plas(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBE9 Uncharacterized protein Low 8.7 1 246-270 TISYPSKQLKQIKRHSEKHHPISSD nucl(11),mito(4),cyto(3),plas(3),pero(3),golg(3),cyto_pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CF84 DNA helicase Low 9.9 1 208-230 NGETEKDPRRKTRNQQTDKLFSL nucl(19),cyto_nucl(13.5),cyto(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLL4 PALP domain-containing protein Low 8.7 1 349-369 AQATANKKRKRAQGRRDEGYG cyto(19),cyto_nucl(11.833),cyto_mito(11.833),nucl(3.5),mito(3.5) KKRKRAQG (355-362, prob:0.754) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CM33 Uncharacterized protein Low 9.9 1 588-608 ITYRWYRDSLHPRNTPRCRCG nucl(18.5),cyto_nucl(11.5),cyto(3.5),mito(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMQ0 Uncharacterized protein Low 8 1 719-746 AWSPPSEFKKHARKSWRRKDTTESEHDD mito(23),cyto(4) HARKS (729-733, prob:0.633) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMQ1 Exocyst complex component EXO84 Low 8.2 1 2-26 EARGLTLRSKTRRARPQISAPKPIS mito(13),nucl(10.5),cyto_nucl(7),cyto(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1M3 Uncharacterized protein Low 9.9 1 86-105 VPSRSRRKWRSAKVLVRNDE nucl(18.5),cyto_nucl(12),cyto(4.5),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1Z7 ORC_WH_C domain-containing protein Low 8.8 1 23-51 VYIYRPSKAQGERPSKRRKVQPDDEVDSE nucl(14.5),cyto_nucl(13),cyto(10.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8M3 Lovastatin nonaketide synthase, polyketide synthase component Low 5.7 1 2832-2854 MVAFRIKERSRKHKATPMQFYLA plas(16),E.R.(4),nucl(2),cyto(2),cyto_nucl(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8X8 Uncharacterized protein Low 7.1 1 4-24 QNTGRPFKKFVKLMRQRARTG mito(9),nucl(7),cyto(6.5),cyto_pero(6),pero(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C965 Uncharacterized protein Low 5 1 1-21 MWHCGRRRTWRSGCRGKQSIS plas(24),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCV8 Uncharacterized protein Low 7.4 1 178-200 ATNPLSKVRKWWKKRAAIQRMDS mito(15),nucl(6),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDB2 Exocyst complex component Sec8 Low 9.3 1 115-137 SWLAPESRKRSPPCRQERCEVLQ nucl(15.5),cyto_nucl(11),cyto(5.5),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDR0 Zn(2)-C6 fungal-type domain-containing protein Low 7.6 1 8-45 SKACIACRRRKIGCDQNPRGCRQCARSRKPCPGYRDYI mito(11),nucl(8.5),cyto_nucl(7.5),cyto(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CG52 Fatty acid hydroxylase domain-containing protein Low 6.1 1 298-318 HDLHHRKGWKKSSNYGKQTRL plas(9),mito(8),nucl(3),cyto(2),pero(2),golg(2),cyto_pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJ39 Uncharacterized protein Low 8.8 1 1-21 MPVRRGKNKYRQKAITDYFRA nucl(14.5),cyto_nucl(11),mito(8),cyto(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJ44 Zn(2)-C6 fungal-type domain-containing protein Low 8.6 1 58-102 VHDGHPPCRRCQRLNRQASCLLTDPRSSPLRPRKHQLRTPARSSP nucl(10),plas(6),mito_nucl(6),cyto(3),extr(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVJ2 Palmitoyltransferase Low 7.7 2 5-32, 128-151 AVSPPSSPSWPKRRPRAWALRCERYCCA, TGGSRFCKKCQVPKPDRAHHCSTC plas(12),mito(8),cyto(3),nucl(2),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVJ3 RHOMBOID-like protein Low 8 1 110-136 MEPPMGPNSRRKQRKGFFKKKIAWVTY plas(26) RRKQRKGFFKKK (119-130, prob:0.796) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CW78 Uncharacterized protein Low 9 1 748-770 ALDRAQKRARSLMRQKKCSRTKV nucl(13.5),cyto_nucl(10),cyto(5.5),mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWP4 Uncharacterized protein (Fragment) Low 7.4 1 1-27 MSPLNSTSTRKRGRPPKYQSAEERQAA mito(11),nucl(7.5),cyto_nucl(7),cyto(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXT6 Uncharacterized protein Low 5 1 673-692 LPGGNRKSRKPDPNSVHAVR mito(22),cyto(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7T6 Uncharacterized protein Low 5 1 63-86 LHTVMSQAVRRRRQRPPLKSVLAG plas(21),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9R6 Uncharacterized protein Low 9.1 1 1-29 MPRCNDPKCGCQPYPRKNRKVQVMLRGSQ nucl(13),cyto(6.5),cyto_mito(6.5),mito(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDV2 PKS_ER domain-containing protein Low 6.1 1 46-70 DYEGTSVHSKKKKERNRNSYNIVCI cyto(15),cyto_nucl(10.5),mito(6),nucl(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CEU6 Glyco_transf_28 domain-containing protein Low 7.8 1 635-657 HFSDRGHHRHRHHHHHRHPPEDY cyto_nucl(10),nucl(9.5),cyto(9.5),pero(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGU3 Zn(2)-C6 fungal-type domain-containing protein Low 8.4 1 6-39 EWSTLRLGRKPRSKTGCRTCRIRKVKCDEEKLPV nucl(11.5),cyto_nucl(9),mito(8),cyto(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CI97 SRR1 domain-containing protein Low 8.1 1 1-22 MPHTHRKKHPPPQKRLQVTDDA mito(14),nucl(8),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIL7 Uncharacterized protein Low 6.6 1 22-44 LSDDRRTQVRRAQRTYRLKKEAI mito(10),cyto(7.5),cyto_nucl(7),nucl(5.5),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLR1 Asparagine synthase (glutamine-hydrolyzing) Low 6.8 1 569-588 TDEIYKRKKKPYLGPTRFQE cyto(11),pero(6),cyto_mito(6),nucl(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMP0 Zn(2)-C6 fungal-type domain-containing protein Low 8 1 51-78 CQYTPSRRGYKGPSKKRRANPSSPEQTP cyto(8),plas(7),mito(4),extr(4),cyto_pero(4) RGYKGPSKKRR (58-68, prob:0.775) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNF4 FA_desaturase domain-containing protein Low 5 1 31-51 HQPPETSLRRRQKDETRPADE mito(8),cyto(5),plas(5),golg(4),pero(2),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPA7 Zn(2)-C6 fungal-type domain-containing protein Low 9.5 1 34-62 NSTACLPCKQAKRKCTGRPSPCKACQNTD nucl(15.5),cyto_nucl(10.5),cyto(4.5),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPN6 APH domain-containing protein Low 7.4 1 65-84 VRQFQHIKKQRPKIKAPDLF cyto_nucl(9),nucl(8.5),cyto(8.5),mito(6),extr(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZT4 Uncharacterized protein Low 7.8 1 217-239 LCLERRATPRKLKPIRSQPEEKE cyto_nucl(10.5),nucl(10),cyto(9),mito(4),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJA6 DAGKc domain-containing protein Low 5 1 33-59 RPECKPPLRWSSLRKSQKKEELHNFIP cyto(12.5),cyto_nucl(7.5),pero(6),cysk(4),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMY1 Uncharacterized protein Low 9.1 1 55-78 RDKRWYPYSTKRAKLKKGNFAQQA nucl(15.5),cyto_nucl(10.333),cyto(4),cyto_pero(3.333),mito(3),pero(1.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CS17 Uncharacterized protein Low 5 1 442-461 GWDTKKIQRWRETHQCEKPL extr(15),golg(7),plas(2),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTU3 Nonspecific lipid-transfer protein, mitochondrial Low 5 1 428-447 GESVRSKTRRHDHVLKDTVA mito(13),cyto(9),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAD1 Serine/threonine-protein phosphatase Low 9.6 1 623-648 RCSSSPRGTRSSRRKQRRRGASADGQ cyto(12),cyto_nucl(10),nucl(6),mito(4),pero(1),E.R.(1),golg(1),cysk(1),vacu(1) SPRGTRSSRRKQRRRGA (627-643, prob:0.937) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDZ0 Signal peptidase subunit 3 Low 8 1 134-159 PEKPNSRNSRAKKRTPPKNAKKDAAA extr(19),plas(4),mito(1),E.R.(1),golg(1),vacu(1) KPNSRNSRAKKRTPPKNAKKDAAAPG (136-161, prob:0.968) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGZ3 Dolichyldiphosphatase Low 8 1 206-231 TEAGWQRWEAKRKLRRRENSDYLAAK plas(21),E.R.(3),vacu(2) KRKLRR (216-221, prob:0.651) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJU1 PKS_ER domain-containing protein Low 5 1 39-61 LQVPSRNKHRTIKVHVYKPHVKD mito(13),extr(6),cyto(5),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNN2 Uncharacterized protein Low 8 1 276-298 RLPAKRPTMRPSRKERHGNEKVD plas(25) KRPTMRPSRKE (280-290, prob:0.666) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVZ3 Uncharacterized protein Low 6.1 1 299-320 PGTTTPRKLKWYKKKGGNLSTS plas(18),nucl(3),mito(2),cyto_nucl(2),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CX74 ABC1 domain-containing protein Low 5 1 217-237 GKPTPAKTYHRTRKWLRRLVY extr(10),mito(7.5),cyto_mito(5.5),pero(3),cyto(2.5),plas(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8R9 Uncharacterized protein Low 7.4 1 5-24 KFRSRFQVWREHKGRRRSAS mito(12),nucl(7.5),cyto_nucl(5.5),pero(4),cyto(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CA76 Uncharacterized protein Low 5 1 360-385 VRTPRPRLCNVRSTNRPRSSRPPARA plas(18),vacu(4),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAI2 Uncharacterized protein Low 5 1 1-20 MESQRLPKHHERESRLTKFR plas(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAX8 Uncharacterized protein Low 5.8 1 537-556 DVARKWKKRLGQRVPGKWTT mito(14.5),cyto_mito(11.499),cyto(7),cyto_nucl(6.666),cyto_pero(4.499),nucl(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CH90 Uncharacterized protein Low 6.1 1 468-489 VREIKVTKPEPKPKEEKPKTED cyto(20),cyto_nucl(14),nucl(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRK7 Endoglucanase 3 Low 5.4 1 47-67 GVYVCPKPRRRLYDTNPRFCS extr(23),nucl(1),mito(1),plas(1),golg(1),mito_nucl(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CV50 Carrier domain-containing protein Low 7.4 2 57-78, 1670-1690 NPKEVFRRLRSHSKTKDHPLLH, TSTRTHYPSGRERSRKQSPGS plas(22),E.R.(2),nucl(1),golg(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZR4 alpha-1,2-Mannosidase Low 5.8 1 1-29 MSSKAASRSQKRPQRKDTKNSGSRPLPRL mito(20),nucl(2),plas(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBT7 Uncharacterized protein Low 9.8 1 18-41 YMNLSKIRKTHRADKNRETIKRCE nucl(12),mito(4),cyto(3),pero(3),cyto_pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJ86 Uncharacterized protein Low 7.2 1 285-305 GEPNQEPKLRRKDLPRRGSNT mito(17),nucl(6),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNW6 Uncharacterized protein Low 9.9 1 99-126 RDIRTSKGVREKAKKRGRGKEAARMTRK mito(12.5),cyto_mito(9.166),nucl(8),cyto_nucl(7.333),cyto(4.5) SKGVREKAKKRGRGKEAARMTRKAK (104-128, prob:0.992) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CT46 Uncharacterized protein Low 5 1 2-28 ALLFIKQKFFPDKKKNPSLNDYRKPLL plas(15),E.R.(5),cyto(4),mito(2),cyto_nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1N1 Cysteine synthase 2 Low 5 1 31-51 LEQRLREYRARRRSQSNGADS extr(16),plas(3),mito(2),cyto(2),E.R.(2),cyto_mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9Z8 Reverse transcriptase domain-containing protein Low 7.9 1 11-36 YKDARNHKTRLVRKILRNGHRQRVQE nucl(10.5),cyto_nucl(9.5),cyto(7.5),mito(5),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCQ4 Phosphatidyl-N-methylethanolamine N-methyltransferase Low 8 1 183-203 AEIYAKRERERAKSKKGGKRQ plas(19),E.R.(3),vacu(3) KRERERAKSKKGGKRQ (188-203, prob:0.972) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDT2 Uncharacterized protein Low 8.4 1 42-65 AKLTALCRKYYDRKAKKTSTLSVG nucl(14.5),mito_nucl(10.333),cyto(6.5),cyto_mito(6.333),mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CF04 Adaptin_N domain-containing protein Low 8 1 247-268 TFYARRCFPRKTQKVKQAVSKG cyto_nucl(13),nucl(12),cyto(10),mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFB7 Chloride channel protein Low 5 1 804-824 IQWVGSKVPRFRRENRPSLPD plas(22),E.R.(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMK0 Uncharacterized protein Low 5 1 1-26 MTPRKLEKLHGRPPRRHRLLCAPFNL plas(20),E.R.(3),mito(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSC3 Uncharacterized protein Low 8.3 1 1081-1107 AGERTTPGGNKKPLRKRLRRWIIGIIH plas(21),cyto_mito(1),vacu(1),golg(1),E.R.(1),cyto_nucl(1),cyto(1),mito(1),nucl(1),mito_nucl(1) NKKPLRKRLRR (1090-1100, prob:0.834) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSJ1 Uncharacterized protein Low 8.5 1 194-215 RGVWAWRKRNGIKPPRPIEEEK nucl(14.5),cyto_nucl(11.333),cyto(7),cyto_pero(4.833),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7D8 AAA domain-containing protein Low 9.1 1 20-42 DESQSERTKRVPSKPNKHDLDQP nucl(13.5),mito(11),cyto_nucl(8.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7V2 Uncharacterized protein Low 6.9 1 70-89 IVLQPFYQRRKENKNQRDEE nucl(5.5),mito(5),cyto_nucl(4.5),pero(4),E.R.(4),golg(3),cyto(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7Z4 Uncharacterized protein Low 6.9 1 554-587 QFLRRGWGRFWKGCRCSRRHMKAERYNKDPNRII cyto(8),cyto_nucl(8),nucl(6),mito(5),plas(3),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAP8 Zn(2)-C6 fungal-type domain-containing protein Low 8.4 1 36-71 VDAIIRTKRKAREPKACYPCHARKVKCDRNLPCDGC nucl(12.5),cyto_nucl(9.5),cyto(5.5),mito(5),plas(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGC1 Uncharacterized protein Low 9.3 1 1-20 MPGERRQRGRKGIARRIRGI mito(19),nucl(4),cyto(4),cyto_nucl(4) RRQRGRKGIARRIRGIE (5-21, prob:0.892) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGL0 MFS domain-containing protein Low 5 1 450-473 YGLMWVYYRRKNERRARGLEDEKV plas(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CM00 Uncharacterized protein Low 5.3 1 571-591 AIIICCWRRHKSRGKLDESSL extr(17),plas(7),nucl(1),mito(1),cyto(1),cyto_nucl(1),cyto_mito(1),mito_nucl(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNY6 Calcium-transporting ATPase Low 8 1 1171-1193 ATRPVKRAAKRVFGKRTPKAESH plas(26) KRAAKRVFGKR (1176-1186, prob:0.711) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPJ1 Mitochondrial genome maintenance protein MGM101 Low 5 1 253-273 EHVVNKRKSKIWVRKDDQVSY mito(22),cyto(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CR75 Ubiquitin Low 8.8 1 386-422 EKSICRKCYARLPPRATNCRKKKCGHTNQLRPKKKLK mito(12),cyto(11),nucl(2) RPKKKLK (416-422, prob:0.805) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CR96 HECT domain-containing protein Low 6.5 1 62-89 NASRIIQRTWRGYRCRRTVRQTFRTEWD plas(12),mito(8),nucl(4),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRM9 Uncharacterized protein Low 7.2 1 131-156 AQLMPTKRWICRKRKNPKPSSFTTTT mito(16),nucl(6),cyto(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTT0 alpha-1,2-Mannosidase Low 9.5 1 63-86 KDKPYFAPRRTGPRLRRRRAVYGV plas(12),nucl(4),mito(4),mito_nucl(4),cyto(3) RTGPRLRRR (72-80, prob:0.7) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUZ6 Longevity-assurance protein 1 Low 8 1 42-70 QVAPSRSSSKSQSKRRKSRSLLRRFKDNC plas(23),mito(3) SKRRKSRS (54-61, prob:0.773) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7G2 Dimer_Tnp_hAT domain-containing protein Low 9.9 1 276-295 MTKIEQKRRIWKKQIYRGLQ nucl(19.5),cyto_nucl(13.5),cyto(6.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CB17 Delta(14)-sterol reductase Low 5 1 357-376 GEDWKTYKRTVRWRILPWIY plas(23),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CE59 Peptidase A1 domain-containing protein Low 5 1 481-504 VAAVWIVLRRRRRRPDAENETPVE extr(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJ82 Uncharacterized protein Low 9.8 1 149-170 NTSVESRRQNAKRRKIQPFSVE nucl(13),mito(10),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CK64 Uncharacterized protein Low 8.1 1 167-186 ISEKSKPRIREKQPASKPTP nucl(11),cyto_nucl(11),cyto(9),pero(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTZ5 Uncharacterized protein Low 8 1 4-29 RVPEANKRQLRGKRHKVDKMRLACAL extr(11),mito(8),E.R.(4),cyto_mito(4),mito_nucl(4) RGKR (14-17, prob:0.626) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZM9 Zn(2)-C6 fungal-type domain-containing protein Low 8.4 1 43-80 QDQRVFRVKRKHVLKACDRCRVKKTKCDGKQPCNRCSA nucl(12.5),mito_nucl(12.5),mito(11.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8F1 Cell division cycle protein 48 Low 9.7 1 28-49 LDTSTAILKKKKKPNSLIVTDA nucl(18),cyto_nucl(13.5),cyto(7) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8J6 Calcium-transporting ATPase Low 5 1 1136-1157 RPLSRGMRRLWSRKENDPDKSD plas(24),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CD38 Uncharacterized protein Low 8.2 1 1-24 MPTSKKPSKKMPLRDRFRRFLGGS nucl(9),plas(7),mito(4),cyto(2),pero(2),golg(2),cyto_pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFP5 Uncharacterized protein Low 8 1 705-727 TPAEDEKAKKKKKKSKDTDAFAV plas(17),E.R.(7),mito(1),pero(1),vacu(1) KAKKKKKKSK (711-720, prob:0.952) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGF1 Uncharacterized protein Low 5 1 52-78 EDEKFPYDSRRPPYKRRRWQVGMSMFV plas(21),E.R.(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CL35 AA_permease domain-containing protein Low 5 1 69-88 KPVYDHTHRKLKPRHIQLIG plas(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CL72 Uncharacterized protein Low 8 1 136-162 DPVPNEHLRRPRRRSRAKSNVLHREKE plas(18),mito(4),E.R.(2),vacu(2),cyto_mito(2),mito_nucl(2) RRPRRRSRAKSN (144-155, prob:0.895) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNB6 N2227 domain-containing protein Low 5 1 92-113 VEVKRWRDWYKQIPKRQRSMVE extr(11),plas(6),E.R.(4),mito(2),cyto(2),cyto_mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQQ5 Uncharacterized protein Low 9.9 1 133-155 SKLSPKHQFRLERKYRRRAALKF mito(14.5),cyto_mito(9.666),nucl(8),cyto_nucl(6.833),cyto(3.5) PKHQFRLERKYRRRAALKFARPKWT (137-161, prob:0.907) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CR00 MFS domain-containing protein Low 5 1 476-496 EWDVRRIRRLRIKEMKQGRVY plas(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CV59 Sulfite reductase beta subunit Low 6.9 1 1236-1255 QRDFGDRKNRKHARLKYTID cyto(12.5),cyto_nucl(10),nucl(6.5),pero(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWD2 Serine/threonine-protein kinase Tel1 Low 6.4 1 2525-2544 MPAHQRYYPKDMKPNVCRKH plas(11),cyto(5.5),cyto_nucl(5.5),nucl(4.5),E.R.(2),mito(1),extr(1),pero(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1V2 Protein phosphatase Low 7.3 1 24-48 ITSPSTPRTPGLRRKRRPDSGEDAF extr(13),nucl(6),mito(4),cyto(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C844 Uncharacterized protein Low 7.1 1 31-55 DNTYRDRIEQRKELRRKYRHLVMDS cyto(10.5),cyto_pero(7.5),nucl(7),mito(5),pero(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGX2 Uncharacterized protein Low 7.2 1 189-209 DCNQCDPRKMVKRSRRQNGRA cyto(11),nucl(8),cysk(6),cyto_mito(6),cyto_pero(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIF0 Aa_trans domain-containing protein Low 5 1 404-426 ESGILRRSTRHWRRTLLRKLSLA plas(22),mito(2),golg(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKH1 E3 ubiquitin-protein ligase Low 7.5 1 2024-2043 EEANRRRCPNSKKELTDPSI nucl(8.5),cyto_nucl(7.5),cyto(5.5),plas(5),mito(3),pero(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKU6 Uncharacterized protein Low 8 1 226-251 IYWHKAGEARKRERKMRERKEVVGSE mito(13),plas(5),cyto(3),extr(2),cyto_nucl(2),cyto_pero(2) EARKRERKMRERK (233-245, prob:0.872) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CR06 Uncharacterized protein Low 6.9 1 97-120 EVSCICSRLKRLRKLKLNGNRFCS cyto(13),cyto_nucl(11.333),cyto_mito(8.833),nucl(8.5),mito(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWT1 Meiotic recombination protein DMC1 Low 9.2 1 564-607 LEDFYRFQSREKRKMRQNELLKRFDEDKKRLEELKRRKGKLRPE mito(15),cyto(8),nucl(3) KRKMRQNELLKRFDEDKKRLEELKRRKGKLRPE (575-607, prob:0.971) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYD7 Uncharacterized protein Low 7.4 1 145-166 EDERQRQEQMPRNPKKRVMEAK cyto_nucl(12.833),cyto(11),nucl(10.5),mito_nucl(7.332),mito(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0T1 Heat shock protein Hsp88 Low 9.1 1 523-548 DATNGEQPKKTRKVKKQVRKGDLPIS cyto(20),cyto_nucl(13.333),cyto_mito(10.833),nucl(5.5) KKTRKVKKQVR (531-541, prob:0.772) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7D9 ELMO domain-containing protein Low 8.3 1 241-263 DDPNDVRRSKRHNPEKWRRLGFE nucl(11.5),cyto_nucl(10),cyto(7.5),pero(3),cysk(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CA08 Cation-transporting ATPase Low 8 1 1295-1321 GHIKTRLQPGRGKKRRQYKVLLEEMRP plas(24),E.R.