ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Y4	Protein kinase domain-containing protein	Medium	10.2	1	95-122	YQKCVIKVLKPVKKKKIKREIKILQNLA	nucl(7.5),cyto_nucl(7.5),cyto(6.5),mito(5),pero(3),extr(2),vacu(2)	KPVKKKKIKRE (104-114, prob:0.895)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1T5	zf-met2 domain-containing protein	Medium	11.6	1	5-27	NGAKAAQKRARNEKHKNVPKAAS	nucl(16),cyto_nucl(11.333),mito(6.5),cyto_mito(6.166),cyto(4.5)	KRARNEKHK (12-20, prob:0.669)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q289	Uncharacterized protein	Medium	11.4	1	8-54	LPFEREKETRRHKSRSSSHGRSSHGRSERPHRERTHRREKERARDSA	nucl(13),cyto_nucl(11.5),cyto(8),mito(6)	KETRRHKSRSSSHGRSSHGRSERPHRERTHRREKERA (14-50, prob:0.968)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2U9	Uncharacterized protein	Medium	14.8	2	65-87, 1155-1174	TDTESRRSEERNRSRPRGSRSAS, QLPPQQQQQQQQQRDWRNSG	nucl(17.5),cyto_nucl(11.5),cyto(4.5),pero(3)	DGRKNVKK (805-812, prob:0.668)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q350	Condensin complex subunit 2	Medium	11.2	2	79-102, 221-245	AETPGSSPRTPRRRRSVNYTTILD, VDEDGNVRKKPKKKTQRSSEATLAP	mito(13.5),cyto_mito(11.333),cyto(8),cyto_nucl(7.333),nucl(5.5)	RKKPKKK (228-234, prob:0.801)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M0	Uncharacterized protein	Medium	11.7	1	572-595	EPTSAAKPSRRRPRYPKPVDWTPN	nucl(12.5),mito(9),cyto_nucl(8.5),cyto(3.5)	SRRRPR (580-585, prob:0.654)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Z9	Uncharacterized protein	Medium	10.6	1	213-235	LERTKERWGPRRQAAREERRARM	mito(20),nucl(7)	RTKERWGPRRQAAREERR (215-232, prob:0.768)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBF3	Uncharacterized protein	Medium	10	1	33-53	IPSSTPPSKTPKRRSIPLGAL	nucl(13),cyto(6),mito(5),extr(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF22	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.6	2	3-44, 60-84	TASSPSTRRSIRPHRKSRARCGFCKRRKVKCNEEKPCSNCVS, RCAAPTTRRGRGRPRKVWAPDCSRS	plas(8),nucl(7),mito(6),cyto(3),pero(1),E.R.(1),vacu(1)	RPHRKSR (14-20, prob:0.668),RGRP (70-73, prob:0.621)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFV1	Uncharacterized protein	Medium	11	1	41-64	DEQVKLVRVKRRRRPQVETRRGRL	mito(11),nucl(8),cyto_mito(8)	KRRRRP (50-55, prob:0.738)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH09	Uncharacterized protein	Medium	10.6	1	581-600	ACGGRRRSGHQDAPRPRLRR	nucl(9),cyto_mito(9),mito(8.5),cyto(8.5)	RSGHQDAPRPRLRRGDGEGGRM (587-608, prob:0.768)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHR6	Uncharacterized protein	Medium	12.9	1	37-62	DGALSPRSVRSRRPRRASRKGTAYYL	nucl(18.5),cyto_nucl(13),cyto(6.5)	VRSRRPRRASRK (45-56, prob:0.838)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHV3	Uncharacterized protein	Medium	11.8	1	632-656	STNAVELRREKRRRDERRLELDLSK	nucl(14),cyto_nucl(10),mito(9),cyto(4)	KRRR (642-645, prob:0.648)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLT9	SH3 domain-containing protein	Medium	11.7	1	135-155	VLNARRKKLARRRQQIEDDEK	nucl(10),mito(7),cyto(5),pero(2),plas(1),extr(1),golg(1)	RKKLARR (140-146, prob:0.666)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN58	Uncharacterized protein	Medium	13.5	2	2-24, 69-90	DATYTQHRPSWRRKSRSGAGLDS, LLSHSPPPSRPRRPARGASVPY	mito(12),nucl(9),cyto(5)	PAAARKRRS (114-122, prob:0.745)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2D4	Uncharacterized protein	Medium	10	1	433-454	GRVSGRSRTKRMRMGMRMRMRI	plas(21),E.R.