(1),golg(1),vacu(1) LQPGRGKKRR (1301-1310, prob:0.803) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCW2 Alpha-glucosidase Low 5 1 942-962 KFNGRPVHRRHIHFDKPKQTL extr(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFQ8 Acid trehalase Low 8 1 475-497 QLPRRETRPGRRQHRHCLRQFQE extr(23),mito(2),pero(2) RGRAGRHQLPRRETRPGRRQ (468-487, prob:0.817) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJY2 Protein dopey Low 6.5 1 970-991 YLPPPPPRPKHQRNSSRERLTS cyto(7),cyto_nucl(7),nucl(5),mito(4),plas(3),pero(3),extr(2),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMY9 Uncharacterized protein Low 5 1 1-24 MEWASKWSSAKRRRRTAVFRILLL extr(9),plas(7),golg(5),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C826 Chitinase Low 5 1 1042-1065 GAGHVPCRKLYRKKLNYPLKASDD extr(23),plas(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C996 HET domain-containing protein Low 8.6 1 713-735 ASSSHNSTLHRRQRRPRSSSSDY mito(12),nucl(9),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9U7 Carboxypeptidase Low 5 1 39-58 RTAPPVKKSHHQSHDHFRFL extr(20),mito(2),vacu(2),cyto(1),pero(1),golg(1),mito_nucl(1),cyto_pero(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CG12 Uncharacterized protein Low 9.1 1 812-835 VDLCGDCARKQRRPWQPRLLFTSS nucl(15.5),cyto_nucl(13),cyto(7.5),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHQ2 WD_REPEATS_REGION domain-containing protein Low 6.9 1 1-22 MPKTAVKQKSRQKPNPFQKAGL mito(16),nucl(5.5),cyto_nucl(4),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJU2 Zn(2)-C6 fungal-type domain-containing protein Low 9.4 1 33-58 PKQVPCTYLKPARRRGPKIRRVAASE mito(19),nucl(4.5),cyto_nucl(4.5),cyto(3.5) KPARRRGPKIRRVAASENNAGRMRRR (42-67, prob:0.906) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKQ4 ANK_REP_REGION domain-containing protein Low 5.8 1 675-695 VDWCLEMKRKKKDIIKILSDA cyto(15),mito(5),pero(3),nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CM15 Dipeptidyl-peptidase IV Low 9.4 1 958-985 QAQQREKQLVRRKRAQRREQAARRREER extr(16),nucl(4),cyto(4),cyto_nucl(4) RLRRREERRAKAARAQRQAQQREKQLVRRKRAQRREQAARRREERR (941-986, prob:0.992) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDE1 AP_endonuc_2 domain-containing protein Low 5 1 22-48 AAAPTKPTFFQRWKRHMKKWWWAYLIG plas(19),mito(3),E.R.(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDX8 Uncharacterized protein Low 8 1 509-528 IKSIQKHVQDHKARHKWLKG cyto(17),cyto_nucl(10),mito(6) LRRLLRDQEKEARRRAG (545-561, prob:0.722) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHG4 Palmitoyltransferase Low 5 1 453-481 VSCMVRKPLRSKHCKRCGRCVAKHDHHCP plas(24),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJH3 Ribosome assembly factor mrt4 Low 9.4 1 10-31 VHESKTAKKSHKEQTRRLYANI nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CK30 Fungal_trans domain-containing protein Low 9.2 1 1-27 MPCTFTRVTRRKRKEKSHAIPEQRASG plas(19),mito(4),nucl(3) RRKRKEK (10-16, prob:0.729) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPF0 Uncharacterized protein Low 9.4 1 32-55 ENGVYHGYKPRKRARQNATDLKEE cyto(14),cyto_nucl(10.5),nucl(5),cysk(5) PQGRGRGQAAGRGQAPGRGGARGNSQRGGAPRGRGQPSNR (556-595, prob:0.897) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPQ8 Cytochrome b561 domain-containing protein Low 5 1 372-399 VAYAWVMRQKQRRKRQQHQPQLVAKDEH plas(21),extr(3),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPS7 3'-5' exonuclease domain-containing protein Low 8.6 1 68-89 AGSPRPKPSTQSTRKPNRLLST nucl(13),cyto_nucl(9),mito(8),cyto(3),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CV20 Importin N-terminal domain-containing protein Low 9.6 1 862-903 VNFAGCWWRSWRRRRAARRLMRRRRRRWRKKAATTTTSGRTC plas(7),cyto_nucl(5),nucl(4.5),cyto(4.5),mito(4),E.R.(4) WRRRRAARRLMRRRRRRWRKKA (872-893, prob:0.999) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D090 Uncharacterized protein Low 5 1 666-687 LAYPTFRKKRHNTFERTHRFLG plas(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D198 RRM domain-containing protein Low 9.5 1 40-63 NEQITAQQLKKKRKQQTNSDEVSQ nucl(14.5),cyto(10),mito_nucl(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1Z6 Uncharacterized protein Low 7.3 1 656-679 GVPAGTPKRRLRRLSTTPKSKENI cyto(7),cysk(7),nucl(6),cyto_pero(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7F6 Uncharacterized protein Low 8 1 216-239 LSQALRRAKNRWRRRNLRAEDTTE plas(15),mito(7),E.R.(3) AKNRWRR (223-229, prob:0.644) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9D6 Uncharacterized protein Low 8 1 147-170 ADTPAAESKRQKKMEKRGNRVQYR mito(20),extr(5) RQKKMEKR (156-163, prob:0.66) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CF73 Non-reducing polyketide synthase ATEG_07661 Low 8.7 1 1721-1745 VKASRTTKKKAKASKSKSSVKKDKA plas(18),E.R.(4),nucl(2),mito(1),cyto_nucl(1),golg(1),vacu(1) SRTTKKKAKASKSKSSVKKDKA (1724-1745, prob:0.96) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGR4 Uncharacterized protein Low 5 1 420-439 VNCLRGRKTLPDRKWRLPAI plas(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKE8 ANK_REP_REGION domain-containing protein Low 8.5 2 104-129, 742-765 ASARDIWRQRCNRGNPKKQLRTTVHW, EFYQVLRSRRGRRRLFVTEKRYLG cyto(10),mito(6),nucl(4),pero(4),cysk(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNH8 DUF2235 domain-containing protein Low 9.1 1 243-271 ISESRPWTEKKRAHRWKRHMPHHMPHHHN cysk(21),nucl(3),cyto(2),mito_nucl(2) KKRAHRWKR (252-260, prob:0.76) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPC7 Uncharacterized protein Low 8 1 825-849 TLTWESGNQKNRRRRSCPKGICDAD nucl(13.5),cyto_nucl(11.166),cyto(7.5),cyto_pero(5.666),cyto_mito(5.166),pero(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CX72 Uncharacterized protein Low 9.7 1 36-55 RPNVNRAKTKRWVEAKKYSY nucl(17.5),cyto_nucl(12.5),cyto(4.5),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXB0 Uncharacterized protein Low 5 1 39-63 LLYAGVKRLRQYRKTKSRLETLSPK plas(24),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CY11 Very-long-chain 3-oxoacyl-CoA reductase Low 8 1 332-353 MHESIRKRALRKAEREKGKKST mito(13),plas(9),extr(3) RKRALRKAEREKGKKST (337-353, prob:0.946) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CY27 Probable arabinan endo-1,5-alpha-L-arabinosidase B Low 5 1 257-276 FSWGKCCKYNPKALPPRGKE extr(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D000 alpha-1,2-Mannosidase Low 5 1 90-110 AESWWTRRTRVKRQEAVKAAF golg(9),E.R.(7),mito(3),plas(3),extr(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLD4 t-SNARE coiled-coil homology domain-containing protein Low 7.4 1 234-253 NVELRSASRHQKNARNKACC cyto_nucl(10),nucl(8.5),cyto(8.5),mito(4),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNN8 Uncharacterized protein Low 7.4 1 11-31 GPAKKAKTGSSTKRNQRWSSV mito(16.5),cyto_mito(9),nucl(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSZ6 Uncharacterized protein Low 9.6 1 142-164 MDGSRAPRRTPRKQLNRPSRLVR nucl(16),cyto_nucl(10.5),mito(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUL8 Uncharacterized protein Low 5 1 294-320 MHNFHKGLKPHVNKKKADKEAEKTTEL plas(16),E.R.(5),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZT1 Cytochrome b5 heme-binding domain-containing protein Low 8.3 2 429-448, 454-477 GTDATKKYRKYHSDKALARY, TGVVEPSKQQKPKKSFLSRFRRGG cyto(13),cyto_nucl(11),nucl(5),mito(5),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CB40 Zn(2)-C6 fungal-type domain-containing protein Low 9.6 2 36-67, 101-124 NQTSRQVRSCKVCRLRKVKCDRVKPCHACCAH, DLTARLNDREHRNRNRHQWQLAKL nucl(11),cyto_nucl(10.833),cyto(9.5),mito_nucl(7.333),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIZ0 Purine permease Low 5 1 8-27 GPDFRPKRTLADQARRIKKT plas(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKG7 Endo/exonuclease/phosphatase domain-containing protein Low 5 1 343-362 HSYVRRERSQRRWRLTHFLL cyto(10.5),plas(9),cyto_nucl(6),mito(3),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNN5 Uncharacterized protein Low 9.9 1 305-342 DETQREREARRARRAVRERARDERRKKIEELRSKRRAE mito(18.5),mito_nucl(13.5),nucl(7.5) EREARRARRAVRERARDERRKKIEELRSKRR (310-340, prob:0.988) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7Z8 Uncharacterized protein Low 5.8 1 521-547 VYERWRQIVCSKPKPRWKFVQPNTFVN cyto(15),cysk(9),nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C858 Uncharacterized protein Low 7.1 1 578-597 ISNYPTRKSRDKNCLGQDLE cyto(7.5),cyto_nucl(7.5),nucl(6.5),E.R.(3),golg(3),mito(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9U5 Serine/threonine-protein kinase srk1 Low 8.7 1 484-510 GYAVHRQEEENKRRKNQRNYPGTNPTA nucl(13),cyto_nucl(9.5),mito(9),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCE8 Fe2OG dioxygenase domain-containing protein Low 8 1 1-23 MAKSKSAKRKRNAPDDHPQKLPK mito(18),cyto(7) SAKRKR (6-11, prob:0.681) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCW7 Uncharacterized protein Low 9.8 1 96-118 ALARAHRKPRTPRRVGKRGSGCK mito(8),cyto(6.5),cyto_nucl(6.5),nucl(5.5),extr(4) RAHRKPRTPRRVGKRGSGCKAPPAGRR (99-125, prob:0.966) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CL32 Fungal_trans domain-containing protein Low 5 1 1-21 MPARVPKPRVRHPRFHGPISS mito(16),cyto(4),plas(4),pero(1),E.R.(1),golg(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLS9 Uncharacterized protein Low 6 1 85-108 SEPPNEYKIRRRPNTARYKSPAKQ mito(14),cyto(9.5),cyto_nucl(8),nucl(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMY8 Fungal_trans domain-containing protein Low 8.6 1 18-45 MLSQFRASKRTTVRKKFSKPPVKLACLS nucl(13.5),cyto_nucl(11),cyto(7.5),mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPL7 Uncharacterized protein Low 5.8 1 32-57 TWLAHPPTRGRRYRRLNYPRRADGRD mito(21),nucl(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQX3 2-oxoglutarate dehydrogenase E1 component, mitochondrial Low 5 1 861-880 LFHILRRQIHRQFRKPLVIF mito(23),cyto(2.5),cyto_nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSN0 Uncharacterized protein Low 5 1 20-39 RTPKLISKRSTRIQPFRSFS mito(24),cyto(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUY2 Uncharacterized protein Low 9.6 1 31-53 GPPTGKCYRKEYCRAPNDKRLSS extr(12),nucl(4),mito(3),E.R.(3),golg(3) KKKPDNGGNKDPDKKKPDNGGNKDPDEKKPDNGGNKDPDKKPDDKK (113-158, prob:0.877) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZ77 AA_permease domain-containing protein Low 5 1 539-561 FRNNPEPEPKPKRGIRRLNILWS plas(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7W5 Uncharacterized protein Low 5.3 1 19-39 PQPDQPQRKSYGRRTQQTGAS plas(21),E.R.(2),nucl(1),mito(1),cyto(1),cyto_nucl(1),vacu(1),cyto_mito(1),mito_nucl(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGD7 Zn(2)-C6 fungal-type domain-containing protein Low 8.4 1 1-28 MARHQKVVCSSCRRRKTKCDGASPSCSA nucl(11.5),mito(11),cyto_nucl(8),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHM8 TRP_N domain-containing protein Low 8 1 605-627 CVRENPHARRRREAKKMGRDIDD plas(21),extr(2),E.R.(2) RRRREAKK (613-620, prob:0.739) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CK01 Tr-type G domain-containing protein Low 7.2 1 115-137 LSSSSKPQTRSPQSRQQRLQQLT cyto(14.5),cyto_nucl(13),nucl(8.5),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CL11 Ubiquitin carboxyl-terminal hydrolase Low 7.5 1 66-91 HPLVLNIKRSRKKVQRDEPPQKISKL nucl(9),cyto_nucl(9),cyto(7),pero(6),mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMC1 Uncharacterized protein Low 7.5 1 60-83 SDDSSRLKSKWKSQWNGKIKNEVI mito(10),nucl(8.5),cyto_nucl(8.5),cyto(7.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CP37 Uncharacterized protein Low 9.9 1 992-1018 VGGLLYRKRKEAKRRMKAQQSASLDRN mito(15.5),cyto_mito(10),nucl(7),cyto(3.5) RKRKEAKRRMK (998-1008, prob:0.851) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQA4 Non-specific serine/threonine protein kinase Low 9.8 1 557-577 GPDLWKRKAPRLKAYVPPPRE nucl(15),cyto(8),mito_nucl(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTK5 MFS domain-containing protein Low 8 1 544-564 QEDKRRLEGKRKRLLERLQGA plas(26) KRRLEGKRKR (547-556, prob:0.722) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CU75 Uncharacterized protein Low 7 2 47-77, 90-110 LQSDRPRKPPVTRRMSSKRQPHKGQEFSTED, QAANPQRSPRIRPMRNNSSTL plas(24),mito(1),cyto(1),E.R.(1),cyto_mito(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWZ1 Zn(2)-C6 fungal-type domain-containing protein Low 9.2 1 8-47 QSNGHPPRRTRQNPVSCRLCRLKKLKCNRQRPCSNCSARG nucl(11),plas(7),mito(6),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7G0 WD_REPEATS_REGION domain-containing protein Low 5.7 1 86-106 LKEKIDPKKAQTQMRKWGFRA extr(14),cyto(3),nucl(2),mito(2),pero(2),E.R.(2),mito_nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C984 Uncharacterized protein Low 9.6 1 308-331 AENSDDSSRQPRQRRQLQMPQRRR nucl(16.5),cyto_nucl(11),cyto(4.5),mito(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAS5 Uncharacterized protein Low 7.3 1 124-146 IKTPKVPKSSTPQKGKKRSSGVT cyto_nucl(9.5),cyto(9),nucl(8),pero(5),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDP1 Uncharacterized protein Low 5 1 245-264 APKRKGRKWCGLFSRRSQNR plas(20),mito(2),E.R.(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CK23 Uncharacterized protein Low 5 1 512-532 MVKFGKPLRARSREKYWKLVE plas(22),mito(2),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVD8 RNase_PH domain-containing protein Low 5 1 26-46 VPGAATRPQRQRQPNELRKIF mito(20),cyto(4),extr(2),cyto_nucl(2),cyto_pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D144 14_3_3 domain-containing protein Low 7.4 1 51-73 MLSKKLLRARRLRRLDPTRETKS cyto(15),cyto_nucl(13),nucl(9) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CA87 HTH araC/xylS-type domain-containing protein Low 6.1 1 76-98 TAGFRPCKRCRPQTLRPENPQVQ mito(19),nucl(3),cyto(3),cyto_nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CH20 Uncharacterized protein Low 6.8 1 19-44 VGALLILRRKRQNRKRSELPVHNGEC extr(6),nucl(5.5),cyto_nucl(5),mito(4),cyto(3.5),plas(3),E.R.(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJT6 Protein kinase domain-containing protein Low 8.1 1 30-51 VIYASRKLKKTRQHGRPTLCDF cyto(10),nucl(9),cysk(5),mito_nucl(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKX2 Uncharacterized protein Low 9.8 1 3-33 DYERRNHGYRGGRKRRYREDDDYDRRQRRRY cyto(11),cyto_nucl(9.5),nucl(6),mito(4),plas(3) K (16-16, prob:0.604) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSP8 Mtf2 domain-containing protein Low 6.6 1 60-79 DSVLKDMKRRRGRAASKTVD cyto(15),cyto_nucl(12.5),nucl(6),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CT05 KEX1 protease Low 7 2 111-138, 752-777 GILWSQKLAPRKRLQKRIPPPNNQIRDP, ALGVYFQVVRRRRKRNDPRDDYDFEM extr(15),plas(7),mito(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXA7 Uncharacterized protein Low 5 1 1-24 MERPEKHVRNRRCLQSRRSRIILA extr(18),E.R.(2),golg(2),cyto_mito(1),vacu(1),pero(1),plas(1),cyto(1),mito(1),cyto_pero(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZF8 Uncharacterized protein Low 7.1 1 1-31 MPPRRSHTKSRNGCDQCKKRRVKVSSLLARS mito(17),nucl(6.5),cyto_nucl(5),cyto(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7S0 Uncharacterized protein Low 6.2 1 536-555 LYVRAERRTKWPVKSRSASP cyto(13.5),cyto_mito(9),pero(6),nucl(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C812 Mitochondrial escape protein 2 Low 7 2 1094-1113, 1126-1153 LPPCRAPSRRYAEARFRPKG, RETGQTMRPKAKKYQRRQPPRLFWNVTP mito(14),cyto(10.5),cyto_nucl(6.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CEH8 MFS domain-containing protein Low 5 1 485-509 AVIFLRFYLKHQNKKKERLLREAGM plas(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJ72 MYND-type zinc finger protein samB Low 5 1 86-105 FYLTKTQSHNKQPQDTKNNA cysk(15),cyto(6),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNG1 Uncharacterized protein Low 9.4 1 826-848 IEKVLMKRWTRHRYIRPDESTSK cyto(13.5),cyto_nucl(12.333),cyto_mito(10.332),nucl(7),mito(5.5) KAKKAIAAKR (555-564, prob:0.702) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRR0 Aamy domain-containing protein Low 6.6 1 447-470 LVKVRLDFPQRQKQVRKNIDCTAF cyto(9),cyto_nucl(8.333),cyto_pero(7.833),nucl(6.5),pero(5.5),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTE9 Sec39 domain-containing protein Low 8.9 2 219-242, 820-839 GPWMFGSNRPKRRRLNQTAQQTSI, AFETKQRHARRARAQQSRVD cyto(7.5),cyto_nucl(7.5),nucl(6.5),extr(5),mito(4),plas(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D065 Fibronectin type-III domain-containing protein Low 6 1 912-933 IFGSRKSDKDKEKDKGKDRDLD extr(11),golg(4),nucl(3),E.R.(3),vacu(3),cyto_mito(1),pero(1),cyto(1),mito(1),cyto_pero(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0E0 General transcription and DNA repair factor IIH helicase subunit XPD Low 8 1 678-698 LADRRFQKKRSQLPKWISQAM nucl(10.5),cyto_nucl(10.5),cyto(9.5),cysk(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7U3 Uncharacterized protein Low 5 1 399-419 ACINHRFKGSWKKGWRRYISG extr(10),mito(6),golg(5),plas(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8Q8 Uncharacterized protein Low 9.5 1 136-162 QKIKEKAERIVQRKKPRNQRVRLDDTI E.R.(6),extr(5),golg(5),nucl(4),plas(3),cyto_nucl(3) QRKKPR (147-152, prob:0.674) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C916 Histone deacetylase Low 9 2 684-710, 739-760 HGVWNPETNRHKKPSKRYGNLIQSPKE, TEEERPTSRSPKKEQARNQLGS cyto(17.5),cyto_nucl(13),nucl(7.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CA96 Ribosomal_L5_C domain-containing protein Low 8 1 67-94 KSFDPASKAKGRKKQLPRSRFRSPKYDR mito(22.5),cyto_mito(13),cyto(2.5) SKAKGRKKQLPRSRFRSPKYDRG (73-95, prob:0.951) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGB5 Fungal_trans domain-containing protein Low 7.4 1 2-21 ADMRRKFAMKRKIDRLEQAE mito(9),nucl(6),cyto(5),golg(3),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGU5 MFS domain-containing protein Low 5 1 467-488 GFYLRWENSRRDRKYPRSGESI plas(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNX2 Uncharacterized protein Low 5 1 9-30 PPSSSHSHRRPWQTHSNRTPSH plas(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPG9 Dihydroxy-acid dehydratase Low 5 1 556-578 TEELEKRRKEWKAPPLRYQKGTL mito(22),cyto(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSD1 Uncharacterized protein Low 6.3 1 40-63 VTYHGVYKSRKLRRRQVEESVEFH cyto(13),cyto_nucl(9.833),cyto_pero(8.333),mito(6),nucl(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSV2 Isocitrate lyase Low 7.3 1 17-36 AVKAWWKDDRWRYTKRPYTA pero(10),cyto_nucl(9),nucl(8),cyto(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTU1 Uncharacterized protein Low 5 1 23-45 VLNVLQRKWKQARFIKENRCESV cyto(9.5),extr(6),cyto_nucl(6),E.R.(5),mito(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUV3 Uncharacterized protein Low 9.8 1 81-103 QGKKRSFSSVRRRRDKYSMRQEK mito(11.5),cyto_mito(9.333),nucl(7.5),cyto_nucl(7.333),cyto(6) VRRRR (90-94, prob:0.672) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZI9 F-box domain-containing protein Low 7.8 1 284-305 IAYYRHWRTRRFERARRIGDCD mito(12),nucl(8.5),cyto_nucl(6.5),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CA95 Uncharacterized protein Low 7.2 1 120-139 IKQLRNKSVINRKQRNMDKL mito(12.5),cyto_mito(10),nucl(8),cyto(6.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAP0 Elongation of fatty acids protein Low 5 1 281-301 ATYKKAAKTGRPRRNTGRQAV plas(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CB84 Uncharacterized protein Low 5 1 140-168 ADTVSLEKRDPKCRRRCTSHKQCCRSDLC extr(15),E.R.(6),pero(2),golg(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDR2 Carrier domain-containing protein Low 6.7 1 2301-2323 QAPNNRCIWKRDRRMSVYRNIEQ cyto(12),cyto_nucl(10),nucl(6),pero(4),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJV9 Uncharacterized protein Low 8 1 42-62 STTVSHQKRPHHHHRAHIVGG mito(13),nucl(10.5),cyto_nucl(7.5),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVS2 Probable feruloyl esterase B-1 Low 5 1 493-519 DQDGHPQYTRKHCRYPRRNVYRGPGSY extr(20),cyto(3),vacu(2),cyto_mito(2),cyto_pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYS9 L-type lectin-like domain-containing protein Low 5 1 265-286 PSSSSNTRGRVKPRKQQGSWGW extr(18),E.R.(3),golg(3),plas(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0R9 Adenylyl cyclase-associated protein Low 9.3 1 349-379 SVTRSKSPAPSKKPKPESMRVRKPPRKDLEG cyto_nucl(10.666),cyto_mito(10.665),mito(10),mito_nucl(9.665),cyto(9.5),nucl(7.5) KSPAPSKKPKPESMRVRKPPRK (354-375, prob:0.943) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1C0 Uncharacterized protein Low 8.9 1 488-511 EVTQRRWLRPRKSGQSNDRRPPLQ nucl(15),cyto_nucl(12),cyto(7),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7F9 Uncharacterized protein Low 7.5 1 395-415 KDTFKKKIKECKALLNHRDKT cyto_nucl(10),nucl(8.5),cyto(8.5),E.R.(4),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7V7 Uncharacterized protein (Fragment) Low 8.8 1 1-27 MSPLNSTSTRKRGRPPKYQSAEERQAA mito(11),nucl(10),cyto(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CA34 Uncharacterized protein Low 6.6 1 228-253 ALNQKSKPTTRRKQSLSSQGRKPRVF plas(18),nucl(4.5),cyto_nucl(3.5),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CB87 Uncharacterized protein Low 8.6 1 411-432 GEKLCRAYYKQHKEHRGIGSRL nucl(12.5),cyto_nucl(10.5),mito(6),cyto(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKJ6 Non-structural maintenance of chromosomes element 4 Low 9.5 1 44-63 SASTKRQRLARRTSNLPNGS nucl(16.5),cyto_nucl(11),mito(5),cyto(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMQ2 Mitochondrial import receptor subunit tom-20 Low 8 1 30-53 QTDPEFRRALKRNNRRHARAVKEE cyto_mito(13.333),cyto(13),mito(12.5),cyto_nucl(7.833) KRNNRR (40-45, prob:0.63) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CN70 Uncharacterized protein Low 7.1 1 233-252 GPWSRDKKLKKLGRWNLVHC cyto(13),cyto_nucl(11.5),nucl(8),pero(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CN77 MFS domain-containing protein Low 5 1 369-389 LWMNMRAKKIQRKPQPEYRLW plas(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQ03 Protein kinase domain-containing protein Low 5.7 1 755-774 NSATKPKTAAPKKIDTKPKD cyto(15.5),cyto_nucl(10.333),cyto_mito(9.166),extr(4),nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQI4 PKD_channel domain-containing protein Low 5 1 518-537 LEVREARRIRWNRRRGEEDD plas(15),mito(9),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVZ0 Uncharacterized protein Low 8 1 556-580 LGGGRAGARRVRRRRARLRGAGVGR plas(21),vacu(3),E.R.(2) GGRAGARRVRRRRARLRGAGVGRGGRRRRGHGRR (558-591, prob:0.998) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYA9 Uncharacterized protein Low 8 1 438-465 TEQPEIVKKSRKHRKSRGSRSENARGNG plas(13),mito(3),cyto(3),extr(3),E.R.(3),cyto_mito(3) KKSRKHRKSRGSRSENARGNGR (445-466, prob:0.965) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYJ1 Uncharacterized protein Low 8 1 337-360 STTGRDSTKKSKSRGRFRRGLQSI plas(19),E.R.(4),mito(2),vacu(2) KSKSRGR (346-352, prob:0.647) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYR6 WD_REPEATS_REGION domain-containing protein Low 7.7 1 1029-1058 RLVKHRTPSTPNLRQKKFSRPPRRSSVDVT mito(15),nucl(7),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0T3 Chitin synthase Low 8.4 1 722-756 ANPAETTREPQRSKRKRLRKPRRQLTKPMANRADD plas(15),E.R.(5),vacu(3),nucl(1),extr(1),pero(1),golg(1) QRSKRKRLRKPRRQ (732-745, prob:0.98) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D137 Uncharacterized protein Low 8.1 1 367-389 QPYTVREKGKRERKAHCSPKLGT nucl(11),cyto_nucl(11),cyto(9),mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CC92 Uncharacterized protein Low 7.9 1 102-123 LDSSRPRRSRSRSSTTPNRPLM nucl(9.5),mito_nucl(8),mito(5.5),cyto(4),plas(2),pero(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKE9 CULLIN_2 domain-containing protein Low 9.4 1 1-20 MAMRARQKIRAPRRGPTANK mito(14),nucl(11) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CL00 RRM_2 domain-containing protein Low 7.4 1 602-626 APRVGQQYRDEQRRRRSQFDRGTTA nucl(10),cyto_nucl(9.333),mito(8.5),cyto_mito(8.166),cyto(6.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CP66 acidPPc domain-containing protein Low 8 1 27-54 SIQLLVPHRMRRKIRSKLRSRISPTSSI plas(22),mito(2),cyto(1),pero(1),E.R.(1),mito_nucl(1),cyto_pero(1) MRRKIRSKLR (36-45, prob:0.725) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQ60 MFS domain-containing protein Low 5 1 481-503 PLVQWKFAARWRRKEREEAAQRE plas(24),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQR5 Uncharacterized protein Low 9.9 1 5-26 EESPAQKAARLRRERREAKIKE mito(7),plas(7),nucl(5),pero(3),E.R.(2),cyto_pero(2) KAARLRRERREAKIKEG (11-27, prob:0.851) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRA2 Uncharacterized protein Low 8.6 1 33-83 PEQAPQPQAQHRRRPRPPPYQQDSMDSNTALDRPRRQQRRQRRQPLGGDDG nucl(13),cyto_nucl(11),cyto(7),pero(3),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUZ3 Guanine deaminase Low 9.2 1 61-89 SKRVSTACDFCRKRKKKCDFRYPNCSACT nucl(11),cyto(7),mito(6),plas(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0E2 PRP3 domain-containing protein Low 9.9 1 408-431 AANEERKLTKEQRREKLARQQEQD nucl(18.5),cyto_nucl(13.5),cyto(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CII6 Uncharacterized protein Low 5 1 324-346 EWEEKFFWARRKRKTREAQVATE plas(23),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJJ8 RRM domain-containing protein Low 8 1 75-104 ATATKTANARRGRRARRGGGRNTSRPKPKT cyto(14.5),mito(10),cyto_nucl(9) PKPATATKTANARRGRRARRGGGRNTSRPKPK (72-103, prob:0.988) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJU7 PAN2-PAN3 deadenylation complex catalytic subunit pan2 Low 7 1 386-405 HCAPNPKKTRRYQVENTRAV cyto(8),nucl(6),pero(6),cysk(5),cyto_mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLK4 60S ribosomal protein L11 Low 6.2 1 133-161 CCMTRPGERVAKRRRCKARIGSNHRINQA mito(13),cyto(9),cyto_nucl(7.5),nucl(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPY8 Zn(2)-C6 fungal-type domain-containing protein Low 8.2 1 18-41 GPPGKPTKACAPCRVRKVKCDATV nucl(10.5),cyto_nucl(8),cyto(4.5),plas(4),mito(3),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSG7 Uncharacterized protein Low 9.3 1 45-72 LVFRRWVNSFRLKRNRPSRQPVKIVEGW nucl(18),cyto_nucl(14.5),cyto(9) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CU59 C-4 methylsterol oxidase Low 8.7 1 227-248 EYSPEAIKRRREKKATEGNKSL plas(14),E.R.(7),nucl(2),mito(2),mito_nucl(2) KRRREKK (234-240, prob:0.734) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CN58 ATP-dependent Clp protease ATP-binding subunit clpX Low 6.3 1 558-584 EESRWEEKMRQEKKAKERSKAQNSTTS mito(12),cyto(6),cyto_nucl(6),nucl(4),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CN64 Uncharacterized protein Low 9.6 1 64-83 TSTPRSSRPKKTPGKAKTGA mito(16.5),cyto_mito(10.833),nucl(6.5),cyto_nucl(5.833) PKKTP (72-76, prob:0.638) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPF5 AMP-binding domain-containing protein Low 8 1 72-92 VGSRRLIKTHVEKKKVKKIVD cyto(15.5),mito(11),cyto_pero(8.5) VEKKKVK (82-88, prob:0.681) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQP8 Uncharacterized protein Low 8.8 1 886-907 ATTKSPKKASKTFKKNLFKTLP cyto(12),nucl(10),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWX0 Uncharacterized protein Low 7 1 202-221 CSTYYRTSIRRVRRNFRDDV cyto(10.5),cyto_nucl(10.5),nucl(7.5),mito(3),plas(2),pero(1),golg(1),cysk(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9J4 Uncharacterized protein Low 9.1 1 497-518 LRRTRCRSYRWSASQRHRNVKS cyto(10.5),cyto_nucl(7.5),mito(7),nucl(3.5),pero(3) RKRSKYDRPLGLRRGSRK (395-412, prob:0.708) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCE0 Uncharacterized protein Low 6.8 1 13-37 VFHTLLHPRRDHRRQQIKPTRTMDI cyto(10),cyto_nucl(9),nucl(6),cysk(5),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CED0 Uncharacterized protein Low 5 1 80-100 DSGGRVCKKKNQKNCYHVKSN extr(17),cyto(5.5),cyto_mito(4.5),mito(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIN6 tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial Low 6.5 1 57-76 YSNSCTSKSILKKQPNGHNA mito(19),nucl(4),cyto(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIQ0 Uncharacterized protein Low 6.9 1 147-168 LAVPRCCQKRKGTQDRWRVNAS cyto_nucl(13),cyto(11),nucl(7),mito(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMT0 Uncharacterized protein Low 7.8 1 279-298 YNVRMSLKKHHPNPNSAPPV nucl(11),cyto_nucl(10.333),cyto(7.5),cyto_pero(6.666),pero(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMT8 Uncharacterized protein Low 5 1 545-570 FDICGEHCKCKHKKCSHHDGEKSDHH extr(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CN23 Zn(2)-C6 fungal-type domain-containing protein Low 7.7 1 83-109 MRPTYSCLSCHKRKVKCDRVKPCGACC plas(11),nucl(7),E.R.(4),mito_nucl(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7W0 FACT complex subunit Low 9.9 1 998-1017 DWDELEKKAKKKDREGGLDD cyto(17.5),cyto_nucl(14),nucl(7.5) KKAKKKDREGGLDDEDRGKKRKR (1004-1026, prob:0.961) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C835 Uncharacterized protein Low 8.6 1 237-261 ARRPIHPPKNPKKEKEKRRLSWTSQ plas(20),nucl(2),mito(2),cyto(2),cyto_nucl(2),cyto_mito(2),mito_nucl(2) RRPIHPPKNPKKEKEKRR (238-255, prob:0.949) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C974 Calcium-transporting ATPase Low 5 1 203-226 WQKAKQFAKLNRRKSDRQVKVVRS plas(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFD6 Uncharacterized protein Low 8 1 1235-1271 NRLHRPARLHIRLLRRHRRNRLRRVEARHRRPPPGVP plas(25) HRPARLHIRLLRRHRRNRLRRVEARHRRPPPGVP (1238-1271, prob:0.989) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFN8 Uncharacterized protein Low 8.1 1 196-218 IPSSSQRRRKFTRRSATGCRTCR nucl(8),plas(7),pero(4),cyto(3),mito(2),golg(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CH05 Uncharacterized protein Low 8 1 32-59 AGHNRWSQIKHHKAKNDKAKSKERQIIG mito(21),cyto(3.5),cyto_nucl(3.5) KAKNDKAKS (44-52, prob:0.639) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLI5 WD_REPEATS_REGION domain-containing protein Low 6.2 1 164-189 VPSPEDSKSSSKKKKTRSDDSDDEEM mito(15),cyto(8),nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CP40 Uncharacterized protein Low 9.3 1 7-30 GRAALKKTKVPKPSPPRPGGKSPV mito(19),nucl(4),cyto(4),cyto_nucl(4) GRAALKKTKVPKPSPPRPGGKSP (7-29, prob:0.929) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSZ5 Uncharacterized protein Low 7.6 1 354-377 GHFSRDCTKKKDWSKVQCNNCGGM cyto_nucl(10),nucl(9),cyto(9),pero(4),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTY2 Uncharacterized protein Low 9.5 1 1542-1567 ISGKLRPYIKKSKPEKKEKIEEELRK cyto(11),cyto_nucl(9.333),cyto_mito(7.833),nucl(6.5),pero(4),mito(3.5) PYIKKSKPEKKEKI (1548-1561, prob:0.841) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUL1 Protein phosphatases PP1 regulatory subunit sds22 Low 8.6 1 119-138 LSISWKKKMRTQRYQCCSLA nucl(15.5),cyto_nucl(13.333),cyto(8),cyto_mito(5.999) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXU6 Putative lipase atg15 Low 5 1 1-20 MKSHQGHQKKRRMREMGFST extr(22),golg(2),mito(1),plas(1),E.R.(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7E7 Uncharacterized protein Low 9.7 1 83-110 ALDAGRLRPRHKHKHSKSRDGRFPRLMN mito(7),cyto_nucl(6),nucl(5.5),cyto(5.5),extr(3),golg(2),plas(1),pero(1),E.R.(1),cysk(1) RLRPRHKHKHSKSRDGR (88-104, prob:0.892) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCN2 Uncharacterized protein Low 9.1 1 861-886 EERPAPADHRRRSKTNPYPQSDNNPF extr(12),plas(9),nucl(3),E.R.(1),golg(1),vacu(1) RKRTNSSHKREPLKPIQPRRSLKRTSMQSTKSRRLSK (582-618, prob:0.872) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFK6 Uncharacterized protein Low 5 1 308-327 STGLRRLRQRRSPPDEHEKE cyto(11),cysk(8),mito(3),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKJ9 ANK_REP_REGION domain-containing protein Low 6.2 1 384-409 LGYRMAYRCGTRRRRYRIPNDTTLSV cyto(7.5),extr(7),cyto_nucl(6),nucl(3.5),mito(3),plas(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNW3 Uncharacterized protein Low 6.8 1 40-60 RPTEHRSKYHGPRSRRWNVRS plas(10),nucl(5.5),mito(4),cyto_nucl(4),golg(2),cyto(1.5),pero(1),E.R.(1),cysk(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQR2 MFS domain-containing protein Low 8 1 476-507 GLRWRERRFLRLEEKRRKKQSHQLQEVQPQRS plas(20),mito(4),E.R.(2),cyto_mito(2),mito_nucl(2) RFLRLEEKRRKK (483-494, prob:0.754) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVD9 Uncharacterized protein Low 7.1 1 77-103 ASPTPSPQKQRITKRKKVEEPTVKGEE cyto(11),cyto_nucl(10.833),nucl(9.5),cyto_mito(8.833),mito(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVQ6 Vacuolar protein-sorting-associated protein 36 Low 8.6 1 84-105 KSSPKLTIYPKPPKNNLKSRST nucl(15.5),cyto_nucl(11.333),cyto(6),cyto_mito(5.833),mito(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CX25 Fungal_trans domain-containing protein Low 9.5 1 2-25 DTQYDIPPAKRRKTHNPPPREIGL nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CX34 DFP domain-containing protein Low 8.4 1 326-345 DPPYERWIRVPKSKRSKSIS nucl(13.5),cyto_nucl(13),cyto(9.5),mito(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CY51 54S ribosomal protein L31, mitochondrial Low 8.4 2 12-41, 78-99 LLWKIPWRISQPQKARQRKRLRSVDRVVDT, FDKKEKTYRKGIHKLPKWTRVS mito(20.5),mito_nucl(13.5),nucl(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7J9 Uncharacterized protein Low 5.8 1 15-40 FCRNTASPRCRGRSKRSCRAASKIFH mito(22),cyto_nucl(3),nucl(2.5),cyto(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C863 Uncharacterized protein Low 5.8 1 12-34 LQAIRRSLKGEKDPKPHHHHLSI mito(21.5),cyto_mito(12),nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8T2 AMP-binding domain-containing protein Low 6.1 1 701-722 LISHVPRTKSNKTDRRKLHYLA cyto(7.5),cyto_nucl(6),mito(5),plas(4),nucl(3.5),pero(3),extr(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C999 Uncharacterized protein Low 8 1 238-262 SGSQIGPKKSRSRRSKSRNIFQGSS plas(23),mito(1),cyto(1),pero(1),E.R.(1),cyto_mito(1),cyto_pero(1) GPKKSRSRRSKS (243-254, prob:0.817) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAJ0 NACHT domain-containing protein Low 5.7 1 50-70 ACSTRDYQTPWKQARKRGVAT plas(21),nucl(2),mito(2),mito_nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAU5 Uncharacterized protein Low 7.5 1 160-181 SGSGCARRWTRRPSRSLPWRSI mito(11),nucl(8),cyto_nucl(7.5),cyto(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAY7 Fungal_trans domain-containing protein Low 5 1 795-815 EDKQKKHIVKRLPTEEKRQFH plas(16),mito(6),cyto(2),extr(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CH13 Rap-GAP domain-containing protein Low 6.6 1 120-139 ISTARLKARKSKVPKANGLG plas(14),nucl(4),vacu(3),cyto(2),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIM0 Uncharacterized protein Low 9.8 1 139-158 HYEERQRRRGPQRPRHLPPE nucl(13),cyto(11),mito(1),extr(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIU6 FAD-binding PCMH-type domain-containing protein Low 5 1 14-37 YAGPHSCRCRPHQRCWPSPQEWNA extr(14),mito(11) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIW1 Elongation factor 3 Low 9.3 1 973-1007 THSLEKKKKLTSSEARKKKKERMARKKRGEEVFSD cyto(21),nucl(3.5),mito_nucl(2.5) KKKKLTSSEARKKKKERMARKKRG (978-1001, prob:0.997) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJI3 Uncharacterized protein Low 5 1 24-53 HHYRRGTHPHQLSTRRKPRRWPLVFRFVKG plas(24),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPN3 Uncharacterized protein Low 8.2 2 187-210, 356-378 CGRCPHHCPQPRPQRQPRPRVPAS, WNTLARIQRKRPHWSPERIFKAW mito(22),nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPW2 Condensin complex subunit 2 Low 9.5 1 207-227 GEDGGSRKSRRKQARSHEATL nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQB6 Zn(2)-C6 fungal-type domain-containing protein Low 8.1 1 29-54 APKISKARACADCKRHKIRCEFKPGE nucl(9),plas(8),mito(4),cyto(4),cyto_mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTJ8 Uncharacterized protein Low 8.4 1 225-246 QLELRRSRYPPRAWRQRSQELE nucl(12),cyto_nucl(9),mito(5),pero(5),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D053 Uncharacterized protein Low 5 1 781-801 VLVYMRQQRNRPQQNDNNAGN plas(10),extr(10),mito(3.5),cyto_mito(2.5),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0V1 SCP domain-containing protein Low 8 1 55-79 ISQHLRRPPPPLRLRRPRRVASSKS extr(21),mito(3),cyto(2) RPPPPLRLRRPRR (61-73, prob:0.779) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C827 Uncharacterized protein Low 8.7 1 22-48 FPRNESCIERQRRFKNKPWWKNITEQS nucl(14.5),cyto_nucl(12),cyto(8.5),mito(1),pero(1),golg(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9Z1 Uncharacterized protein Low 7.4 1 873-893 SSSRTEVPKQNRPPKIKDANY mito(15),nucl(6),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDF4 Uncharacterized protein Low 5 1 19-42 VQSQKWSWSRLRRGRAHPIPSERQ plas(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFE7 Uncharacterized protein Low 8.8 1 20-41 LTLRCVVRAKYHRDKSRRSAEV nucl(16.5),cyto_nucl(13.833),cyto(8),cyto_mito(5.499) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRM2 Uncharacterized protein Low 8 1 283-302 SPFMKTQEDARQKRRDKAVS nucl(9.5),cyto_nucl(7),mito(6),pero(6),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBR9 Zn(2)-C6 fungal-type domain-containing protein Low 9.1 1 30-66 ETDSRHPQRQHIPKISRRIRACTECKRHKVRCDMSAG nucl(14.5),cyto_nucl(10),cyto(4.5),mito(4),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBY4 Zn(2)-C6 fungal-type domain-containing protein Low 8.7 1 59-84 PPITGKRRGGSRKACNECKQQKLRCD nucl(10),mito(7),cyto(5),plas(2),pero(1),E.R.(1),golg(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CH82 Uncharacterized protein Low 7.3 1 655-676 DLERKRYQNARWWRNLNRWMNC plas(18),nucl(6),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHD2 Uncharacterized protein Low 8 1 332-359 RFIPRFSVKPKYKGGKKKTRPAKESVGE plas(17),E.R.(6),golg(2) VKPKYKGGKKKTRPAK (339-354, prob:0.945) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLS2 Protoheme IX farnesyltransferase, mitochondrial Low 8 1 103-129 ADTNQTELPHRRRKRLKEESARNKSDD plas(15),mito(8),E.R.(2) RRRKRLK (113-119, prob:0.744) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLT3 26S proteasome regulatory subunit RPN2 Low 5.8 1 933-958 LSTTAQAKRRAQRREKQQRRESMDID cysk(12),cyto(9.5),cyto_nucl(6.5),nucl(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPL9 Uncharacterized protein Low 8 1 138-159 GDVPPPKGAKPQPQPQPPKNGN extr(25) GPAPKKPAPPKRGDVPPPAPKEPQPQPEDGPHGKRGDVPPPAPKGPKQDGAHPKRGDVPPPPKGEQPQPQPQHPKRGDVPPPKGAKPQPQ (62-151, prob:0.959) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQW5 Uncharacterized protein Low 5.7 1 15-35 FANALKPKKSRQVLRKDFSAS mito(22),nucl(2),cyto(2),cyto_nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CV06 TIP120 domain-containing protein Low 7 1 182-205 LESVGGSKNSRKRRRQDSDASMID cyto(9.5),cyto_nucl(8.5),plas(8),nucl(6.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXX3 Lactamase_B domain-containing protein Low 6 1 320-341 PLSANDWKRKNWREQTLWTFLK extr(9),cyto(6),cyto_nucl(5.333),cyto_pero(5.333),mito(4),nucl(3.5),pero(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D115 Uncharacterized protein Low 5 1 156-176 EEKNSGKKRSKSLRNPHPQLA mito(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAL2 DUF1996 domain-containing protein Low 8.5 1 465-488 STPTDPPAKRHHAHKRHGHGHAHA extr(17),cyto(4.5),cyto_nucl(3.5),mito(2),nucl(1.5) HAHKR (476-480, prob:0.627) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAW5 IPPc domain-containing protein Low 9.7 1 259-278 PSSPEKPSPKRLSHRPIYHS nucl(16.5),cyto_nucl(11),cyto(4.5),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFX2 Uncharacterized protein Low 6.8 1 694-713 VVDEQARKRRFKKVGFWSLQ plas(11),nucl(5),mito(3),golg(3),cyto(2),pero(2),cyto_pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJW6 ERF-3 Low 6.3 1 641-661 LEPGTGRKSKRPPPFASKGQT cyto(15.5),cyto_nucl(10.5),pero(5),nucl(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPV5 Eukaryotic translation initiation factor 3 subunit M Low 9.3 1 426-453 AAQGKSGDKKGDRRQRRDQPQQSQPAPE nucl(16),cyto_nucl(12.5),cyto(7),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTL9 Uncharacterized protein Low 5 1 65-84 AQEAWKKRELRRKTFHQLGS mito(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYT3 Chloride channel protein Low 5 1 49-71 GLREPISFKRKQKQPSKFSLSNL plas(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D122 Uncharacterized protein Low 6.1 1 21-41 VEKQSSPYRHHYRQPSHSSFA plas(13),mito(4),nucl(3),E.R.(2),golg(2),cyto(1),pero(1),vacu(1),cyto_pero(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCB0 Squalene synthase Low 6.9 1 352-372 DTFRRYARRIHQKNTPKDPNF cyto(8),nucl(5),E.R.(5),mito(3),golg(2),plas(1),extr(1),pero(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CEX2 Uncharacterized protein Low 7.2 1 751-772 DGEKHIRRKARSQDKQQPVPFP mito(16),nucl(6),cyto(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGS2 Uncharacterized protein Low 9.4 1 1056-1092 EDQGELKFKARKKKKLTRAQLKEREARRRLRHLEWLQ cyto(10.5),mito(9),cyto_nucl(8),nucl(4.5) KFKARKKKKLTRAQLKEREARRRLR (1062-1086, prob:0.988) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLP6 Ribosomal protein Low 7.4 1 86-117 KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK mito(17),nucl(7),cyto_nucl(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CN99 Abhydrolase_3 domain-containing protein Low 5 1 51-74 LYFYCPPSYHRARKDKSNRRFPVL mito(11),extr(10),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CT64 PKS_ER domain-containing protein Low 5 1 4-26 PSTTAKSSSHRYRTRPHHNTLFS mito(14),cyto(4),plas(4),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVC2 Queuosine salvage protein Low 8 1 364-388 HLDAHKKCTTQKHWKQKSVNEPTAS nucl(13),cyto_nucl(12.833),cyto(8.5),cyto_mito(5.832),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVH4 Threonine aldolase Low 6.6 1 451-477 LSPHEHGKVHPRRRERRTQTIPTRVEP cyto(12.5),cyto_nucl(9.5),nucl(5.5),mito(3),pero(2),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVQ2 Uncharacterized protein Low 7 2 31-51, 773-798 AVKPRFIPKHLKRQINYKPSS, AGMFWVARRYRKKRQGHQRSSSTVEQ extr(24),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVZ6 Uncharacterized protein Low 7 2 449-477, 648-670 YVKRVLRQKWRDYREKKTRNRTRHYSIRT, LTGSLSPKGKRRVRFQDRVNVYS plas(17),mito(3),E.R.