(2),vacu(2)	RTKRMRMG (440-447, prob:0.649),R (449-449, prob:0.602)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3B1	IBR domain-containing protein	Medium	10.7	1	170-194	AISELDKRSKKKKEEEEEAEKRFRR	cyto(9),nucl(7),mito(6),extr(4)	DKRSKKKKEEEEEAEKRFRR (175-194, prob:0.914)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q608	Uncharacterized protein	Medium	11.4	2	119-145, 186-208	SVDDLRAEKRRARRQRREMKRDRLLAD, LLHVTDTKSKRKRNCCRWVLFYA	plas(7),cyto(6.5),cyto_nucl(6),nucl(4.5),mito(3),golg(2),pero(1),E.R.(1),cysk(1),vacu(1)	EKRRARRQRREMKR (126-139, prob:0.924)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAL4	Methyltransf_25 domain-containing protein	Medium	13.7	2	17-38, 142-165	YEIEGSPRSRKKPTRSNSTAAP, HDHDHDHDRHRHRHRDHRMSSSHK	nucl(18),cyto(5),mito(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAN0	Uncharacterized protein	Medium	12.6	1	74-102	IILPRQRDRARSKSQNRPRRDQSQDKISG	nucl(17),cyto_nucl(13),cyto(7)	KRPDSSPKKPGTTAASRKPKPANGAAGRPKTRGGPS (234-269, prob:0.961)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB77	Ribosomal_L18e/L15P domain-containing protein	Medium	10.4	1	1-20	MPTRFSKTRKHRGHVSAGKG	mito(12),nucl(8.5),cyto_nucl(8),cyto(6.5)	KTRKHRGHVSAGKGRVGKHRKHPGGRG (7-33, prob:0.977)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBB9	Uncharacterized protein	Medium	10.8	1	203-228	GMYYKEKDRCKKCKGKRTVKETKALE	nucl(15),cyto(9),cysk(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC99	Uncharacterized protein	Medium	13.5	2	373-394, 509-533	PDNSPHHRHHHNHQHRHRHSAR, NESGVRPAKKPRTRKDQEEHHFWAL	nucl(25.5),cyto_nucl(14)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHB6	Lysine--tRNA ligase	Medium	10.9	1	22-50	VTGERVSKSELKKRQKQRQKEAEKAAKAA	cyto_nucl(12.5),cyto(12),nucl(11),pero(2)	ELKKRQKQRQKEAEKAAKAANAPPKPSSKPK (31-61, prob:0.952)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHK5	Uncharacterized protein	Medium	13.2	1	102-122	SYSFSARKRKLSKKGRHADVF	nucl(20),cyto_nucl(12.5),mito(3),cyto(3)	RKRKLSKKGRH (108-118, prob:0.847)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT9	TPR_MLP1_2 domain-containing protein	Medium	13.2	1	1932-1951	QQPPQQQQPQQQQQQPQPQS	nucl(19.5),cyto_nucl(13.5),cyto(4.5)	GAGNKRPRDGADGGGPGEGGRGGKRARGGG (2037-2066, prob:0.932)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK55	RF_PROK_I domain-containing protein	Medium	10	1	171-194	ANEARVKAKKMQKSKKAFRRGFDD	mito(20),nucl(5)	LKKSANEARVKAKKMQKSKKAFRR (167-190, prob:0.944)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL50	Uncharacterized protein	Medium	10.3	1	11-33	SFGLRRSFPPPQQHNPTNKPSPS	nucl(21.5),cyto_nucl(14.5),cyto(4.