(3),vacu(2),mito_nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CW71 Pyruvate decarboxylase Low 5 1 635-656 RVKSPRCVPRPSVKRPAREGPH mito(13),cyto(7),mito_nucl(7) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWE6 Uncharacterized protein Low 9.4 1 398-420 DMELRRKRVEPLPYKRRNPSTFR nucl(14),mito(9),cyto_nucl(9) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYF2 Uncharacterized protein Low 5.8 1 187-206 LETREKRQRRVEDAEKRRQF mito(20.5),cyto_mito(12),nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZH9 Uncharacterized protein Low 5 1 237-259 MGSRRLGKLTHRRRDSREKLLRG extr(9),mito(6),E.R.(4),mito_nucl(4),cyto(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0Z0 Pyr_redox_2 domain-containing protein Low 5 1 53-79 AAAPTPTPTPKPKKRFRFLRWTWRLTW mito(21.5),cyto_mito(13),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0Z6 Serine palmitoyltransferase 2 Low 6.2 1 967-987 IEDPKRGRSRWTRVRGWMRGW mito(8),plas(8),nucl(3),cyto(3),cyto_nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CEP3 Protein kinase domain-containing protein Low 7.3 1 55-87 VQRLARANTRRRQQFRYWRKRRVKYEEYSKSIE cyto(8.5),cyto_nucl(8.5),nucl(7.5),mito(5),extr(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CL06 Peptidase A1 domain-containing protein Low 5 1 42-65 VSDPVARDRVRRKRDKTVSQALDN extr(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNK3 GFO_IDH_MocA domain-containing protein Low 7.7 1 5-26 GVIRHPRFGRLGRRNRPVHTHS nucl(8),mito(8),mito_nucl(8),cyto(3),plas(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQV2 Uncharacterized protein Low 8 1 360-383 VLDADRARRRKRGARDLTREEKEQ cyto(12),extr(7),cyto_mito(7),cyto_pero(7) ARRRKRGA (366-373, prob:0.791) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYJ9 Uncharacterized protein Low 5.5 1 570-595 LTLFVKCNANRRNSRRGKRVIQGWEY extr(10),cyto(7.5),cyto_nucl(5),mito(2),plas(2),golg(2),nucl(1.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D193 MAP kinase kinase kinase Low 9.3 1 129-155 FQNDRQRSSSSKRNSRRDPNAQYQAQE nucl(17),cyto_nucl(12.5),cyto(6),mito(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7E3 Vacuolar protein sorting/targeting protein 10 Low 5 1 1330-1353 EFDHVKTKPCPHKEKEYEKKHGIS extr(7),plas(6),E.R.(5),vacu(4),golg(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLE1 Uncharacterized protein Low 7.8 1 86-112 HSQSRSGSRARNHRHQRSKSTTREKTL mito(18),nucl(7) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CM85 Zn(2)-C6 fungal-type domain-containing protein Low 9.6 1 4-39 PGGGPPRKSHTKSRFGCKTCKRRHIRCDETFPQCRN nucl(12),plas(12),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQ79 Uncharacterized protein Low 5 1 166-188 VIIFFCCRKMRRNKERSSFFEIG extr(12),mito(7),cyto(2),plas(2),pero(2),cyto_pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQX9 Uncharacterized protein Low 6.7 1 13-35 GVGPGRPLRQRPSRPPSKSPSSW mito(17),nucl(5.5),cyto_nucl(5.5),cyto(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0C8 F-box domain-containing protein Low 5.4 1 82-107 FCNWRIRRIMQRRRRHLECRRQRGGC plas(9),cyto(5),mito(4),E.R.(4),nucl(1),pero(1),golg(1),cysk(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1V6 Actin cytoskeleton-regulatory complex protein SLA1 Low 6.4 1 956-980 VEAQHQKRESRHKSKPDPTKTRSWT mito(12.5),cyto_mito(9.5),cyto(5.5),nucl(5),extr(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CA35 Uncharacterized protein Low 9.7 1 16-37 GLMPPPPPPKRIKRPATVLDED nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCZ4 Uncharacterized protein Low 5 1 356-376 KTWSRIQIRSTRKEERRLSNT cysk(11),mito(6),cyto(4),mito_nucl(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CF67 Transcription factor ATEG_07667 Low 8.3 1 16-58 QACTQCYKAKCRCVRTPSGDTCERCIRLKKRCEPSESVRRRNA mito(11),nucl(9),cyto(4),plas(1),pero(1),golg(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIX0 Ribose-phosphate diphosphokinase Low 6.7 1 88-111 VMPYFPYSRQSKKKSHRGAITARM cyto(13.5),cyto_nucl(11.833),cyto_mito(9.666),nucl(8),mito(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKP9 ANK_REP_REGION domain-containing protein Low 5.7 1 316-339 LSFLHFKKVFRRHHYRQCPKSKIS extr(7),plas(5),cyto(4),golg(3),cyto_mito(3),nucl(2),mito(2),E.R.(2),mito_nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLC7 HET domain-containing protein Low 6.3 1 696-720 DVGCKGPPRSRRAFRSPSRLWCFSR cyto(10),extr(6),cyto_mito(6),nucl(4),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPR2 Carrier domain-containing protein Low 7 2 919-942, 1418-1445 LSENASKQKRVKRQPATKQGQKMQ, VRSCTSRNTSQRSPSKRQHSHPIQSLVT extr(12),mito(4),plas(4),cyto(3),pero(2),mito_nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQB2 MFS domain-containing protein Low 8 1 421-450 RPGTIQGRTRPIRRRKCDRQKRLSLRAGTA plas(22),mito(2),E.R.(2) RRR (433-435, prob:0.628) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTW8 C2 domain-containing protein Low 7.3 1 417-437 GEFFVRRRKHHRHSLSQTEIP cyto(9.5),cyto_nucl(9.5),nucl(8.5),pero(5),mito(1),extr(1),golg(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUS7 F-box domain-containing protein Low 7.2 1 95-114 LRYHHLCRGKPKSVQRYKLC cyto(7.5),nucl(7),cyto_mito(7),mito(5.5),extr(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYV0 Lysophospholipase Low 5 1 775-800 QVKRVVRAVYERKKNDRLRREAEAAR mito(12.5),cyto_mito(11),cyto(8.5),extr(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8R8 Uncharacterized protein Low 6.6 1 308-334 ECQVCERRIRTRRGLRVMKLRARQKVR mito(17),nucl(4.5),cyto_nucl(4),cyto(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCP1 Uncharacterized protein Low 7.4 1 21-44 HYSIQKQMGRPPKKRAREDDSDLG mito(10),nucl(6),extr(6),cyto(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDY6 Uncharacterized protein Low 6.9 1 299-320 NNAGHHHHHHHHHHHNHNQQNI extr(8),cyto_nucl(7.5),mito(7),nucl(6.5),cyto(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CE77 Uncharacterized protein Low 8.8 1 29-51 ATAPRGPRNSIRRPEPIRKPAAS mito(22.5),cyto_mito(12),nucl(3) PRGPRNSIRRPEPIRK (32-47, prob:0.713) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CL92 Outer mitochondrial membrane protein porin Low 5.9 1 56-79 VDQPTGTRPKHRQHVLRKPPDPND cyto(16.5),cyto_nucl(11.5),nucl(3.5),mito(3),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRH3 Polyketide_cyc domain-containing protein Low 6.6 1 7-26 RHLSRQTRRLAQRRILPQSV mito(17),nucl(5),cyto(5),cyto_nucl(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CT49 Uncharacterized protein Low 8 1 223-257 PDSEFPRISRKEKKRLRREKKERKKQAKLSGSDGS plas(23),E.R.(2),vacu(2) RISRKEKKRLRREKKERKKQAK (229-250, prob:0.997) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D117 Fungal_trans domain-containing protein Low 9.2 1 11-41 VRPGTACTECQRRKQKARSPCDRSSNREPDP nucl(11),plas(5),cyto(4),mito(3),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCX8 Methyltransferase gedG Low 7.1 1 22-43 QDPDFWKNYRRGRPQVPYSFFQ cyto(10),cyto_nucl(9.5),nucl(7),pero(5),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CD24 Aa_trans domain-containing protein Low 8 1 496-515 KSGKRDPSIKWKKNVFRTGM plas(25) RRRPSERTPLLRARKRSRVGR (178-198, prob:0.86) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDI6 TauD domain-containing protein Low 8.6 1 105-124 SSLARKKMFRHENQPNKRRY nucl(12.5),cyto_nucl(10.5),cyto(7.5),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDJ9 Uncharacterized protein Low 5 1 189-208 SWELYWKRRMRNMKLPDHGD plas(19),E.R.(3),pero(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CG98 SGNH_hydro domain-containing protein Low 5.7 1 644-665 NTPVFTRRRCFNNNKVQKKAGG extr(15),mito(4),nucl(2),pero(2),vacu(2),cyto_mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJN4 Uncharacterized protein Low 5.7 1 49-75 DEKPGRIRATNQKVKRHIRRFWCCYLI plas(7),extr(7),cyto(5),cyto_nucl(4.5),nucl(2),mito(2),golg(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CL84 ENDO3c domain-containing protein Low 5 1 18-42 PLAPSTPTKRTNKTTQRNGVTKARK mito(21.5),cyto_mito(12.5),cyto(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQ38 Zn(2)-C6 fungal-type domain-containing protein Low 8 1 5-35 QASRPRTSRSCDNCRVVKRRCDKEVPQCGQC nucl(9.5),plas(8),cyto_nucl(6.5),mito(5),cyto(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWC7 Uncharacterized protein Low 7.4 1 58-78 RINSRDTVRNRGRRNTARSYH plas(16),nucl(7.5),cyto_nucl(5.5),cyto(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CX91 Uncharacterized protein Low 5 1 23-42 LWFSRRKKPGSNTRNTKSPS extr(13),mito(3),plas(3),golg(3),cyto(2),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0Q0 Alpha-1,4 glucan phosphorylase Low 7.3 1 334-354 HDIVRRYKKTKRPWSEFPEQI cyto(14),nucl(6),pero(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1N6 Endoplasmic oxidoreductin 1 Low 9 1 535-556 GLPVPPRSWRIRRPGQHVELHQ nucl(14.5),cyto_nucl(11.5),cyto(7.5),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFM9 Uncharacterized protein Low 8.1 1 35-55 EGEGRDYRRHRTNRTRWLRAA nucl(8),cyto(4),plas(4),golg(4),mito(3),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CI85 FK506-binding protein Low 8.8 1 287-312 EEKKEEESKKQQKKVKKNNGEPAPAE cyto(20.5),cyto_nucl(12.333),nucl(3),mito_nucl(2.833) KGKNKRAAEEEKKEEESKKQQKKVKKNNGEPAPAEQKKEGKK (278-319, prob:0.978) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CID2 Fungal_trans domain-containing protein Low 9.6 1 657-682 GPAASWKKHIPRWTWRKANLPRDWIP nucl(17),cyto_nucl(13),cyto(7) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIG2 Uncharacterized protein Low 5.7 1 12-40 VPEWRAKYLDYKQGKKKLKAISRALQKST plas(21),nucl(2),mito(1),cyto(1),E.R.(1),vacu(1),cyto_mito(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJ94 Uncharacterized protein Low 8.5 1 1-27 MSPLNSTSTRKRGRPPKYQSAEERQAA nucl(12),cyto_nucl(10),mito(6),cyto(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQY5 MFS domain-containing protein Low 5 1 31-59 GFHIQWAKGNRRHPRNWRQSRKIYDTCLI plas(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CR01 GPN-loop GTPase Low 9.5 1 274-293 KPELERKKKEREEMKANQRE nucl(16.5),mito_nucl(11),cyto(5),mito(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRK0 DUF3533 domain-containing protein Low 5 1 455-479 EIIHRELSRPKSHRRESRDNQGPCF plas(21),E.R.(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRL3 Zn(2)-C6 fungal-type domain-containing protein Low 7.5 1 47-73 RRNTTCRFSSRKEKREALKRTHYVKNL plas(11),nucl(7),mito(5),cyto_nucl(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CW21 General transcription and DNA repair factor IIH subunit TFB4 Low 8.8 1 344-371 DYGAKPAVVARKKKKKKARANGPSGTAT cyto(10.5),cyto_nucl(7),mito(6),extr(4),nucl(2.5),E.R.(2) ARKKKKKKARA (353-363, prob:0.987) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CX03 Amidase domain-containing protein Low 6.2 1 5-29 FDYFTYRSVRNSKRRERAHRFASLP mito(22),nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7L0 MFS domain-containing protein Low 5 1 43-67 WVAEDPKHPRNWPKWKKNAQILMVA plas(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHP1 Uncharacterized protein Low 5 1 48-69 AHSRVPKTFGRRRIQNRQKFLQ mito(23),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CP59 Fe2OG dioxygenase domain-containing protein Low 8.1 1 1-23 MPPKKSKKDKASQPPSQPQKQPA nucl(10.5),cyto_nucl(9),mito(8),cyto(6.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CP67 Uncharacterized protein Low 5 1 27-52 ETKDEKPVKVYSKKPSKRRSGFIFVL plas(18),mito(4),E.R.(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSI0 Autophagy-related protein 2 Low 8.3 1 1662-1685 RQNHSPPFKKKLRLSRSKYHKMTF nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(7) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWZ8 Uncharacterized protein Low 5 1 70-92 ALTAPGKKQKFRRHWARFWCCYL extr(14),mito(5),cyto(3),E.R.(2),cyto_pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CX77 Alpha-1,3-glucosyltransferase Low 8 1 1-25 MPPPPSSYRPRKKRKFVSAFSGSNS plas(19),E.R.(5),mito(2) RKKR (11-14, prob:0.666) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CA05 Seryl-tRNA synthetase Low 7.8 1 439-458 KELPKDSTSQKPKGKQAKAA cyto(13),nucl(8.5),mito_nucl(6),mito(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAY3 Abhydrolase_3 domain-containing protein Low 5 1 599-618 QEKNRQRHPGLGRRPDRHDG cyto(9.5),cyto_nucl(6.5),extr(5),mito(4),pero(3),cysk(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CC12 Uncharacterized protein Low 8.6 1 30-52 AARSAHARKRRLRTIQYQAQKRH nucl(13.5),cyto_nucl(11.5),cyto(8.5),mito(2),cysk(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CH18 PUM-HD domain-containing protein Low 9.3 1 798-819 IVRPIVNRLKKEKNNVPKQLAS nucl(17),cyto_nucl(12.5),cyto(6),mito(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CN98 Aspartate--tRNA ligase Low 5 1 66-91 GALSKNQQKRLARQQRRQERSRLSGE mito(9),cyto(9),cyto_mito(9) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQH2 Uncharacterized protein Low 5 1 21-40 TANPPRRPPKPPPNSRHWVP extr(12),cyto(10),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQN4 Iron sulfur assembly protein 1 Low 9.2 1 123-145 AAKPAEKPRRKLRPRKAAMKLTP mito(19.5),mito_nucl(12.833),nucl(5),cyto_nucl(3.833) AKPAEKPRRKLRPRKAA (124-140, prob:0.975) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CR52 Uncharacterized protein Low 8.4 1 302-327 TLLWDDKSRKRSLRRRRDSLPVRTTP plas(7),E.R.(6),golg(6),extr(3),mito(2),nucl(1),cyto(1),cyto_nucl(1),vacu(1) RKRSLRRRR (310-318, prob:0.744) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSV1 Trehalase Low 7.9 1 510-532 ESSSVWDRRARRRKMRMDTYLWD cyto_nucl(11),nucl(10.5),cyto(10.5),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWH4 Uncharacterized protein Low 8.1 1 65-84 RSTTSSRPPKPQDTRLPLRG mito(12),nucl(10.5),cyto_nucl(7.5),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CX04 Uncharacterized protein Low 9.6 1 1-21 MPPVKGRRRRQKDEIYFINAR nucl(13),plas(5),cyto(4),mito(3),cyto_pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CX86 Uncharacterized protein Low 7.1 1 455-477 YFDKWWKREPFRIFSRPRSKNMK nucl(6),mito(6),plas(6),mito_nucl(6),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYC4 Uncharacterized protein Low 7 2 8-28, 190-214 LLDPKAYRRQLQKNNGNDPDC, MYGVERRSRQPYKKIKTENNVEEKG cyto(10),mito(9),cyto_nucl(9) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZG0 Ubiquitin-conjugating enzyme E2 15 Low 8.9 1 143-168 ARLWREDPKEFKKRVRKCVRESLGEE nucl(14.5),mito_nucl(11.5),mito(7.5),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1A2 Carrier domain-containing protein Low 5.3 1 24-46 WDNIVQKRDLWRKMPKDRFNIDA plas(15),E.R.(4),extr(2),vacu(2),mito_nucl(1),cyto_mito(1),pero(1),cyto_nucl(1),cyto(1),mito(1),nucl(1),cyto_pero(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7R1 Glyco_transf_28 domain-containing protein Low 8 1 624-646 VQEYHDYHKRRKNQRSSSMSSSA cysk(16),mito(6),cyto(3),mito_nucl(3) KGKKRR (855-860, prob:0.813) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBI1 IFRD domain-containing protein Low 9.3 1 349-372 LATVHGKRISKRDKKNLHSNFASI nucl(15.5),cyto_nucl(11),mito(6),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCK3 HET domain-containing protein Low 6.7 1 521-541 ATKLQDRRSRPWKVKKYETEL mito(8),cyto(8),cyto_mito(8),nucl(6),cyto_pero(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKS2 Uncharacterized protein Low 5 1 511-538 MTVPMMVWGKRWRRRCKGRYMKFLAEVG plas(22),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLL1 Mevalonate kinase Low 6.9 1 1-25 MQNARRKHGKSSVKACKGRNQRATI mito(12),nucl(5),cyto(5),cyto_nucl(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPE9 Importin N-terminal domain-containing protein Low 7.8 1 251-270 ELNHWWKCKKWSYANLNRLF nucl(7),cyto(6),mito(4),plas(4),E.R.(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPN2 Uncharacterized protein Low 8.2 1 492-511 HMRTRERRDLDRPKVRQTPT nucl(11.5),cyto_nucl(10.5),cyto(8.5),mito(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8Y0 Uncharacterized protein Low 9.2 1 217-236 QEIERETRRRRNSRISRLSD nucl(15.5),cyto_nucl(10.5),mito(6),cyto(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAE3 Electron transfer flavoprotein beta-subunit Low 7 2 26-45, 772-791 YPKFNWAARKLYKRLRQLGA, LPNIMKAKKKPLEKKTLADF mito(13.5),cyto_mito(12.5),cyto(10.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBK8 Zn(2)-C6 fungal-type domain-containing protein Low 7.1 1 4-24 FSKSIDTLRRHVRQRHPEDEP mito(14),nucl(6),cyto(2),plas(2),pero(2),cyto_pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCW4 Uncharacterized protein Low 8 1 23-48 CVSPKAKQREAKKPLPRFNPKKHSSV extr(8),plas(6),E.R.(5),mito(4),golg(3) AKQREAKKPLPRFNPKK (28-44, prob:0.78) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDT6 Fatty acid hydroxylase domain-containing protein Low 5.7 1 130-151 LLHRPAWYRRIHKRHHRFTAPI extr(10),plas(7),cyto_nucl(3.5),mito(3),cyto(3),nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGT9 Aminotran_1_2 domain-containing protein Low 5 1 8-28 RESLRQALRRREAKSSRRRLT mito(24),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CID5 Uncharacterized protein Low 8 1 561-587 APEAKKKKKLFSFGRKKKDQKPSADPE plas(25) PEAKKKKKLFSFGRKKKDQK (562-581, prob:0.965) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUR9 DEAD domain-containing protein Low 6.7 1 237-257 LNPYQQRWKKLQRSVRVTGYF mito(10),cyto_nucl(6.5),pero(6),nucl(5.5),cyto(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7T9 Fungal_trans domain-containing protein Low 8.8 1 2-26 SLEETPEYRKRKRTSHAKSEPCTTC nucl(11),plas(9),mito(3),cyto(3),cyto_mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDS1 Uncharacterized protein Low 8 1 43-62 REVSKQLQRRPIKRAVRNVM nucl(11),cyto_nucl(10.5),cyto(8),mito(3),plas(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHD3 AAA domain-containing protein Low 6.6 1 49-73 FATQSPHDPKPPNKKDQNQPPDQGS mito(18),nucl(4),cyto(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQ01 AIP3 domain-containing protein Low 8.6 1 128-153 LLHGLKKKQARLRSRQQRDDRPVASR nucl(13),mito(10),cyto_nucl(9.5),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQZ6 Fungal_trans domain-containing protein Low 8.1 1 8-33 EATDRISKPRSRNERVRSQYRRDAIC nucl(10.5),cyto_nucl(8),pero(7),cyto(4.5),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSE1 Uncharacterized protein Low 5 1 378-401 ISITCVRIRRWRKQPLPPARWSMG plas(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVQ8 Uncharacterized protein Low 9.6 2 77-98, 358-377 LDITRRDGKKIRKRLWQLPYNN, RINSEKSRVLPRKRCWIQNG cyto_nucl(10),nucl(9.5),cyto(9.5),pero(4),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0P3 Cullin-1 Low 9 1 703-725 SAIVRIMKSRKKMKHVQLVQEVI nucl(13.5),cyto(13),mito_nucl(7.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7G5 Uncharacterized protein Low 8 1 768-790 AGAIQYKKTRRSRKPARDEESGR plas(25) RRSRK (777-781, prob:0.644) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C805 Coproporphyrinogen oxidase Low 6.9 1 15-36 GQFSRTCRTPRHIQPPLRRFAS mito(15),nucl(5),cyto(4),plas(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAE4 DNA-directed RNA polymerase III subunit Low 8.8 1 69-89 SYSGRYQKKRRAAPNLKGRPY nucl(11),cyto(9),mito_nucl(9) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBT1 PSDC domain-containing protein Low 5.6 1 11-30 AWLPRHPKKIWRWINEKALS mito(10.5),plas(7),cyto_mito(6.5),pero(3),golg(3),nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIJ4 NMO domain-containing protein Low 5 1 50-72 TPEDLRKEIRRCRKMTNKPFGVN cyto(15.5),cyto_nucl(8.5),mito(5),pero(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRG9 Uncharacterized protein Low 5 1 29-50 ETALVRDRRRRHSFHTARKLSC plas(21),E.R.(3),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVN4 Zn(2)-C6 fungal-type domain-containing protein Low 6.4 1 360-384 RKSTSCSQCHARKQKCNQEHPCSRC mito(11),nucl(4),plas(4),cyto(2),extr(2),pero(2),E.R.(2),cyto_pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZ93 Uncharacterized protein Low 8 1 306-328 VDQAHCRVPKRPNARNKGKAMAG extr(26) RPNARNKGK (316-324, prob:0.666) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D125 Fungal_trans domain-containing protein Low 7.8 1 18-48 FSPRTIPSRLQPWKRECRPVRAERPRPAASV nucl(7),mito(6),plas(4),cyto(3),golg(3),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCJ8 ANK_REP_REGION domain-containing protein Low 6.8 1 283-309 LAFPTRICGRPARRRLRHDKPVNETIL cyto(11.5),cyto_nucl(9.5),nucl(6.5),mito(5),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFS5 Uncharacterized protein Low 8.6 2 27-49, 482-502 LSLASKAYYRRFRRYLRREVVIQ, ASIRRGCQYKRERSMKVRDDT cysk(9),cyto(6.5),cyto_nucl(6.5),nucl(5.5),extr(3),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHV7 Fungal_trans domain-containing protein Low 8.5 1 867-887 SLSDSVRKRLRQRMPPAAPYT nucl(9),cyto(8),mito(6),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CI18 3'(2'),5'-bisphosphate nucleotidase Low 8 1 344-369 GAVKTVLKLRYKKKKPSRVAHLPDLL cyto(20.5),cyto_nucl(11.5),mito(5) KKKKP (355-359, prob:0.706) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CN49 Cytochrome c1, mitochondrial Low 5 1 290-315 LSVWVKRYKWSPIKTRKIVYNPPVSR mito(15),cyto(6),plas(3),cyto_nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPU5 Uncharacterized protein Low 6.5 1 352-377 QNMPNVKVFPKKQKRMDQDEELGRKK mito(18.5),cyto_mito(10.5),nucl(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQB0 Uncharacterized protein Low 9.9 1 553-577 ADSGPGMHKPRKRRRGRMGDVTYLE mito(15),nucl(5.5),cyto_nucl(5),cyto(3.5) GMHKPRKRRRGR (558-569, prob:0.934) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CY54 Uncharacterized protein Low 7.7 1 1-21 MPHLHHRRRHSWPYSGPRKQP mito(15),nucl(8.5),cyto_nucl(6),cyto(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYQ1 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 Low 8.2 1 2-26 DAAPPTNTLKQPKKRFVGKRTADAQ nucl(11.5),cyto_nucl(10.5),cyto(8.5),pero(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDY4 Uncharacterized protein Low 8.9 1 26-47 RPASSSVSRRRQVRNGSRQELS nucl(14.5),cyto_nucl(12.5),cyto(7.5),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CE75 Uncharacterized protein Low 8 1 232-275 SAKSYNRRNRWLAWRKRQARAERAAQMKSLKNKKKASKKAKGGR mito(26.5),cyto_mito(14) NRRNRWLAWRKRQARAERAAQMKSLKNKKKASKKAKGGR (237-275, prob:0.998) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKY8 Uncharacterized protein Low 5.4 1 615-634 GTIWKTRGARVPKWRNDPLP plas(21),vacu(2),nucl(1),mito(1),extr(1),E.R.(1),mito_nucl(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLK0 Clathrin heavy chain Low 7.8 1 1606-1629 IEMLKKDNEERKKREVSQKTEEDN cyto_nucl(11),nucl(10.5),cyto(8.5),cysk(7) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CS42 Translation factor guf1, mitochondrial Low 8 1 626-652 ASDVSRRRKLLEKQKEGRKRLRAVGNV mito(21),cyto_mito(14),cyto(5) RRRKLLEKQKEGRKRLR (631-647, prob:0.882) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYI2 Uncharacterized protein Low 9.5 1 690-711 VGQGPKTVKQSPRVGKKQKPSA nucl(19),cyto_nucl(16),cyto(7) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8X9 60S ribosomal protein L10-B Low 7.6 1 1-31 MARRPARCYRYCKNKPYPKSRFNRGVPDPKI mito(13),nucl(7),cyto(4),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGH5 Uncharacterized protein Low 8 1 197-220 IQSRDSTRPMRARRRKDYLYFICR mito(23.5),cyto_mito(12.5) GKKKKNKQTEIEVPMRKKNATKKGKGKGSAPNRMP (146-180, prob:0.982) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQP1 S5A_REDUCTASE domain-containing protein Low 8 1 281-309 MASWALKKERRYRKEFPDKYKRKRFAMLP plas(18),E.R.(3),mito(2),vacu(2) KKERRYRKEFPDKYKRKR (287-304, prob:0.807) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CR79 DAO domain-containing protein Low 5 1 5-25 RACLSFPRIFRHPRRNFSSTR mito(17),extr(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSC7 3-isopropylmalate dehydrogenase Low 6.2 1 454-481 RKISRYRRYTVQSRKEKRWMRRQFLVLM cyto(15),cysk(7),nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CT60 Uncharacterized protein Low 8 1 337-361 SSESSGRRTRYTRRSRRSGTRSRRS plas(12),extr(10),mito(2),cyto(1),E.R.(1),vacu(1),mito_nucl(1) RTRYTRRSRRSGTRSRRS (344-361, prob:0.831) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUV0 Uncharacterized protein Low 8.5 1 222-245 QPMCKKFVFKTQKRRLEHKVQLRD nucl(11.5),mito(11),cyto_nucl(7),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZ41 Uncharacterized protein Low 6.9 1 38-65 NYVGAKREKPRRFWSRLWKHFKRFWICY cyto(8),plas(8),nucl(5),cyto_mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0Y9 Protein MGM1, mitochondrial Low 5 1 895-916 DGRSKRNSDRPLPSKEQRSRGW mito(19.5),cyto_mito(13.5),cyto(6.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9T5 F-box domain-containing protein Low 9.5 1 599-619 VELERRRTRLHRRNDNLRMRG nucl(16.5),cyto_nucl(12),cyto(6.5),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCR9 Pheromone-processing carboxypeptidase kex1 Low 5 1 539-561 GFFIWRSRRHHRGYRSVYNKNMS extr(9),mito(5),E.R.(5),golg(5),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLD7 Elongator complex protein 1 Low 9.1 1 1167-1199 TGKTTASRQTSKTRRREERKRARGKKGTVYEEE mito(11.5),cyto_mito(11),cyto(9.5),nucl(4) KTRRREERKRARGKK (1178-1192, prob:0.972) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRD3 Uncharacterized protein Low 6.7 1 415-441 LARARHRHEYPLRHECRRRPRAYCAGG cyto(12),cyto_nucl(10.333),cyto_mito(8.833),nucl(7.5),mito(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CS19 Uncharacterized protein Low 6 1 4-25 GILPRPRGRRFSSRRAWFPYCL mito(14),mito_nucl(9.833),cyto_mito(8.833),nucl(4.5),cyto(2.5),plas(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CS75 Uncharacterized protein Low 5 1 263-286 SVVFWKMYQRQRRLMLRKREEQTG plas(18),E.R.(4),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSL6 Kinesin motor domain-containing protein Low 9.6 1 629-654 DITEITTHSRRKKRTKTKSSDEECTL mito(19.5),mito_nucl(13.5),nucl(6.5) RKKRT (639-643, prob:0.68) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CV94 PNP_UDP_1 domain-containing protein Low 8.1 2 827-846, 868-895 EDKLYRSSYRHKHQDPQVCP, EDLGCDDRQLVRRRRRNRLNSPIVHIGL extr(8),plas(7),nucl(3),cyto(3),cyto_nucl(3),E.R.(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CW51 SEC7 domain-containing protein Low 7.2 1 1493-1512 DPSKEKTWTETKKRLERFLP cyto(12.5),cyto_nucl(12),nucl(8.5),cysk(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBX0 SMP-LTD domain-containing protein Low 8 1 782-803 LPYPEKFKKNSGPSVRRKPVPA extr(6),golg(5),E.R.(4),cyto(3.5),plas(3),cyto_nucl(2.5),mito(2),vacu(2) FKKNSGPSVRRKPVPASRPN (788-807, prob:0.786) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCH6 Uncharacterized protein Low 5 1 13-33 SLNFCLFRRRRHRTVEDEECA plas(15),mito(5),E.R.(3),cyto_mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNY4 Methyltransf_11 domain-containing protein Low 5 1 33-53 FEVFNRKTKHIQKDRAARNVE mito(22.5),cyto_mito(13),cyto(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNY7 L-ornithine N(5)-monooxygenase Low 9.2 1 196-223 SGCVGKELSKHKKKKKQQRRPVAIGDNE extr(7),plas(6),cyto(4),nucl(3),cyto_mito(3),cyto_pero(3) SKHKKKKKQQRR (204-215, prob:0.95) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPB8 RNA polymerase II subunit B1 CTD phosphatase RPAP2 homolog Low 5.9 1 20-39 STSSRSQPSRPAPPRPQASH mito(20.5),cyto_mito(11.833),nucl(3.5),cyto_nucl(3.333) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPW3 Uncharacterized protein Low 5 1 5-27 QLLPTLSRSPRQKPRYSVRPFYW plas(21),E.R.(3),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRB2 Uncharacterized protein Low 5.7 1 389-416 VTPLTPSRIVTRKQRKREAKENGLRVLN extr(16),plas(6),nucl(2),cyto(1),E.R.(1),vacu(1),mito_nucl(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZ02 Zn(2)-C6 fungal-type domain-containing protein Low 5.8 1 18-41 SCDLRTPRCARCIKRKIHCVYANA mito(23),nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZL2 Uncharacterized protein Low 7.7 1 108-127 GNNPWQRKAQWRRLRYVFSR nucl(9.5),cyto_nucl(9),mito(7),cyto(5.5),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7L6 Zn(2)-C6 fungal-type domain-containing protein Low 6.9 1 8-35 VRSPHRRSCLLCRSRKIKCDRQQPCAAC mito(19),nucl(5.5),cyto_nucl(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCB3 Uncharacterized protein Low 5 1 54-77 MLNDPEKSKKLRRRVDRILLPLLC plas(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CD82 Uncharacterized protein Low 7.3 1 782-808 KSDPSVKRSFRRMLKRPLDERRLFKEA nucl(7),cyto(7),cyto_nucl(7),pero(5),cysk(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJL3 Dynamin_M domain-containing protein Low 8.9 1 479-499 QSSQRRRSECHAPSRRPHGAS nucl(14),cyto_nucl(12),cyto(6),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CK21 Uncharacterized protein Low 7 2 23-51, 89-108 SQTSLERRQRWIEKRYRAREASKNNNCQV, PQPSGKTKIQHHHNHHHRPE cysk(12),cyto(5),mito(4),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMM1 Uncharacterized protein Low 9.6 2 127-148, 336-360 VAERSRIQKGKRRSVSQNTLIE, IGAHYRSPSSPRRNRKTDRLRTEVT cyto_nucl(10),nucl(9),cyto(9),plas(5),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CN35 Zn(2)-C6 fungal-type domain-containing protein Low 9 1 1-26 MYRSHRPCKARKVKCGEEKPACLNCR nucl(14.5),cyto_nucl(10.5),mito(6),cyto(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPP1 Cation_ATPase_N domain-containing protein Low 5 1 86-105 KEEAIKSKREKERHPDHDYF plas(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRN2 Serine/threonine-protein phosphatase Low 8.4 1 476-498 DSTALKNHIKKGRKERNSMLSSP nucl(13),cyto_nucl(12.5),cyto(8),pero(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSP6 PH domain-containing protein Low 9.3 1 101-121 TGTLKKKNSLSRKGSLRRSGS mito(16.5),cyto_mito(11.166),cyto_nucl(6.333),nucl(6),cyto(4.5) KKKNSLSRKGSLRRSGSRRSMR (105-126, prob:0.851) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CY41 Uncharacterized protein Low 5 1 33-55 SDLTVTVKDRRTKQPRNLIDGSS plas(23),E.R.(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7G9 MBOAT_2 domain-containing protein Low 5.8 1 2-26 PNPLQRLKQLMHKTRQRRKGALDIE plas(14),mito(7),nucl(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7N9 Biotin carboxylase Low 5.8 1 925-946 HAVTRKPFQNVRKQFRNQRFDP cyto(10.5),mito(8),cyto_nucl(7),cysk(4),nucl(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C809 Uncharacterized protein Low 8.3 1 32-52 TPTATSHRRSHQHSNHARPSP nucl(13),cyto_nucl(12),cyto(9),mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C990 Uncharacterized protein Low 8 1 380-417 GGESPVNYPRRRRKRAMLLKEKKWRHRLGIWRRKNVED plas(27) RRRRKRAMLLKEKKWRHRLGIWRRK (389-413, prob:0.98) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAJ5 Cell division control protein 12 Low 8.3 1 43-67 FSTTIKNYADHKRRHQKQIDRTVEI cyto_nucl(13),nucl(12.5),cyto(12.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBA4 Fungal_trans domain-containing protein Low 6.6 1 14-36 FDPVPPCRLRQRNTHLKPPGFRE mito(8),extr(5),nucl(4),cyto(4),cyto_nucl(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBD5 Protein-L-isoaspartate O-methyltransferase Low 6.8 1 260-284 RDYVPLCRTRYPRRRWVGCDNCSQR mito(15),nucl(5.5),cyto_nucl(5.5),cyto(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CET1 Abhydro_lipase domain-containing protein Low 8.8 1 152-172 ERQSNSQKWERRQEKKEVDEE plas(23),nucl(2) RERRARGPRVFAERKGA (232-248, prob:0.779) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CF23 Uncharacterized protein Low 9.1 1 223-247 YDDGPTRSSKPPKLKSKIARLMRVG nucl(18),cyto_nucl(13.833),cyto(7.5),cyto_pero(4.666) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHK1 NADH-ubiquinone oxidoreductase 19.3 kDa subunit, mitochondrial Low 9.8 1 288-307 IFQLQKKMRHTRITRMWYRR nucl(13),mito(7),cyto(4),extr(1),pero(1),cysk(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHS0 Uncharacterized protein Low 5 1 15-34 GTNHCTERRIHPRRESLHDD cyto(15.5),cyto_nucl(9.5),pero(5),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIE2 Probable endonuclease LCL3 Low 6.9 1 714-733 DNDWYRAKIRRNDRDNKQAE cyto(15),cyto_nucl(13.166),nucl(10),cyto_mito(8.666),mito_nucl(6.166) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJS6 Hydroxyacid-oxoacid transhydrogenase Low 5 1 27-48 HPPSCPCHSNPNHHHHHRSPTL mito(23),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMV4 Uncharacterized protein Low 8 1 277-300 SQPGEEKRKRIRWKVKSDEQRQSL plas(24),E.R.(2) RKRI (284-287, prob:0.639) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTE7 Protein kinase domain-containing protein Low 8.1 1 710-730 ETNRKREKRYSSSAKHNKRSS nucl(11.5),mito_nucl(10.5),mito(8.5),cyto(7) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUQ3 Uncharacterized protein Low 8.4 1 482-502 SLETTRDLSKRKARDQRDRAV nucl(12),cyto_nucl(10.5),cyto(7),pero(4),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYJ4 Uncharacterized protein Low 8.9 2 32-56, 580-605 TEASWTRPAPKPKPKGPLINFNRHP, ATGLSRKKSKLVKQKTQKKNSYGVLR plas(19),nucl(5),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0P1 Uncharacterized protein Low 8.8 1 207-227 EDPMRMKKRRQIWFKRFHNTL plas(12),nucl(10),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CB85 TauD domain-containing protein Low 6.4 1 136-161 ISSEQRKTLYRDRNNRKQSSRREWHS cysk(13),cyto_nucl(6.833),cyto(6.5),cyto_mito(5.166),nucl(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CD25 Ppx-GppA domain-containing protein Low 8 1 559-583 ELEKDLKKIKKVGKKKHWIGGRHGW cyto(11.5),plas(7),cyto_nucl(7),pero(5),mito(2) DLKKIKKVGKKKHWIGGRH (563-581, prob:0.955) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CM66 Phosphatidylserine decarboxylase proenzyme 1, mitochondrial Low 5 1 39-61 RKPSARQFSKSWKQYNNNNNQEH mito(18),extr(5),cyto(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMB1 Uncharacterized protein Low 5 1 475-497 LGVSEQRKANQRKDDERRMAKFH plas(24),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRE4 ANK_REP_REGION domain-containing protein Low 7 1 11-34 GSDWAAIQSRKRKRDQEGKDSDVY plas(8),cyto_nucl(7),nucl(6.5),cyto(6.5),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRH7 Uncharacterized protein Low 8 1 668-696 TQLHNAKRWIHDRRKAKRQPHTEICRHSE plas(10),mito(4),extr(4),pero(4),cyto(2),E.R.(2),mito_nucl(2) K (682-682, prob:0.603) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSD5 Uncharacterized protein Low 8.8 1 1-22 MSIRQKVRKVFHRQSSNAKAKE nucl(15),cyto_nucl(12),cyto(7),mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CW22 Uncharacterized protein Low 7.2 1 938-962 LNERIKHTRDFKKKGFKGNSRGNHI mito(8),nucl(6),cyto(5),pero(4),plas(1),golg(1),cysk(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C904 Alpha-galactosidase Low 8 1 1-28 MGFLSRLRKRSKSQSRVRRNPSWDLRFE nucl(12.5),mito_nucl(12),mito(10.5),cyto(2),pero(2),cyto_pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCC1 Zn(2)-C6 fungal-type domain-containing protein Low 7.8 1 4-61 QRPGSACEECRRRKVRCDRRRPQCQVCFENGIECKINTTRLPRGPRKGQLRTLRTRIA plas(16),nucl(8.5),cyto_nucl(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CH16 Uncharacterized protein Low 8 1 162-183 HLDTKHKCRKFDKIVEWEKKNQ nucl(11),cyto_nucl(10.5),cyto(8),mito(4),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CH27 Uncharacterized protein Low 8.1 1 293-316 VYPAWWLRQRRYRPVPRRPVDFRV mito(12),nucl(8),cyto(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CI00 Uncharacterized protein Low 8.9 1 9-76 LNPNTPRKPSEHPHRPLPNQPEFGKPSPIRPVHHHNQRPSNPFNIPKPNRARPEHHRPPPQSRPQGSV nucl(15),cyto_nucl(12),cyto(7),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CN05 Uncharacterized protein Low 9.8 1 124-147 VSDTTKWLKQRKRKRGVNNDDVEK cyto(16),cyto_nucl(12.5),nucl(7),pero(4) RKRK (134-137, prob:0.646) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CP72 Ras-GAP domain-containing protein Low 8.1 1 631-655 HNVRSQSEGKSRKQQKHQELGPYKF nucl(16),mito_nucl(12.666),cyto_nucl(9.666),mito(8),cyto_mito(5.666) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPT8 Peroxin/Ferlin domain-containing protein Low 9.3 2 405-424, 466-489 QDGWDRYTRRRRWCRDAELI, SLAPSISSSKPRRRRWFGSSKSVS plas(15),nucl(6),E.R.(3),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRI1 WD_REPEATS_REGION domain-containing protein Low 7.1 1 480-504 VYGATDKFRQNRKKSFRGHNNAGYA cyto(10.5),cyto_nucl(9.5),pero(8),nucl(7.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUI9 Delta(24(24(1)))-sterol reductase Low 7 2 1-22, 49-69 MTVTRSQTGKTPKKMDRPGFVE, DVRGRSKSATRSRRTPARVKT plas(24),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVN9 Uncharacterized protein Low 8.2 1 1256-1279 FNCSFCGRRFARKNDVRRHEQTVC nucl(11.5),cyto_nucl(9),cyto(5.5),pero(2),plas(2),mito(2),extr(1),E.R.(1),golg(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CY12 Galactose-1-phosphate uridylyltransferase Low 6.9 1 23-43 LVSPHRTKRPWQGQQESPSKT cyto(12),cyto_nucl(10.833),cyto_mito(8.833),nucl(8.5),mito(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYW5 Uncharacterized protein Low 9.9 1 285-309 DEPYCAPYSRRREERMRGQRRGVSV nucl(17.5),cyto_nucl(10),mito(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CC70 Uncharacterized protein Low 8 1 16-57 RTGQARKRARVAQRAECRRSFVVPRTRRRRSRTVRRRLLLLP plas(13),mito(8),E.R.(3),cyto(1),golg(1),vacu(1) VPRTRRRRSRTVRRR (38-52, prob:0.875) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFZ6 Uncharacterized protein Low 9.9 1 522-551 FTRRSNCHEHMKRHDPSRKNLHRCDYCGKT nucl(20.5),cyto_nucl(15),cyto(6.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKT2 CUE domain-containing protein Low 9.9 1 297-321 ESRSFHHRYQKQKTKPDKGKSRDSG nucl(19),cyto_nucl(13.5),cyto(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLW7 Uncharacterized protein Low 8 1 171-201 KETVVRRRSHSSRRGHGHRRHSSSSRRPHYV plas(22),mito(2),E.R.(2) RRSHSSRRGHGHRRHSS (177-193, prob:0.805) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQ36 PHB domain-containing protein Low 6.2 1 32-52 TPALNRVRRRHVSTSPRRLAP mito(22),nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CS85 Zn(2)-C6 fungal-type domain-containing protein Low 7.1 1 15-48 AINVCLACREQKRKCDKRLPACSRCVRLKRSCNY cyto(8),mito(7),cyto_nucl(7),nucl(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CW35 Uncharacterized protein Low 7.8 1 14-46 LGKKDDDHKRRSDREHLWHSKSQWRLPRRRSLL plas(11),nucl(7),cyto(4),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWK2 Amino_oxidase domain-containing protein Low 5 1 637-658 FSTCTDSCPKKRQAQATRGALY mito(7),extr(7),plas(6),cyto(3),golg(2),cyto_pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXY5 Alpha-1,3-glucan synthase Low 8 1 1736-1756 GPGHLVRRGRRRLRRSYIGNE plas(18),extr(4),vacu(3) PGHLVRRGRRRLRR (1737-1750, prob:0.831) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYX7 Protein kinase domain-containing protein Low 8.5 1 83-102 VGLPRSTTFKRQNSERRDNL nucl(15.5),cyto_nucl(13.333),cyto(10),cyto_mito(5.833) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8Y1 F-box domain-containing protein Low 8.8 1 7-37 LESFRRQWREEVARRTKQNKPSPSQSKPSAS nucl(15),cyto_nucl(13),cyto(7),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C962 RelA_SpoT domain-containing protein Low 6.6 1 51-72 AASLEKKLYARQKERPQPYKSI cyto(13.5),cyto_nucl(10),nucl(5.5),pero(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGR6 Malate synthase Low 5.6 1 38-57 RTFNPTRKALLQRRIDRQAE pero(12.5),cyto_pero(10.333),cyto(7),cyto_nucl(5.333),cysk(3),nucl(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGW8 Uncharacterized protein Low 9.2 1 17-44 ALARLQSKRNLPRNPSKRTPHRDSRANT nucl(11),mito(10),cyto(3),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHS2 Siderophore iron transporter mirC Low 8 1 250-270 NQRRARKLKLIKQKSLRRRGL plas(24),E.R.