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0L6	40S ribosomal protein S30	Medium	11.2	1	24-44	QEKKKVPKGRAGKRLKYTRRF	nucl(11.5),mito(10),cyto_nucl(9),cyto(5.5)	GKVKSQTPKVEKQEKKKVPKGRAGKRLKYTR (12-42, prob:0.988)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0X1	Uncharacterized protein	Medium	14	2	16-36, 606-634	NDDPRPPSRSQSRPRATSPRS, QGGGEGKERYGRKKRRRRRPAEQFELDLE	plas(17),nucl(5),E.R.(3)	RPRATSPRSGRRG (28-40, prob:0.694),RRSSRSARRVVSRASGRREDREQGGGEGKERYGRKKRRRRRP (584-625, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3J5	Uncharacterized protein	Medium	11.4	2	65-95, 1308-1327	RIAYLRYILQPRKKRKEYISAPKPRPHPRVH, RNLGTMRKAKEEKRKEAQAD	mito(17),nucl(4),cyto(4),cyto_nucl(4)	RKKRKEYISAPKPRP (76-90, prob:0.798)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8G5	Uncharacterized protein	Medium	12.7	2	72-93, 459-483	ADQWKAHPPAHHRRHNHRGTTT, EATVMRSQKRRSRPRQDRQHAGNGA	nucl(21.5),cyto_nucl(13),cyto(3.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBH3	Uncharacterized protein	Medium	11.3	1	43-62	ITPGRYHNRHSSRQERPAAE	nucl(17),cyto(6),mito(2),pero(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCV6	REM-1 domain-containing protein	Medium	11.7	1	92-111	TPTPRPQASQQQQQQQQQQQ	nucl(18),mito(3),cyto(3),cyto_mito(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF04	Tudor domain-containing protein	Medium	11.7	1	226-251	ENADDKPRPKFKKIKATKELEKGKTK	nucl(11),cyto(9),mito(5),cyto_pero(5)	KPRPKFKKIKATKELEKGKTKWQEFTSKGKFGKVAK (231-266, prob:0.95)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGC7	G-patch domain-containing protein	Medium	12.2	1	77-98	DEGPGGRWKHKRLRDKAVSFVS	cyto(9.5),cyto_nucl(9),pero(8),nucl(7.5)	RKRRR (53-57, prob:0.669),KKKAARKKKAVAGGIGSRPGSGTSTPKRPKPK (336-367, prob:0.984)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT7	BZIP domain-containing protein	Medium	14.5	1	49-80	AERRRIQNRIAQRNYRKKLKKRLEELERRAGS	nucl(25.5),cyto_nucl(14)	IAQRNYRKKLKKRL (58-71, prob:0.851)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM35	BZIP domain-containing protein	Medium	10.8	1	162-186	NAAALARFRKRKKERERSQQEELQK	mito(13),nucl(9.5),cyto_nucl(7.5),cyto(4.5)	RGSKAADDKRRGNAAALARFRKRKKERER (150-178, prob:0.976)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0D7	NADAR domain-containing protein	Medium	12.6	1	1-25	MPPKRSKPQHQKSKRIRVARPETGP	nucl(12),mito(11),cyto(3)	KRSKPQHQKSKRIR (4-17, prob:0.739)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3S1	RING-type domain-containing protein	Medium	11.3	1	678-698	TSTPRPPQRRSPPSEAENRRR	nucl(23.5),cyto_nucl(14)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3W7	Origin recognition complex subunit 4	Medium	12.2	2	79-98, 155-180	EEPPRPPRPRQVLPRTNGET, ATGQEAGKKKRGRPRKRDREAIATAQ	nucl(7.5),cyto_nucl(7.5),mito(7),cyto(6.5),pero(2),plas(1),golg(1),cysk(1),vacu(1)	AGKKKRGRPRKRDR (160-173, prob:0.986)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q466	BZIP domain-containing protein	Medium	13.3	1	37-64	SVSERRTTKDGQPQKRRGPKPDSKPALT	nucl(19.5),cyto_nucl(12.5),cyto(4.5)	PQKRRGPKPDSKPAL (49-63, prob:0.814)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6J7	