(2) RRARKLKLIKQKSLRRR (252-268, prob:0.839) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CI21 Probable feruloyl esterase B-2 Low 5 1 493-518 GSTVEYSRKHCRYPRRNVFKGPGNYT extr(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CM30 Uncharacterized protein Low 9.8 1 503-551 NWSSVSRRCRTSRRASTWRTPSSGTRTTRPVRRVRRRGWRSGTRWSIRG cyto(8),mito(7),nucl(5),extr(4),cyto_pero(4) RPVRRVRRRGWR (531-542, prob:0.796) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CP70 Uncharacterized protein Low 7.9 1 144-163 QARDRRTRSRRDLSRSDRKL mito(12),nucl(11),cyto_nucl(10.5),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQI0 Uncharacterized protein Low 5 1 493-514 WQNSSFYSRWRARRNQQSSTTG plas(21),mito(2),cyto(2),cyto_mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZQ0 Uncharacterized protein Low 8.8 2 15-42, 350-369 SLAVVKYRKDKSPPSKKPNCNDLKRMAP, PRALEFCEKKRQQQQEKMEV mito(16),nucl(5.5),cyto_nucl(5),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1K4 Uncharacterized protein Low 7.1 1 453-472 PSLPRFRHLHHKDQEGKLRQ cyto(12),cyto_nucl(10.833),nucl(8.5),cyto_mito(7.333),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CC43 Uncharacterized protein Low 8.7 1 760-781 GSFVGRRSPKRHRDNSFPMEKI nucl(13),cyto_nucl(11.5),cyto(8),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCM9 CTP_transf_like domain-containing protein Low 8.5 1 1-21 MSSPSTAHKRKRSASQHITAD mito(15),nucl(9),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDK8 Uncharacterized protein Low 5 1 1-21 MNARRIRYRIFPCRLNRRWSI extr(10),golg(8),mito(3),plas(3),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKF3 Uncharacterized protein Low 5 1 275-294 TPRSCRHPFLRPLHPRSPRP extr(10),golg(5),plas(4),E.R.(4),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CN32 Presequence translocated-associated motor subunit PAM17 Low 5 1 226-247 QGYRQWLKDQRAYNRKRRHFIL extr(13),plas(6),mito(4),E.R.(2),mito_nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNA7 PPM-type phosphatase domain-containing protein Low 6.6 1 15-34 ALNKLFPKRASRNHNNSSLQ mito(15),plas(6),nucl(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTY3 Uncharacterized protein Low 9.4 1 16-43 TADSDSQDQKKPRRSQRITSQSQKQATP nucl(15.5),cyto_nucl(11),cyto(5.5),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVG7 Uncharacterized protein Low 5 1 49-72 KDNTSGARPRRKLRSAKWFNCEDN cyto(13.5),cyto_nucl(8.5),mito(7),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVS7 Uncharacterized protein Low 7.2 1 12-32 ETVGNTPKGGRKNRNKDQSGD mito(11),cyto_nucl(8.5),nucl(7.5),cyto(6.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWB9 LDB19 domain-containing protein Low 9.5 1 63-90 VEHLIHRDHHKDKRRIRGRSSHSKERSG mito(20),nucl(4),cyto(2) HKDKRRIRGRSSHS (72-85, prob:0.832) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZN4 N-acetyltransferase domain-containing protein Low 8.2 1 11-36 VVHTGRSGNKKRAQPQPRQGRPYGRG nucl(11.5),cyto_nucl(10),cyto(7.5),pero(4),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAB3 TPR_REGION domain-containing protein Low 8.8 1 775-794 RSDSRKLRKRSSTLKNQDAT nucl(13.5),cyto_nucl(9),mito(4),cyto(3.5),pero(2),plas(1),extr(1),cysk(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBM6 MFS domain-containing protein Low 5 1 21-45 DRHIRPTEDVRPKSRKKLVQQVVVI plas(23),E.R.(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFI6 CAP10 domain-containing protein Low 5 1 83-108 HDVKNASSRYRQRRGRHPPPGFDKWF golg(8),extr(6),E.R.(5),mito(4),plas(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGI0 Uncharacterized protein Low 7 2 513-534, 550-578 LPFQIRPERRALHRRRHDDTAQ, QLVAGKSARDPRHRHQRYRLRSSCDGRAD plas(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJF5 HET domain-containing protein Low 8.2 2 1-26, 513-536 MAENLCSKCRKIPRPRYFTRNSNFPS, PGRQREIKTRKHDLFKRRARMERS mito(21),nucl(3),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLS3 Mannose-P-dolichol utilization defect 1 protein homolog Low 8 1 256-282 LYYWNTPSKTKKQPARKQTEKPAAVKS plas(15),E.R.(10) TKKQPARKQTEKPAAVKSTGASPKPSGRTPTTRRRG (265-300, prob:0.816) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNY2 40S ribosomal protein S7 Low 9.1 1 104-127 PRPKRSVNSRTNQKQKRPRSRTLT cyto(11.5),mito(9),cyto_nucl(8),nucl(3.5) PRPKRSVNSRTNQKQKRP (104-121, prob:0.677) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CR94 Fungal_trans domain-containing protein Low 7.3 1 448-467 GASGRSKKRRLNEASPRPDG nucl(6),extr(6),mito(5),cyto_nucl(5),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CU53 Phosphoinositide 5-phosphatase Low 5 1 1145-1165 LTDRATPKSQWRNPAVNKHQE extr(17),mito(3),cyto(3),cyto_mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXE8 Uncharacterized protein Low 9.5 1 93-115 LTNPHPHLAKKHKKRIATHKDLH mito(20),nucl(4),cyto(2) KKHKKR (102-107, prob:0.711) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZE2 Zn(2)-C6 fungal-type domain-containing protein Low 8.8 1 16-47 EDRSNPRRSNVACNRCRNRKTRCAGNPPYPCA plas(16),nucl(10) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0Z3 Protein kinase domain-containing protein Low 9.8 1 174-194 ASSSPQKYRNHRGQPLNTREG nucl(13),mito(7),cyto(4),plas(1),extr(1),pero(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9T4 Zn(2)-C6 fungal-type domain-containing protein Low 9.3 1 22-53 GARPYRSHKVRACDLCRKRKSRCTVDIPGQSC nucl(14.5),cyto_nucl(9.5),mito(6),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAM0 Uncharacterized protein Low 8.9 1 345-365 GCQGCNCKRRVRSWSVKPTLI nucl(11),cyto(7),mito(5),cyto_pero(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDK5 Uncharacterized protein Low 6.5 1 287-308 HHGNHLRRLRFRRTRCSFLERP cysk(14),nucl(4.5),cyto_nucl(4.5),cyto(3.5),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQJ7 Uncharacterized protein Low 5 1 336-360 SPDPSWKPQRPRKWYEKSPNQSTSS plas(20),E.R.(4),mito(1),cyto(1),vacu(1),cyto_mito(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CR72 MMS1_N domain-containing protein Low 7.9 1 1181-1206 RDPIISPFTTKRKRQRNPVGNDPLQF nucl(8),cyto(7),mito_nucl(7),mito(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTG9 TauD domain-containing protein Low 7.6 1 17-38 QYHPDYQKYKARTQRRKATEDL cyto_nucl(10),nucl(9.5),cyto(9.5),mito(4),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWU1 J domain-containing protein Low 9.9 1 33-53 GDPRPQPPSPRYARHRRRIFI mito(11),nucl(5),plas(4),extr(4),pero(2) RKKREKKG (349-356, prob:0.753) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZJ4 HET domain-containing protein Low 7.9 1 80-99 EAALKCLRHARKKRLIWIDF cyto_nucl(11),nucl(10.5),cyto(10.5),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAT0 DUF2236 domain-containing protein Low 6.3 1 404-429 VPFFTRTTRLGKRKNQKTNKRGIEAL mito(11),plas(7),nucl(4),cyto(4),cyto_nucl(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CC14 ANK_REP_REGION domain-containing protein Low 5.8 1 238-259 APKTVEAEKKRCKNSFRRQDDP cyto(8.5),cysk(8),cyto_nucl(6),pero(4),mito(3),nucl(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CE96 O-acetylhomoserine Low 9.4 1 193-223 LRRRRLLLPPHRARRRHRRAQRHQNDRDTAR cyto(12),cyto_nucl(9.5),mito(6),nucl(5),pero(3) EKGRQHLRRRRLLLPPHRARRRHRRAQR (187-214, prob:0.989) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHM3 Uncharacterized protein Low 8 1 454-480 SETPLGRGERSKRKRRFRSLSPLGRGG mito(21),cyto(4) RGERSKRKRRFRSLSP (460-475, prob:0.933) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMH7 Uncharacterized protein Low 5 1 9-35 SYDDPSKWLKKIKQQRLKGGKTLRTLC plas(24),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CN43 WD_REPEATS_REGION domain-containing protein Low 7.5 1 1-26 MATLLPPPTKRQKREQDEKARLQQEI mito_nucl(8.166),nucl(8),mito(8),cyto_nucl(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRY2 Zn(2)-C6 fungal-type domain-containing protein Low 9.8 1 18-43 RPPLSCASCRSRKIRCDRVQPCSNCT nucl(13),mito(4),cyto(3),plas(2),pero(2),E.R.(1),golg(1),cysk(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZA3 Uncharacterized protein (Fragment) Low 8.6 1 1-27 MSPLNSTSTRKRGRPPKYQSAEERQAA mito(12),nucl(9),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZC5 Peptidase_M24 domain-containing protein Low 5 1 14-33 EERPGDRRPWQAKRAKQVLF plas(13),mito(4),E.R.(3),vacu(3),mito_nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAA1 Zn(2)-C6 fungal-type domain-containing protein Low 9 1 60-80 CETCRLKKTRCDESRPKCGLC nucl(10),plas(8),mito(5),golg(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CG71 Uncharacterized protein Low 5 1 50-77 PRQYLDIFRRSKRPKRTILKNINGQVRP plas(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CH04 Uncharacterized protein Low 9.5 1 271-297 ARIMAAPKPKKAKRMSKKPAPRPGEDE plas(14),nucl(4.5),cyto_nucl(4.5),cyto(3.5),E.R.(3) APKPKKAKRMSKKPAPRP (276-293, prob:0.98) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CK61 Homogentisate 1,2-dioxygenase Low 5 1 431-450 EYNEHSWRPLKRHFKNPNKA cyto(11),pero(10),cyto_nucl(7.5),extr(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQI8 Spo7_2_N domain-containing protein Low 9.8 1 46-72 IPKGWLQNHRKSWYKTRIKFRNYTSRT nucl(17.5),cyto_nucl(12.5),cyto(6.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CT73 Uncharacterized protein Low 5 1 1-23 MTLGWRRSHRRHHAAKDSLERCN plas(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CES5 Uncharacterized protein Low 6.5 1 246-268 TPSSIFSRRRTKRPSSPPRDILS extr(11),cyto(7),nucl(4),cyto_mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIQ1 U2 snRNP auxiliary factor large subunit Low 7.6 1 17-36 VSVLHRKRRLTQWDIKPPGY cyto(13),nucl(9),mito_nucl(8),mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CP18 RING-CH-type domain-containing protein Low 5.8 1 459-486 VLYCRWKLAQTHRRRRVLNYDRTKKQVV mito(11),cyto(7),extr(3),nucl(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQS2 Aminotran_1_2 domain-containing protein Low 5 1 68-87 ECNQYSPTKGRPRLKKAIAD mito(14),cyto(10),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUU0 DNA primase large subunit Low 9.7 1 3-26 RQDFHRIDPKRRANLDHKKKQFAA nucl(18.5),cyto_nucl(12),cyto(4.5),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CV23 Fatty acid hydroxylase domain-containing protein Low 5 1 295-317 DHDLHHRKGWRKSHNYGKQTRLW mito(15),pero(5),plas(3),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CW62 Uncharacterized protein Low 6.5 1 115-135 IPVPRRHRTVRESRKLPRGNH mito(7),nucl(4),cyto(3),plas(3),extr(3),E.R.(3),golg(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZ56 MFS domain-containing protein Low 5 1 818-838 LKQRLGRRYAVRRTCPRQEET plas(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZN6 2-isopropylmalate synthase Low 6.5 1 1-28 MPMLKDPSKKYKPFKPLHLPNRQWPDKV plas(8),cyto(6.5),cyto_nucl(6),nucl(4.5),mito(4),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C910 Uncharacterized protein Low 5 1 252-272 VLNYLTQRRWERKEREERARL cyto(8),extr(7),cyto_mito(7),mito(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCV3 Uncharacterized protein Low 9.8 1 40-70 TSTSASRTAGRCRRRRRRRRRQTLAQQAVDA mito(18),nucl(5.5),cyto_nucl(4.5),cyto(2.5) RCRRRRRRRRR (50-60, prob:0.962) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CEN4 Zn(2)-C6 fungal-type domain-containing protein Low 9.6 1 1-37 MSEKQQNARRRVKTRSGCLRCKQRRIKCDETVPHCNQ nucl(17),cyto_nucl(11),mito(6),cyto(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQM0 AKAP7_NLS domain-containing protein Low 9.6 1 162-182 YVKGRTPKRGNAKGNNRRNQH nucl(18),cyto_nucl(12.5),cyto(5),mito(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRW8 Uncharacterized protein Low 8 1 5-46 STSSLPRKKVKAGAKKAGKKTGKKTTGKKKTTPSAIGNRKGK plas(19),mito(4),E.R.(2),cyto_mito(2) PRKKVKAGAKKAGKKTGKKTTGKKKTTPSAIGNRKGK (10-46, prob:0.998) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSF8 Uncharacterized protein Low 8 1 468-491 GMVVYGKRIRRKTARRYREMAAKG plas(24),E.R.(2) KRIRRKTARRYREMAAKGRA (474-493, prob:0.895) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSM8 CRAL-TRIO domain-containing protein Low 8.5 1 45-73 DAPAPPSPTQDKKKQSKRRFTFWGKSNEE cyto(11),nucl(9),pero(4),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTG0 AP-1 complex subunit gamma Low 9.7 1 616-640 GAPTKKRQSKVLKDKTKKPAKQAEQ mito(15),cyto_nucl(6),nucl(5.5),cyto(5.5) KKRQSKVLKDKTKKPA (620-635, prob:0.787) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUB3 ANK_REP_REGION domain-containing protein Low 6.2 1 590-611 TVSWMLQQAKKRRQGRVAARWI cyto(13),pero(6),cysk(4),nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8Y3 Uncharacterized protein Low 7.9 1 965-1016 VLFYPLKRMFHREKKTKKAPSVSTQSTHRRDRFSRYRRYQKQLENDIWKRHE plas(10),nucl(8),cyto(4),E.R.(2),vacu(2),cyto_pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9P4 60S ribosomal protein L34-B Low 8.1 1 1-22 MANNRLQYRRRNPYNTRSNKVR nucl(11),mito(8),cyto(8),cyto_mito(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMU8 Uncharacterized protein Low 7.4 1 795-815 AQQQDHQGSRRRSRRMSSFLR mito(11),nucl(7.5),cyto_nucl(6.5),cyto(4.5),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVQ1 Mitochondrial 18 kDa protein Low 8.9 1 275-300 SWEEYKEERRRAKEQRRHQRETDGRG cyto(13),mito(9),cyto_nucl(9),nucl(3) RRAKEQR (284-290, prob:0.641) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXW6 MFS domain-containing protein Low 5 1 419-441 VRCMRFPFYCKRRERVRGGYVSE plas(20),E.R.(4),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CH03 Uncharacterized protein Low 6.8 1 171-193 RPLNQYLPKKKVKKLKNLLSSSE cyto_nucl(7.5),cyto(7),nucl(6),mito(4),extr(4),E.R.(2),golg(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIU4 FHA domain-containing protein Low 8.9 1 493-518 VVNDLRKPGLRNCRKQHKQYFWRKPK nucl(13.5),mito(9),cyto_nucl(9),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKA6 Arf-GAP domain-containing protein Low 6.9 1 23-46 LDYNKTCADCKRNKHPRWASWNLG mito(16),nucl(5),extr(3),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CL39 Uncharacterized protein Low 8.7 1 72-92 NESRRQVRRHAMRQYMHQRRL nucl(13),cyto_nucl(10.5),cyto(6),pero(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CP20 Zn(2)-C6 fungal-type domain-containing protein Low 9.6 1 8-47 PSYDAYWQAKRRKVRKGTHSCWECKRRKMKCIFDPRIASA nucl(12),mito(8),cyto(3),plas(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CT71 tRNA (guanine-N(7)-)-methyltransferase Low 8.7 2 1-21, 34-54 MGNSRNKRGKREANRQRTVEA, ALQLPQKKFYRQRAHANPFSD mito(14),nucl(5),cyto(5),cyto_nucl(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZ31 Uncharacterized protein Low 9.1 1 417-447 GAGGRSDRRRDERRHGQRPNAPKKGRRGHLQ mito(21),nucl(3),extr(2),cyto_nucl(2) RSDRRRDERRHGQRPNAPKKGRRGH (421-445, prob:0.973) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CN76 C2H2-type domain-containing protein Low 8.6 2 3-28, 30-50 VICRMPKPVYLCQKHRQRLTWCRFED, GSKPFICKQCHRPFARQDALT mito(17),nucl(4),cyto(2),plas(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQR9 Uncharacterized protein Low 5 1 719-742 WCLINRCRRARPAAKMPPPPPRGP extr(24),mito(1),E.R.(1),golg(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRH4 Zn(2)-C6 fungal-type domain-containing protein Low 9.4 1 9-47 VLSPKEKKRTRVQLSCTACRSRKLRCCRTHPCTNCIKRD nucl(15.5),cyto_nucl(11),cyto(5.5),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTK9 Uncharacterized protein Low 8.2 1 6-27 VTSFPRRPRLHLRSEDQRREFP mito(17),nucl(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CU77 Uncharacterized protein Low 6.4 1 458-477 LTDRWCHRCHKWFCNTCLPR cyto(13.5),cyto_nucl(10.833),cyto_mito(8.166),nucl(6),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CV36 Uncharacterized protein Low 5 1 290-312 GVPRCGPLRPERRQQLHDRQLAA mito(23.5),cyto_mito(13) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXP1 Uncharacterized protein Low 5 1 43-63 SDPTTLRRDVHSRRRGRPFPA mito(23),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CY82 Mannan endo-1,6-alpha-mannosidase Low 9.9 1 101-125 VPFGTSSPRSRRREPPKPSTRVQTP cyto(7.5),cyto_nucl(7.5),nucl(6.5),mito(5),plas(3),golg(1),E.R.(1),pero(1),extr(1),cysk(1) RSRRREPPK (109-117, prob:0.697) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZ42 DUF2236 domain-containing protein Low 7.3 1 179-202 VALRVPREKWPKNRKAFWKYWNKT mito(9),nucl(6),plas(6),cyto(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZ81 MFS domain-containing protein Low 5 1 516-536 ILFRRRVPARKWKQTVVDIRD plas(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8V2 Uncharacterized protein Low 7 2 71-90, 103-123 GNPQEGRRRLPRRSYTNISA, LSGSLRRSRHHSRANSQNLRF plas(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9Q3 Alkaline phosphatase Low 6.1 1 433-455 QDYLAVEKKKNKQKKFVRELLVE mito(8),plas(4),cyto_nucl(4),nucl(3.5),cyto(3.5),golg(2),pero(2),extr(1),E.R.(1),cysk(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAB0 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase Low 5 1 8-28 QAFRCAVRRPVARRNLCERKF mito(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKD5 TPT domain-containing protein Low 8 1 83-113 EETGLTAKQRRQRRRRRRQQRRQLDARIADV plas(20),E.R.(4),mito(1),extr(1),vacu(1) KQRRQRRRRRRQQRR (90-104, prob:0.967) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLH6 Uncharacterized protein Low 9.6 1 370-390 EGPIGPVRRTRERGNCRRRIY nucl(18),cyto_nucl(12.5),cyto(5),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLW6 acidPPc domain-containing protein Low 5 1 1-24 MDRLPDKLPFSKRRLRPRIIISYV plas(14),mito(3),extr(3),E.R.(3),vacu(2),cyto_mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CM86 Uncharacterized protein Low 9.4 1 80-99 EVKMRRWRHRIQQRLICPPR nucl(17.5),cyto_nucl(12.5),mito(5),cyto(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CV05 Fungal_trans domain-containing protein Low 5 1 43-62 KSKYLSQKVKLRRTPPWPTS plas(13),E.R.(5),mito(4),vacu(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVW8 Uncharacterized protein Low 5 1 354-373 PAPARVKTSKQPGKNPGPRL extr(13),plas(10),E.R.(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CX29 Uncharacterized protein Low 8.8 1 85-116 SPPAVPPRKVRGTSRRRRRKGAWKKLLWVKQS plas(23),nucl(2) VPPRKVRGTSRRRRRKGAWKK (89-109, prob:0.991) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZ79 ATP-grasp domain-containing protein Low 5 1 4-26 GTKDRNPRFRTLQHKNNLQNSPR mito(17),cyto(4.5),cyto_pero(4.5),pero(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D149 Uncharacterized protein Low 8.3 1 243-264 GHASRQRTKEHQHKREDTLRQE nucl(12),mito(12),mito_nucl(12) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D200 NACHT domain-containing protein Low 6.4 1 35-60 ILSLLQKSRPKDPKSKRQVAWSTLKS cyto(6.5),cyto_nucl(6),plas(5),nucl(4.5),golg(4),E.R.(3),mito(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCC5 Uncharacterized protein Low 6.6 1 231-251 VVKTRISKKYAPRPNAQHRPA cyto(12),cyto_nucl(10),nucl(6),mito(5),plas(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDS7 FAD-binding FR-type domain-containing protein Low 5 1 39-58 FTGRTIVRIRHHRRLREALD plas(20),E.R.(4),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJA0 Zn(2)-C6 fungal-type domain-containing protein Low 6.2 1 1-45 MVRESGRSRGCKPCRQKRIKCDEKEPECGQCVRRGRKCPGPLRGL plas(22),nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKE3 Uncharacterized protein Low 8.6 1 2-22 AQDHVGSKKRRREPVNVDTRL nucl(12.5),cyto_nucl(11),cyto(8.5),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLN1 Uncharacterized protein Low 9.7 1 356-381 LSDTLDKGVRKRHRRLRWIRRTGFVM cyto(9.5),cyto_nucl(8),mito(7),nucl(5.5),pero(2) RKRHRRLRW (365-373, prob:0.788) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTY5 Protein FYV4, mitochondrial Low 8 1 220-242 GGERRRAEVRAKKRSEERKKGTA mito(24),cyto_mito(13.5) GERRRAEVRAKKRSEERKKGTA (221-242, prob:0.973) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUY7 Uncharacterized protein Low 9.7 1 200-219 SCPMTERRPSRNQRRLVAES nucl(17),cyto_nucl(10.5),mito(5),cyto(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CX00 TPR_REGION domain-containing protein Low 9.4 2 161-181, 358-380 TTMARRTKWAIHDKKKFQDLV, AAFEPYHKRRYKRQQRLDEYDIE cyto(15),nucl(6),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0C2 Uncharacterized protein Low 5 1 451-470 VPPPPAATRRPTRRRGSTAF plas(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAQ7 Arylsulfatase Low 6.2 1 553-576 EGAQSIHPYKRKQRRIFDYGDHLG extr(17),nucl(3),mito(2),pero(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBR6 VOC domain-containing protein Low 6.2 1 473-492 ASSRRSSHSHRSRASKHSHV extr(18),mito(4),nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCH1 Uncharacterized protein Low 7.4 1 880-899 VKLYNLKRDRLRFNHDPKAR mito(10),nucl(7),cyto_mito(7),cysk(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDV8 Uncharacterized protein Low 8 1 465-488 RLDARVRGRRTERRDRRAVHRDAG extr(17),cyto(7),mito(3) RVRLDARVRGRRTERRDRRA (463-482, prob:0.836) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIR4 Zn(2)-C6 fungal-type domain-containing protein Low 9 1 1-34 MSTTNAKRKRARKACIPCHQRKRKCDTVYPCDMC plas(21),nucl(3),mito(3),mito_nucl(3) RKRA (8-11, prob:0.635) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIR7 Uncharacterized protein Low 6.9 1 84-103 ASDAPRSARRRQTKAKEEVE mito(10),cyto(6),nucl(5),cyto_pero(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIS6 Uncharacterized protein Low 9.2 1 9-28 IQLPRPATRHHVQRPHQFSR nucl(16),cyto_nucl(13),cyto(6),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJP2 Zn(2)-C6 fungal-type domain-containing protein Low 9.5 1 5-34 RPRTKTFTGCWTCRKRHVKCDEQRPECARC nucl(15),mito(9),cyto_nucl(9) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJR5 Uncharacterized protein Low 8 1 681-713 LDDNTKPSTNGAKKRRRRRKRGNNSKPDDHGDE plas(7),E.R.(7),mito(6),extr(4),cyto_mito(4) GAKKRRRRRKRGN (691-703, prob:0.993) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKG4 Uncharacterized protein Low 8 1 377-396 EIEKLKKRHARRMEKFNRTS cyto(10),cysk(7),cyto_mito(7),mito(4) KKRHARR (382-388, prob:0.712) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKS4 D-aminoacyl-tRNA deacylase Low 5.8 1 144-164 IEINTKLPKKDKKPESSQTSG cyto_mito(10.666),mito(10),cyto(10),cyto_nucl(7.666),mito_nucl(7.666),nucl(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRV7 Uncharacterized protein (Fragment) Low 6.8 1 1-27 MSPLNSTSTRKRGRPPKYQSAEERQAA mito(14),cyto_nucl(6),nucl(5.5),cyto(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CV54 Uncharacterized protein Low 7.4 1 293-314 MTGWAMKQNRKKQGGKESSREN cysk(17),nucl(6),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVX8 AB hydrolase-1 domain-containing protein Low 5 1 55-79 THGTGFPKVRQRNIPRSKRTRLLTT cyto(13),pero(7),mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXP7 Cytochrome c oxidase assembly protein COX20, mitochondrial Low 9.2 1 153-176 VEMMKELKVKKQREKEQKAEEAAR cyto(10.5),pero(8),cyto_mito(7.5),nucl(4),mito(3.5) KKQREKE (162-168, prob:0.636) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C855 Uncharacterized protein Low 9.5 1 760-781 LLEKSWARRRRSGGLFRRRRNS mito(10),cyto(5),nucl(4),plas(4),pero(2),golg(2) ARRRRSGGLFRRRRNS (766-781, prob:0.851) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8C7 Peptidase_M24 domain-containing protein Low 8.6 1 376-406 ILERPLSKSTGNKKNKNNKKKAAKKESGDKE cyto(21),cyto_nucl(12.833),mito_nucl(2.666),nucl(2.5) KSTGNKKNKNNKKKAAKKESGDK (383-405, prob:0.979) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CB58 AA_permease domain-containing protein Low 7 2 18-37, 53-72 SEKPNVKKDKTAPPESKKDG, EEPPKELKRNLKSRHLQMIA plas(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDJ0 Zn(2)-C6 fungal-type domain-containing protein Low 9.7 1 8-39 AEKQRVRTGCLTCRRRRRKCDEGKPRCANCEV nucl(16),mito(9),cyto_nucl(9) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGS1 Protein kinase domain-containing protein Low 8.3 2 40-63, 110-141 DDPDNRSKKVKLRRLDRSDPEHHA, DGAKKRAQMQRHRAEQMRKRNRHQGWRAVYYS plas(14),nucl(4),cyto(3),mito_nucl(3),mito(2),golg(2),cyto_pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHP6 Uncharacterized protein Low 5 1 593-616 VIKNYIWEKKRAKRWDNTGPGDTH extr(19),plas(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIB8 Uncharacterized protein Low 7.4 1 938-960 SLEGQPRDKRRKVNDDGIRRFFT cyto_nucl(9),nucl(8.5),cyto(8.5),mito(4),pero(2),plas(1),extr(1),E.R.(1),golg(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIY5 Uncharacterized protein Low 7.2 1 424-448 NTPLTRTSHRSTKVRRDPDRELLLC nucl(9),mito(8.5),cyto_nucl(7.833),cyto_mito(7.166),cyto(4.5),extr(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPC2 Serine/threonine-protein kinase TOR Low 7.8 1 1996-2017 ILHVLQTKKRPRRMTLKGSDGN cyto_nucl(13),nucl(11),cyto(11),mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZ53 Uncharacterized protein Low 5 1 54-75 DPWPEYPRPQLQRSKWKNLNGI extr(19),mito(3),pero(2),cyto(1.5),cyto_nucl(1.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1G4 ATP-binding cassette sub-family E member 1 Low 7 2 9-32, 563-588 AIVNSDKKCRQECKKSCPVVRTGK, VTFRRDPNSYRPRINKHQSQMDQEQK cyto_mito(8.166),mito(8),cyto(8),cyto_nucl(7.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CAW2 Cnd3 domain-containing protein Low 7.2 1 82-103 SGISQKTSKKDGKKIQEPVSLP mito(19),nucl(6.5),cyto_nucl(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CC05 Dolichyl-phosphate-mannose--protein mannosyltransferase Low 8 1 12-41 QPAPRSGRSPSRSPRPKNRKKAPATTSSYA plas(25) PRSGRSPSRSPRPKNRKKA (15-33, prob:0.948) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNH9 Uncharacterized protein Low 8.2 1 4-23 RFSTQFKKSKGDRESKQNGT nucl(8),plas(7),mito(5),cyto_nucl(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTA1 Uncharacterized protein Low 8 1 410-429 AIVQRQEKKAKERAKAAKRE plas(15),E.R.(9),mito(1),pero(1),vacu(1) EKKAKERAKAAKRE (416-429, prob:0.908) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1X6 Dolichyl-diphosphooligosaccharide--protein glycotransferase Low 8 1 714-740 MSAAAFDRGHKRKRATKKKGPRVLRTE plas(23),E.R.(3) RGHKRKRATKKKGPRVL (721-737, prob:0.98) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9K3 Uncharacterized protein Low 5 1 508-531 FKPHHSHHRSADRPRSKRHSNSEE plas(23),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFN9 Uncharacterized protein Low 7.6 1 772-795 FAERRPTLAYRRLNKRRMNSDEID cyto_nucl(9.5),nucl(9),cyto(8),pero(5),mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CH94 Uncharacterized protein Low 5 1 1470-1489 CNNPQTKEPKLDRARRQVPE mito(13),plas(8),cyto_mito(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHE2 DDE-1 domain-containing protein Low 9.3 1 79-100 NWPYNFVKRHPQLRTRYTRRIT nucl(15),mito(4),cyto(4),pero(4),cyto_mito(4),cyto_pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHW8 DUF2433 domain-containing protein Low 9.9 1 579-603 RQPAEHKKPSPPGQPRKPNIKFFED mito(10),cyto_nucl(8),nucl(6.5),cyto(6.5),pero(3) RGRGGFGGRGRGRGDRGGRGGRSGRGG (639-665, prob:0.967) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRI2 Uncharacterized protein Low 8.7 1 35-65 QLFSTSPSQPLRRRRTVRRHRRNEPEDPGAA mito(6),extr(5),E.R.(5),golg(4),mito_nucl(4),nucl(2),plas(2),vacu(2) RRRRTVRRHRR (46-56, prob:0.733) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSB7 F-box domain-containing protein Low 7.3 1 76-96 SSPPRPSMRRIWKLRSQCPNR nucl(7.5),cyto_nucl(7),cyto(5.5),cysk(5),mito(4),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSD7 Glutamate decarboxylase Low 5.9 1 152-175 GTLAMKRRWQNKRKAEGKDCSRPN cyto(12),cyto_nucl(8.333),cysk(8),cyto_pero(7.333),nucl(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTP1 Uncharacterized protein Low 6.5 1 189-210 QQAPARARQDRRPRPRCTFCGE mito(14),cyto(5),nucl(4),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0D2 Diphthine methyl ester synthase Low 5 1 206-233 GGCLRTRQPCRWRCEGRSCRPEARRWNV cysk(17),cyto(8.5),cyto_nucl(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CB98 Zn(2)-C6 fungal-type domain-containing protein Low 9.2 1 23-44 ACDECRRRKLRCDGKKPQCSVC nucl(16),cyto_nucl(12),cyto(6),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJY5 Alternative oxidase Low 5 1 321-342 DPNPYTSKYKDPSKPHPSKGME mito(19.5),cyto_mito(12.5),cyto(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKA9 Uncharacterized protein Low 9.1 1 302-321 APEHKSNKPAHENKPKENKP extr(21),nucl(3),cyto_nucl(3) AKPAPEHKSNKPAHENKPKENKPAHENKPALPKDEKKPAP (299-338, prob:0.934) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQH9 F-box domain-containing protein Low 9.6 1 17-37 SISRGRRKSEATKGNPSKHCP mito(18),nucl(4),cyto(3) RASISRGRRK (15-24, prob:0.714) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRH9 Uncharacterized protein Low 5 1 680-702 EANRRPKTSRRISLKQRQDRQLY plas(14),extr(7),E.R.(3),mito(1),pero(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTN1 Uncharacterized protein Low 6.9 1 382-402 PAENRSRRRRSSSSSVSVRRS extr(9),cyto_nucl(7),nucl(6.5),cyto(6.5),mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWQ6 Uncharacterized protein Low 6.4 1 414-433 AERMKKRTESDRVKRPYYPK mito(11.5),cyto_mito(9.333),cyto_nucl(6.333),cyto(6),nucl(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXF8 Uncharacterized protein Low 8 1 104-128 LDEEHRKEKEEKKKNRKSLAHEGLA mito(10),cyto(9),cyto_nucl(6),extr(5) RKEKEEKKKNRKSLAHEGLAEK (109-130, prob:0.932) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXL5 Exonuclease 1 Low 9.8 2 488-508, 645-666 SGLKVSRNKKVRKSKLDVFSD, ATIGPSRSPRRQRLTPLQRLGQ nucl(12),mito_nucl(11.833),mito(10.5),cyto_nucl(8.833) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7Q1 Uncharacterized protein Low 5.9 1 9-28 VDLSQFKKLKLDPKNPKLSD cyto(11),mito(8),cyto_nucl(8),nucl(3),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8N0 Uncharacterized protein Low 5.9 1 96-117 VASTWKSMRKHWRIVHQWSQYP mito(18.5),cyto_mito(11),nucl(3),cyto(2.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CA82 Uncharacterized protein Low 6.6 1 1-21 MIGATRRWFRRNRKPLAIGAG mito(15.5),cyto_mito(11),nucl(6),cyto(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CE44 Uncharacterized protein Low 8.1 1 232-252 RAKHEQFERRRRQHYEMRNIK nucl(11.5),mito(10),cyto_nucl(10),cyto(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGB8 Uncharacterized protein Low 5 1 359-383 AHDRSTMHSKRRKFRHPLSIPDTQW plas(20),E.R.(4),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHR3 Fungal_trans domain-containing protein Low 8.8 1 315-334 SNGVRTHPLHWRRRTTQNTG mito(11),nucl(10),cyto(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CR65 Uncharacterized protein Low 9.1 1 322-342 LSEKGHHPRHHHQHSNVSRHA plas(15),mito(5),nucl(3),cyto(2),E.R.(2) KRRR (313-316, prob:0.643) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSJ3 Uncharacterized protein Low 5 1 32-54 EQDKNNNKHVRTRWKRVYGEIEP plas(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTB0 Uncharacterized protein Low 8.8 1 83-107 KSNYSTKTDRRQATRQKVRMKDGVR nucl(19),mito_nucl(13.333),cyto_nucl(10.833),mito(6.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXQ5 Uncharacterized protein Low 5 1 388-412 IDPALQKPHWWKKDRWRAFTREISR plas(17),E.R.(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYP9 Uncharacterized protein Low 6.5 1 152-174 LEERIRARLKKEQRREIAKPPFD mito(10),cysk(8),nucl(4.5),cyto_nucl(4.5),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1C5 V-type proton ATPase subunit H Low 7.6 1 37-60 DDHLKKIKAVDKVRKEQRRQTIEG mito(11.5),nucl(11),cyto_nucl(8.333),cyto_mito(8.166),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDG8 RRM domain-containing protein Low 9.5 1 425-444 IKQRGYKRLCFRNKQNGPMC nucl(18.5),cyto_nucl(12.833),cyto_mito(4.999),mito(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CEV7 Glutamate decarboxylase Low 5.7 1 213-232 VHLSRVRKCSQPRHERRAAP plas(12),mito(7),nucl(2),cyto(2),cyto_nucl(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFC6 1,4-alpha-glucan-branching enzyme Low 5.8 1 168-187 DQKYHFQHARPKKPQSLRIY cyto(12),cyto_pero(9.333),cyto_nucl(8.333),pero(5.5),cysk(4),nucl(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKK9 Septin-type G domain-containing protein Low 6.4 1 1-24 MSSALSAIRRKKNVKKGIQFCVMV mito(16),cyto(5.5),cyto_nucl(5.5),nucl(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNS8 DUF155 domain-containing protein Low 7.2 1 8-29 CSIFKRPAVKRLQKLPQSQCLH mito(12),nucl(7.5),cyto_nucl(7.5),cyto(6.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPQ4 Uncharacterized protein Low 8 1 52-90 EGPPKYRQAKSAKMKKKKPIDRPRPPPVGERKTLRKRIV mito(23.5),cyto_mito(13.5) KKKTSLEGPPKYRQAKSAKMKKKKPIDRPRPPPVGERKTLRKR (46-88, prob:0.998) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQF5 30S ribosomal protein S15 Low 9.9 1 83-105 LLVHKRQKLLRYLRKKERGGPRW mito(11),cyto(8.5),cyto_nucl(8),nucl(6.5) NKRNLRLLVHKRQKLLRYLRKKERGG (77-102, prob:0.842) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CST9 Zn(2)-C6 fungal-type domain-containing protein Low 9.3 1 18-39 CEPCRVSKIRCDHQQPTCRRCD nucl(12),plas(7),mito(3),cyto(3),cyto_mito(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8W0 Vacuolar transporter chaperone 4 Low 5.5 1 742-768 MLYVWRVDKIRKRRDVKRVYYEKWGPT plas(16),cyto(4.5),cyto_nucl(3.5),pero(3),nucl(1.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9D2 Biotin carboxylase Low 5 1 2119-2138 QAKNTIRKPLTWKNARRFFY cyto(15.5),cyto_nucl(10),mito(4),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CE98 AA_permease domain-containing protein Low 5 1 48-68 ESNPMPDLKRKLKSRHLQMIA plas(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFZ3 Uncharacterized protein Low 7.3 1 1-27 MSPLNSTSTRKRGRPPKYQSAEERQAA mito(10),nucl(7.5),cyto_nucl(7),cyto(5.5),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQS5 Xanthine dehydrogenase Low 5 1 259-280 PLVFGNKKKKWYRPATLQQLLE cyto(13),cysk(12) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CS53 Uncharacterized protein Low 5 1 482-503 DAAWTKFRQHFRRPQTHRSVLT extr(8),cyto(7.5),cyto_mito(7.5),mito(6.5),pero(2),cysk(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUV7 MFS domain-containing protein Low 8 1 684-704 GDYRRRRFDGRELRRRRDRDA plas(26) RR (697-698, prob:0.603) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVG6 Uncharacterized protein Low 9.2 2 88-109, 181-205 GMPGGPRPNKPRKSPNEEQKYE, GQFYSPKDKCKKCKGNKTTEAKKIL cyto_nucl(11.333),cyto(10.5),nucl(10),cyto_pero(8.666),pero(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8U7 DAO domain-containing protein Low 5 1 386-412 LASADKQQRIKRWRWKGNVDKKNWGGD extr(16),mito(4),pero(3),mito_nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C951 Uncharacterized protein Low 9.1 1 186-205 QWRQEHPSPRSPGRRRQSGF nucl(11),mito(10),cyto(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIL9 MFS domain-containing protein Low 5 1 15-39 YIITRVTSLKPPRHKIRNPVAVLRD plas(21),mito(3),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKU8 Leucyl-tRNA synthetase Low 8.2 2 7-30, 954-973 LRLNPARTLRAQPRWPRPSRPLLV, GRTWLQQKNDWERRRRVIVV mito(12),cyto(6),plas(4),nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNC7 Lysophospholipase nte1 Low 8.7 1 365-391 HDHQPESRTRPGKKRRKSVHPDIVARA plas(15),E.R.(5),vacu(3),nucl(2),mito(2),mito_nucl(2) TRPGKKRRK (373-381, prob:0.864) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQ94 Uncharacterized protein Low 9.8 1 133-155 PISSSPPEPTRKRRISNVSSPKA nucl(17.5),cyto_nucl(12.5),cyto(6.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVR2 RING-type domain-containing protein Low 9.4 1 556-583 LARNGPNNPGNRRRRRRMNQQENIRPVG cyto(10),cyto_nucl(8.5),mito(6),nucl(5),plas(2),extr(2),pero(2) GNRRRRRR (565-572, prob:0.777) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CW42 Dicer-like protein 1 Low 7.8 1 47-69 EETGLHKDPSQRQRQQNATFQAF nucl(9.5),cyto_nucl(9.5),cyto(8.5),mito(3),plas(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWE4 Glyoxalase II Low 6.9 1 199-220 GETTEPPRKKRKVQQQQASVAT cyto(12),pero(6),nucl(5),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWN3 Zn(2)-C6 fungal-type domain-containing protein Low 7.5 1 3-24 APSRHMACRTCRERKVRCDGGQ mito(12),nucl(7.5),cyto_nucl(6.5),cyto(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBT5 HTH CENPB-type domain-containing protein Low 8 1 109-128 PYNFVKRHPQLRTRYTRRIT mito(14),nucl(8),cyto(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIM3 Uncharacterized protein Low 9.6 1 100-125 GVEPKKRTVYRRIRRGERKHPVELRD mito(10.5),cyto_mito(8.333),nucl(6.5),cyto_nucl(6.333),cyto(5),pero(4) KKRTVYRRIRRGERKHP (104-120, prob:0.84) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJ22 Uncharacterized protein Low 8.8 1 16-44 PDDWKGLTDPKERRRRQNRINQRAYRYLG nucl(14),cyto_nucl(11),cyto(6),pero(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNJ6 Uncharacterized protein Low 6.4 1 241-267 DRACSATKNKKTSKAKQQSRLQNQIRT mito(6),cysk(6),cyto(5.5),cyto_nucl(5.5),pero(5),nucl(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQ27 PNP_UDP_1 domain-containing protein Low 8 1 111-134 ICTILKRSCKFKRHLRIQVSHDGS nucl(9.5),cyto_nucl(8),cyto(5.5),pero(4),plas(3),golg(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CV43 Uncharacterized protein Low 7.3 1 85-110 AETKRQSTTRRGRRKSIQYTPNNQDS nucl(10),cyto_nucl(9.833),cyto_pero(8.166),cyto(7.5),pero(7.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVV3 Uncharacterized protein Low 8.7 1 144-164 MLGLQGKKKRTTRRINPGMGT cyto(16),mito(7),nucl(2),cysk(2) RAK (404-406, prob:0.606) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8T0 MFS domain-containing protein Low 5 1 463-483 VYIWGHGYRQRKNAYRKQVQS plas(23),E.R.(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CA44 Uncharacterized protein Low 5 1 337-360 IVTARKPFSRKDMKEQRKNDVLKR cysk(15),cyto(7),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBW6 PepX_C domain-containing protein Low 6.5 1 8-31 AEFLKSCHDNRKKAEKYVQFRSAL cyto(8.5),cyto_pero(8.5),pero(7.5),nucl(5),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CC07 Palmitoyltransferase Low 5.8 1 577-598 DQRLSTVKRKYLPRRVEPQTDI plas(21),cyto(3),nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGF6 Uncharacterized protein Low 7 2 63-82, 472-492 RSYVFPRKYRHAGKLWKSKQ, VYIPRNKKSKAEENPQKGSKS plas(17),E.R.(4),golg(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMX4 Uncharacterized protein Low 7.3 1 13-32 LLPYRNQQRRLEKRSVRGLP cyto(9.5),cyto_mito(9.5),mito(8.5),nucl(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPD5 Peroxin-1 Low 6.5 1 1109-1131 ASKLDAIKSARRRQRQMEQGSNS cyto(11),mito(9),nucl(4),extr(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CR47 MFS domain-containing protein Low 5 1 214-235 DMLTRPCTSKRRKSHFKSQDDE plas(20),E.R.(3),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSN9 USP domain-containing protein Low 9.3 1 798-818 VVNRRRQCWEWKKTLRQLEAR nucl(14),cyto(6.5),cyto_mito(6.5),mito(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUM3 Zn(2)-C6 fungal-type domain-containing protein Low 8.9 2 4-23, 53-79 NYRFHAFKTHQVRRRRAVVV, TGIDCSVRPSRRCKRRQTRAPDGSIPD mito(12.5),cyto_mito(8.833),nucl(7.5),cyto_nucl(6.333),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CWX8 MFS domain-containing protein Low 5 1 48-71 FYLNYSPEKRKRTMRKVDVRLIPM plas(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CX07 Zn(2)-C6 fungal-type domain-containing protein Low 6.9 1 83-108 RRACIVTAPSRKRQKKTDSRVAELER plas(16),nucl(5),cyto(3),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CY74 t-SNARE coiled-coil homology domain-containing protein Low 9.6 1 284-307 VSNPFTSSRRRRERDEKMLNTHRE nucl(17),cyto_nucl(13),cyto(7) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D172 EF-hand domain-containing protein Low 7 2 1463-1491, 1910-1930 SPSKRSLDKTTRKWKLRCYRIAVKKHGRW, LYWSREFRRRIDQKRSARMDF plas(24),E.R.(1),golg(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C7L9 SIS domain-containing protein Low 9 1 657-683 KRKATGEPKTPTKRGKGKKASLKEGIE cyto(13.5),cyto_nucl(9),mito(6),nucl(3.5),pero(3) AKRKATGEPKTPTKRGKGKKAS (656-677, prob:0.966) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9C1 Uncharacterized protein Low 7 2 31-50, 135-154 LLLRRFSRRKHFQIVSNNGF, GDRHHHHHHHHHHEHRHPHP plas(19),extr(4),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCD7 Methyltransf_25 domain-containing protein Low 8.3 1 755-781 VNYPVERTKRAMKKSRRRWERALQKAF plas(24),nucl(1),mito(1),cyto(1),cyto_nucl(1),cyto_mito(1),mito_nucl(1) TKRAMKKSRRRWERA (762-776, prob:0.894) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFF8 NmrA domain-containing protein Low 6 1 229-248 ETFAKKLKSKTGKNPPTTYR cyto(15.5),cyto_nucl(10),mito(5),nucl(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJ00 Protein rot1 Low 6.5 1 181-202 LNPVSHSKKKRHVTRETHGWFR extr(8),mito(6),nucl(4),cyto(4),cyto_nucl(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CML5 Uncharacterized protein Low 5 1 179-199 YTYGTRRRAFWRRNKNSPETA plas(17),mito(4),extr(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSQ1 Autophagy-related protein 9 Low 8 1 86-116 SSFNDDRHKPTSRRRKLSRPRWMHARSPQNE plas(23),mito(2) HKPTSRRRKLSRPR (93-106, prob:0.837) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTQ9 Uncharacterized protein Low 8 1 466-488 IWYFFRRHRVRRARHKELRKLAL plas(14),extr(11) RHRVRRARHKELRK (472-485, prob:0.811) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZP8 Uncharacterized protein Low 8 1 135-154 QEDNGSKKRRSRKSAQSTFS plas(20),extr(4),E.R.(2) KRRSR (142-146, prob:0.647) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0I9 DUF202 domain-containing protein Low 5.7 1 18-37 PPTHRSSSPHSSRKEPRRMS plas(23),nucl(2),cyto(2),cyto_nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBG8 Pyr_redox_2 domain-containing protein Low 7 2 46-66, 86-107 SAFFRAPRLRAEKKNFPRLLR, CFSMCSQRKKDSSRKMASKCVS cyto(19.5),cyto_nucl(10.5),mito(7) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CC82 Uncharacterized protein Low 9.3 2 45-66, 607-627 RLGEIKQNPTPQRPNRPLRSSA, VLRKAVKYQRLAQRQPPRHNH cyto(12),cyto_nucl(11),nucl(8),mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CEA8 Uncharacterized protein Low 9.8 1 67-86 DPNQEKKKGKSSPKDRQNNS cyto(11.5),cyto_nucl(10.5),nucl(6.5),mito(5),pero(2) KKKGKSSPK (72-80, prob:0.711) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUY6 DUF2235 domain-containing protein Low 8.2 1 505-524 VSAIRRMKINPQYRPKNLLR cyto(10),nucl(8),pero(7) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYL6 Fungal_trans domain-containing protein Low 8.4 1 36-60 GTSCLVQDPQTKRHRPRNHVEWLEE nucl(11.5),cyto_nucl(9),cyto(5.5),mito(4),plas(2),golg(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1U8 Uncharacterized protein Low 9.8 1 180-208 GDAAPSKGKKGKKKKDKKKQKEDVQVDDL cyto_mito(9.833),cyto(9.5),mito_nucl(9.333),mito(9),nucl(8.5) SKGKKGKKKKDKKKQK (185-200, prob:0.997) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDE9 Uncharacterized protein Low 5 1 315-337 QMEERSSRRYHRRWLHLDRIPTS plas(21),E.R.(3),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CM95 Uncharacterized protein Low 8.5 1 39-59 DKPDNDRRTLRRSPRLNKDVD nucl(11),cyto(10),pero(5),cyto_mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRA3 DUF2470 domain-containing protein Low 8.2 1 52-84 NPDSRRQQQSQSQQRQRQPPKQPPRQAQPEPDD nucl(10.5),cyto_nucl(8),mito(5),cyto(4.5),pero(3),plas(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSA1 FAD-binding PCMH-type domain-containing protein Low 5 1 456-475 ERKLPKLSALKRKWDPEQRF extr(23),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CTN2 Uncharacterized protein Low 8 1 230-259 ERARKKLKESTEKRPVKKAVMKKRPAQDLG mito(22),cyto(4) RARKKLKESTEKRPVKKAVMKKRP (231-254, prob:0.955) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYT2 Midasin Low 8.2 1 4646-4666 ASQYKRDKIWMRRSIPSKRNY nucl(11),cyto_nucl(10.5),cyto(8),plas(3),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1J9 Uncharacterized protein Low 8 1 358-400 PVNFAIVFFKKKKKKKKKKKKKKKKKKKKKKKLVSICGERLQS plas(9),mito(6),extr(5),E.R.(3),vacu(3),cyto_mito(3),mito_nucl(3) KKKKKKKKKKKKKKKKKKKKKKK (367-389, prob:1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CC00 Ubiquinone biosynthesis protein coq4, mitochondrial Low 8 1 262-287 PPDMREIRRMIREQKKREKERLKQAE mito(16.5),cyto_mito(12.5),cyto(7.5) IRRMIREQKKREKERLK (268-284, prob:0.86) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDL3 MFS domain-containing protein Low 5 1 351-370 LSRTLRRRNNNIHKPEHRIP plas(22),E.R.(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CEA9 TPT domain-containing protein Low 5.7 1 79-98 LKNGTVRNSKHRPRKSISEA plas(21),nucl(2),mito(2),mito_nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHA9 RING-type domain-containing protein Low 8 1 588-613 YVLLLLRSRIRRRRWRAPKSLVDRLP extr(16),plas(7),mito(2) RIRRRRWRAP (596-605, prob:0.784) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMZ9 Uncharacterized protein Low 8 1 1-27 MSPLNSTSTRKRGRPPKYQSAEERQAA mito(11),nucl(10),cyto_nucl(8),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQK8 Uncharacterized protein Low 8.1 1 2-21 EGVRQKCRPKHQVLVLKCYP mito(11),nucl(8),cyto(7) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CW64 Uncharacterized protein Low 8.8 1 46-76 TTCSVCRSTFRRPEHLKRHFRSHTKEKPFEC nucl(13.5),cyto_nucl(10),cyto(5.5),mito(3),plas(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYK0 Translocation protein SEC62 Low 8.7 1 324-354 SFKPLWGWQETKKKKKKSKKVTADDSKTEPA plas(17),E.R.(3),nucl(2),mito(2),pero(2),mito_nucl(2) KKKKKKSKK (335-343, prob:0.953) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZB3 Carboxylic ester hydrolase Low 5 1 488-507 NPNTNKRPESPEWKPWRRLS extr(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1A0 Uncharacterized protein Low 7.4 1 46-68 VSFLRFRRLKWLHKKYNYPTRAS mito(9),nucl(6),cyto_mito(6),plas(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C911 Uncharacterized protein Low 6.8 1 150-174 QFGVTRWQIRKRPKKDYERFRTWLA cyto(14.5),cyto_nucl(11),nucl(6.5),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CB03 Allergen Asp f 4 Low 5 1 19-39 LARGHGRQLRHHLRRHAPPGP extr(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CF39 Uncharacterized protein Low 5.6 1 274-294 MERIGRKYKSHVQLRRKFMQA mito(9.5),cyto_mito(7.5),cyto(4.5),pero(4),extr(3),nucl(2),cysk(2),vacu(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CID9 Uncharacterized protein Low 8.7 2 881-900, 1525-1549 IHKPKEPSRLQKKKSLRFNT, IENTWRSRINKRKEKLKQWRQTEEI cyto(7.5),mito(7),cyto_nucl(7),nucl(5.5),plas(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CMU5 Uncharacterized protein Low 8.3 1 454-475 WYLLTKRRLEEMKKKKQEKGMV plas(18),E.R.(4),cyto(2),nucl(1),mito(1),golg(1),mito_nucl(1),cyto_pero(1) KKKK (466-469, prob:0.668) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRG6 Zn(2)-C6 fungal-type domain-containing protein Low 8 1 49-73 SEKPADKIYHARRPHRKSRAGCANA nucl(10.5),mito(10),cyto_nucl(8.5),cyto(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRN0 Uncharacterized protein Low 8.9 1 29-54 DDSPKHLHSRTRKRFRNDRPDEKVVY nucl(12.5),mito(12),cyto_nucl(7.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0D5 Uncharacterized protein Low 5 1 241-260 ADFFKRCRGRNRRQMLNAAL pero(12.5),cyto_pero(8.5),mito(5),cysk(4),cyto(3.5),mito_nucl(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D158 Isoflavipucine cluster transcription factor ATEG_00326 Low 8.2 1 36-58 ATCSWSQSLRSNRLKRHNVPISD mito(17),nucl(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D1W7 Peptidase M12B domain-containing protein Low 5 1 563-582 GIYSWRRRRVGKRLSSLSSA extr(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C9S5 Uncharacterized protein Low 9 1 317-336 AASRQRSSRRREPSPPPDLD nucl(20),cyto_nucl(13.333),mito_nucl(11.333),cyto(5.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBK7 Zn(2)-C6 fungal-type domain-containing protein Low 8.2 1 55-74 TESRAALRRSQRRQDNEGSH mito(9),nucl(8),cyto(4),plas(2),extr(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDF2 Uncharacterized protein Low 7 1 491-511 VQGKVKDREKYEKRLRKAFQL cyto(10.5),cyto_pero(7.5),nucl(7),mito(6),pero(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHJ8 Uncharacterized protein Low 8.6 1 1-44 MFLPRSAGSQRNPRRRQRTSSDDSVKPPRAKRQRSTLGQKAPDS nucl(12),cyto_nucl(9),plas(8),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHQ3 Phosphotransferase Low 5 1 3-24 GIGPKRPPSRKGSRHELPQNLL mito(12),cyto(8.5),cyto_nucl(5.5),pero(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CI76 Uncharacterized protein Low 5.4 1 4-27 KSWLGPPVPKRQPHPTRRDYWAIA plas(13),mito(7),golg(2),vacu(2),nucl(1),cyto(1),cyto_nucl(1),E.R.(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKJ4 Uncharacterized protein Low 8 1 918-942 APDPCPALRRAPKAKRKAPSGSPAL plas(22),E.R.(2),vacu(2) RRAPKAKRKA (926-935, prob:0.805) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLL6 NTF2 domain-containing protein Low 9.8 1 140-160 ADGPKGKRRREWLIQTQNFRL nucl(12),cyto(9),pero(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPN7 Telomerase reverse transcriptase Low 9.7 2 24-46, 134-154 LQQIPVSSKSRRRRIASVRADGS, QRACGPQPPKRHKSSPTCSIP mito(12),nucl(8.5),cyto_nucl(7),cyto(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRJ4 Uncharacterized protein Low 7.3 1 279-303 EPEHREWTQRAKEKNKETHERNEGK cyto(13.5),cyto_nucl(11.5),nucl(8.5),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CSR1 Uncharacterized protein Low 9.1 1 479-498 TSYAYRRKAFREKWGAQFRL nucl(17),cyto_nucl(12.833),cyto(6.5),cyto_mito(5.166) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYU8 PPR_long domain-containing protein Low 8 1 352-383 LTKEERRAASKERRKEKRRRLAIQRTREEEGW cyto(13),cysk(7),cyto_pero(7) SERRRLTKEERRAASKERRKEKRRRL (347-372, prob:0.995) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZE4 Uncharacterized protein Low 9.2 1 74-99 NTTTFPSSSPKRKRRIIIHTSPYLRC nucl(11),extr(6),mito(5),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDK6 Uncharacterized protein Low 5 1 443-466 FYLVKLYYVRRNKQREKIWQAMSS plas(26) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CEY7 Acetyl-CoA deacylase Low 8.2 1 6-25 LLKSRVRRPSYLKKLARAED mito(13),nucl(8),cyto(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CGY8 Phospholipid-transporting ATPase Low 5 1 1220-1240 VWVGKLIKRSWRPPSYRKVRG plas(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CN62 Ribosome biogenesis protein BRX1 Low 6.9 1 2-24 AAVYKTLSKKQARRLAKEQEEEE mito(11),cyto_nucl(7.5),cyto(7),nucl(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVB4 Uncharacterized protein Low 5 1 754-773 DGRILTRRQYQKQLERDRAQ plas(19),E.R.(3),vacu(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYH0 Peroxin-14 Low 9.5 1 3-22 DSKPKPSIPQWQQQQQQQPP nucl(18),cyto_nucl(16),cyto(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8S6 Uncharacterized protein Low 9.1 1 274-297 LEVKPNRTKRYRGRKKQNPTLGIP mito(18.5),cyto_mito(10.5),nucl(4),plas(2) RTKRYRGRKK (280-289, prob:0.747) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CC97 Uncharacterized protein Low 9.4 1 125-146 KSSARNWNKSLRHPRRKALSNL nucl(11),mito(9),cyto(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CF44 Zn(2)-C6 fungal-type domain-containing protein Low 8.3 1 99-122 EAQNRCQNCRKSGRICRRGVRLNF nucl(10),cyto(7),mito_nucl(7),pero(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CIS2 ANK_REP_REGION domain-containing protein Low 7.6 1 1-20 MPSFRVKARFWKRSRSDGAA mito(9),nucl(8.5),cyto_nucl(7.5),cyto(5.5),plas(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKG1 MFS domain-containing protein Low 7 2 1-23, 481-500 MRFYKKDSTPKRHSQPDPPPSYE, MWQNRRLDKKHGPRVDKGDE plas(25) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQ66 RING-type domain-containing protein Low 9.2 1 37-65 LTVFINRRERRPNCKRKRDPSDKLRKLDA cyto(8),cyto_nucl(7),E.R.(5),nucl(4),plas(4),mito(2),golg(2) RRPNCKRKR (46-54, prob:0.68) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CRA8 F-box domain-containing protein Low 6.7 1 556-578 PDPRDTTTPLKLRKQQPFKSVGD cyto(9),cyto_nucl(8.333),extr(8),nucl(6.5),cyto_mito(5.333) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CS70 Uncharacterized protein Low 5 1 41-65 ELETGKKTRAQKLRRHWGRFWCCYC plas(8),E.R.(5),mito(4),cyto(4),extr(4),cyto_mito(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUL3 Uncharacterized protein Low 8 1 55-83 GYSWWRERSKERARGKRLLRRNSGIRGKD mito(12),cyto(4),plas(3),extr(2),cyto_nucl(2),E.R.(2),golg(2) ERSKERARGKRLLRRNSGIRGK (61-82, prob:0.926) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVT1 Protein kinase domain-containing protein Low 8.9 1 97-117 DPYNRAKYSTRPNQHSRPSSQ nucl(13.5),cyto_nucl(10),cyto(5.5),plas(3),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CYU1 Probable E3 ubiquitin ligase complex SCF subunit sconB Low 9.2 1 240-264 SSTSAFSKKRRARPRSYRSHFKQKY mito(15),cyto(4),extr(4),nucl(3) KKRRARPR (247-254, prob:0.779) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZ37 DUF2235 domain-containing protein Low 6.9 1 478-498 LTEYWIKRPDRGRSQHKLGYR mito(11),cyto(6),nucl(5),pero(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CB49 Uncharacterized protein Low 5.6 1 604-630 AGLYRCCHCCRCFRRCRSRSNAYQLVP plas(20),extr(3),nucl(1.5),cyto_nucl(1.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CE03 Uncharacterized protein Low 8.8 1 61-83 ARERPAFKRSRPRRKGRGGIPPA extr(8),plas(7),mito(6),nucl(2),pero(2) ERPAFKRSRPRRKGRGG (63-79, prob:0.97) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHI7 60S ribosomal protein L18 Low 9.3 1 152-184 GFGPHSHKKPYVRSKGRKFERARGRRRSKGFKV cyto(11.5),mito(11),cyto_nucl(8.5),nucl(4.5) GFGPHSHKKPYVRSKGRKFERARGRRRSKGFKV (152-184, prob:0.995) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJN5 DUF2236 domain-containing protein Low 6.6 1 256-278 KFVRTFPKRYYLKDMRRRLQSME mito(14),cyto(7),nucl(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CL43 4F5 domain-containing protein Low 8.7 1 1-28 MTRGNQREKARAKNLKQQKEQNKHKTTM nucl(10),mito(9),cyto(4),plas(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CN92 AAA_16 domain-containing protein Low 9.5 1 353-374 SSLSARNKRAHHRRRLKLLSQA mito(13),nucl(4),cyto(3),extr(2),pero(2),E.R.(2) NKRAHHRRRLK (359-369, prob:0.779) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CU51 Diacylglycerol O-acyltransferase Low 5.8 1 10-37 NNAGPNASHKKDRKRQGRLFQHTVPNKY plas(10),mito(8),cyto(4),nucl(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CV32 Uncharacterized protein Low 5 1 40-59 GDFLRRKAYREYNKNARKLI extr(13),cyto(5),plas(4),mito(2),pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CVE1 Prolyl-tRNA synthetase Low 9.3 1 47-67 ASEKAEKKGKQQQQAKAAPKA cyto(11.5),pero(9),cyto_nucl(8.5),nucl(4.5) NAAKKAAKAAKQASEKAEKKGKQQQQAKAAPKAAKKK (35-71, prob:0.977) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXZ6 Spindle pole body component Low 9.6 1 4-25 RANPSAHKSKTPREQQNITTEK nucl(15.5),cyto_nucl(10),pero(5),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CZM2 GPI-anchored wall transfer protein Low 5 1 95-114 NSKPARTQHKAKPPRQPTAA plas(20),E.R.(4),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CC99 Zn(2)-C6 fungal-type domain-containing protein Low 9 1 31-56 VTTLRACTSCRHRKIKCDGEKPCEAC plas(13),nucl(10),E.R.(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CD18 Uncharacterized protein Low 8.1 1 78-105 SPCVSPNKIRMPNLKKKCDERRGTCGNC cysk(10),nucl(8),cyto(6),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJ19 Uncharacterized protein Low 9.9 1 302-321 LSDQSPTLRRRKPYHQVSAT nucl(16.5),cyto_nucl(10),mito(7) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CT43 Zn(2)-C6 fungal-type domain-containing protein Low 9.8 1 38-64 AHTLTACTRCRQRKSRCDPGIPKCTPC nucl(14),mito(9),cyto(2),pero(2),cyto_pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCR1 Methionyl-tRNA synthetase Low 8.7 1 578-609 KKEEEAAKKKAAKEKKKEKKAKKAPAPVEATA cyto(15.5),cyto_nucl(9.5),E.R.(4),nucl(2.5),mito(2),extr(2) RQKKEEEAAKKKAAKEKKKEKKAKKAPA (576-603, prob:0.999) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CCS8 WD_REPEATS_REGION domain-containing protein Low 8 1 55-81 VLKAVPKKKTSHMKKRHRQMAGKALKD extr(15),mito(7),cyto(2.5),cyto_nucl(2.5) PKKKTSHMKKRHRQMAG (60-76, prob:0.879) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CDW7 Uncharacterized protein Low 8.5 1 232-259 ASLDERYKKHLKKRFGRKFEKIPRQSKQ cysk(8),cyto(7.5),cyto_mito(7.166),cyto_nucl(5.833),mito(5.5),nucl(2),extr(2),pero(2) KKHLKKRFGRKFEKIPR (239-255, prob:0.901) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CEC0 Uncharacterized protein Low 6.1 1 185-208 QDDSRMMRRRRQHLQEHQQRHAHG cyto(13),pero(6),nucl(3),mito(3),mito_nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CF74 FAD-linked oxidoreductase ATEG_07660 Low 8 1 453-478 WGADNLPRLRRLKRRWDPKGLFGRGT extr(21),cyto(2.5),mito(2),cyto_nucl(2) RLKRR (463-467, prob:0.643) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CHV6 Zn(2)-C6 fungal-type domain-containing protein Low 7.8 1 95-118 CENCREQKAKCSGHRPTCQRCQEA nucl(9),cyto(8),plas(5),cyto_mito(5),cyto_pero(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJW4 Uncharacterized protein Low 7.2 1 1188-1211 TGRLCQCYRSRRRTSKEQDTRVRV mito(11),cyto_nucl(9),nucl(8),cyto(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CK82 MFS domain-containing protein Low 5 1 491-510 IWKGKACRRMGARRYHQMVA plas(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNT2 CP2 domain-containing protein Low 9.2 1 1-22 MVDRRHPSYRNNQHKPNPELIQ nucl(13),mito(6),cyto(6),cyto_mito(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNU5 Uncharacterized protein Low 6.5 1 404-430 FVDRHFCKKGKLERKGDQCNKKNVQVL mito(17),nucl(4.5),cyto_nucl(4.5),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNZ0 Uncharacterized protein Low 6.1 1 108-127 QQPSQRSRLRSRFSKPFNNL plas(7),cyto(6.5),cyto_nucl(5.5),mito(4),nucl(3.5),vacu(2),pero(1),E.R.(1),golg(1),cysk(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQA2 Uncharacterized protein Low 9.6 1 7-29 SSVSRHSHSSRRHRSSRSHHGGL nucl(15.5),cyto_nucl(10),mito(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CQE7 Uncharacterized protein Low 7.1 1 185-209 QQQPERANSRLRRLRRRTSSFGLGI mito(16),nucl(6.5),cyto_nucl(5.5),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CW31 Leucine carboxyl methyltransferase 2 Low 6.5 1 41-67 YYPKPHFFRYFVKRPQRRSPLINRGYW mito(13),pero(5),nucl(4.5),cyto_nucl(4.5),cyto(3.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D0E6 Uncharacterized protein Low 5.7 1 11-39 RRTTTCPRHSLPSRTRPRRNQSSGSSPNT mito(20),cyto(3),nucl(2),cyto_pero(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CBW2 C2H2-type domain-containing protein Low 5.8 1 586-606 AIHLWNKKKIKIPKNVRWYDV plas(23),nucl(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CC13 Zn(2)-C6 fungal-type domain-containing protein Low 8.2 2 10-41, 72-95 CRTCIQRRIKCDESRPACRRCERRGIQCPGYQ, DQNAPKARPPAKRPLRQQNNVDEL mito(19),cyto(4),nucl(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CD93 Uncharacterized protein Low 8 1 1-23 MASRRSRRPNNHHNNINNNRQNY nucl(10),cyto_nucl(9),mito(8),cyto(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CPM3 Zn(2)-C6 fungal-type domain-containing protein Low 9.5 1 1-48 MPSRRSHTKSRKGCLQCKRRHVKCDEDTPKCGLCKKRKLDCTYPPPTS nucl(13),mito(8),cyto_nucl(8) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CUX4 RRM domain-containing protein Low 5 1 363-386 VEDARASRPSLPKKKPVDRCGPLV mito(15),cyto(5),extr(4),cyto_nucl(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0D177 Non-specific serine/threonine protein kinase Low 9.2 2 664-685, 950-973 GLLRRFSTRRTKERSRDPERGR, KEESRGTPKSQRRTRGPPDRSFVS mito(11),nucl(7),cyto(7),cyto_nucl(7) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFK4 Uncharacterized protein Low 5.4 1 89-110 ETGQAHPRRTKLRQQPRRLGSG mito(21),cyto(2),nucl(1),plas(1),pero(1),E.R.(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CKQ0 MFS domain-containing protein Low 5 1 473-492 YIFLKHGKRLREKSPFARFS plas(27) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CLW3 RNA polymerase II transcription factor B 38 kDa subunit Low 9.5 1 59-82 CPVAGCHKTLRKNRFRKQTFEDIS nucl(16.5),cyto_nucl(12.5),cyto(7.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CX48 Peptidase_S8 domain-containing protein Low 6.1 1 308-328 SLTKIHDSKKKQNKNNPSLNY cyto(9.5),cyto_mito(9),mito(7.5),nucl(4),cysk(1),golg(1),E.R.(1),pero(1),plas(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXQ9 Uncharacterized protein Low 6.9 1 1248-1269 LHSIKSKQPEHFRQPHLFRKTL mito(12),cyto_nucl(7),nucl(6),cyto(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8E8 Uncharacterized protein Low 7.2 1 203-228 VNTYTKKKRLEALRKRYDQRRGPGSE mito(11),nucl(6),cyto(4),plas(3),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0C8F8 Uncharacterized protein Low 7.9 1 72-96 SFTCQPCSVRRKLSNKSTVKRQTYV nucl(11.5),cyto_nucl(9.333),cyto_mito(6.833),mito(6.5),cyto(6) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CD65 Uncharacterized protein Low 5 1 1-20 MLRLPFRHRRRRGLFHALLI extr(16),golg(5),plas(3),mito(1),E.R.(1),vacu(1) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFY6 Zn(2)-C6 fungal-type domain-containing protein Low 8.8 1 47-69 ACQICRLRKTRCNGARPRCQLCT plas(14),nucl(10),cyto(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CFZ2 Uncharacterized protein Low 8.8 1 293-315 KYEILHHRRQCVQRRRHPSSYPD nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJF0 Uncharacterized protein Low 7.3 1 658-686 FLGDKRQNADRRCWRRRVRRVGWEVLQHW mito(9),nucl(7.5),cyto_nucl(7),cyto(5.5),plas(4) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CJN9 MFS domain-containing protein Low 5 1 481-504 FDSGLPAWRKLKKRSRLEELEEEI plas(19),E.R.(5),mito(2) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CNA3 Uncharacterized protein Low 9.1 1 1-21 MSLTRAFTKRHKRPEVSAPMP nucl(13.5),mito(11),cyto_nucl(8.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CT20 PX domain-containing protein Low 8.8 1 438-457 ESEMQKRKHTQEKLLRQGKT nucl(14.5),cyto_nucl(12),cyto(8.5),pero(3) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CXP5 Calcium/calmodulin-dependent protein kinase type I Low 8.8 1 3-22 SPAQAQQRPKVQPCRYKTGK nucl(12.5),cyto_nucl(9),mito(7),cyto(4.5) UP000007963 Aspergillus terreus (strain NIH 2624 / FGSC A1156) Q0CL90 Ubiquitin-conjugating enzyme E2-18 kDa Low 9.8 1 4-23 CQNRLTEERKQWRKDHPFGF nucl(13),cyto(6),mito(5),extr(1),pero(1),vacu(1)