Uncharacterized protein	Medium	12	1	1-24	MGPWSRRRSRRNTVSRLVRHRDNS	nucl(15),cyto_nucl(10.5),mito(8),cyto(4)	KGRGKGKGG (48-56, prob:0.727)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB07	SpoU_sub_bind domain-containing protein	Medium	13.1	2	83-102, 160-181	EERPSFKIRKGKKDITEYPD, VPRPDLRSPPRRRSARERQSVR	mito(19),cyto(4.5),cyto_nucl(4.5),nucl(3.5)	ARKRLAEERPSFKIRKGKK (77-95, prob:0.831),RRDRGAGRREDAPRHKK (236-252, prob:0.757)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDA6	Separase	Medium	12.7	1	1740-1764	LDKHLPSRRQVRGKKTTKPEQTAKA	cyto_nucl(10),nucl(9.5),cyto(9.5),mito(4),pero(2)	KKPTRGGGGGGGRGGRKAAVAKTPGRKAAKGAIRT (1311-1345, prob:0.986),KASSPKK (1458-1464, prob:0.625)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEK8	Uncharacterized protein	Medium	14.7	2	437-459, 468-494	IPPLSMTLRRRGRQKRPSVSSAG, AAAQQQAPKRRGRPKKAKSEPEPEPEP	plas(18),nucl(2),E.R.(2),cyto_mito(1),vacu(1),pero(1),extr(1),cyto(1),mito(1),cyto_pero(1)	RSGGGKRGKT (402-411, prob:0.724),RGR (447-449, prob:0.605),PKRRGRPKKAKS (475-486, prob:0.953)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QER6	Uncharacterized protein	Medium	10	2	25-50, 399-421	AASSHAAARRPRRNPNPSPRPPASCQ, IRYATYMRHKRQKEAEQRAKEAE	mito(10),nucl(9.5),cyto_nucl(7.5),cyto(4.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFX4	RRM domain-containing protein	Medium	13.1	1	92-133	FDRSERDRRRSPPRRRSPSPRRRDYSPRKDDRRDRDRDRDRD	nucl(17.5),cyto_nucl(10),mito(7)	SERDRRRSPPRRRSPSPRRRDYSPRKDDRRDRDRDRDR (95-132, prob:0.995)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI23	Uncharacterized protein	Medium	11.9	1	105-130	GMAALKPRDRTKRKAKAKKRKGMTAT	nucl(14.5),cyto_nucl(10.5),mito(7),cyto(5.5)	KPRDRTKRKAKAKKRKG (110-126, prob:0.994)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJY7	1,3-beta-D-glucan-UDP glucosyltransferase	Medium	13	3	288-316, 328-347, 1823-1849	VGFANIKGRSGKRKNKKKKATPENEAEAL, AEYRWKTRMNRMSQHDRVRQ, QIRPPIYSMKQTKLRRRRVIRYSILYF	plas(25)	KGRSGKRKNKKKKA (294-307, prob:0.981)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKW9	Uncharacterized protein	Medium	14	2	122-144, 370-390	TTTTTKTTTKKPNRLSRIFHRKH, LWYFHKRGKEEREKREKEAAE	cyto(9.5),cyto_nucl(8.5),nucl(6.5),mito(6),pero(2)	DKAGKKGGTGKEEVKP (12-27, prob:0.758),RGKEEREKREK (376-386, prob:0.698)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMF3	Chromosome segregation in meiosis protein	Medium	11.6	1	60-79	KELDLKRRPRAPRVKLDEAR	nucl(13.5),cyto_nucl(13.5),cyto(10.5)	KRRPRAPRVKLDEARLLSDKGIPKLRKMAPRLKFKGK (65-101, prob:0.926)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNE2	Uncharacterized protein	Medium	10	1	97-116	GGEKAKKKKVNPKEGGGKKF	mito(13),cyto_nucl(7),nucl(6.5),cyto(6.5)	GGEKAKKKKVNPKEGGGKK (97-115, prob:0.954)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPX0	Uncharacterized protein	Medium	10.2	1	17-36	AEQARLRKARREAKIKAGAE	plas(9),nucl(6),cyto(4),E.R.(4),mito_nucl(4)	RLRKARREAKIKA (21-33, prob:0.838)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQE2	Uncharacterized protein	Medium	10.1	1	593-626	VVVERRKREIKEHYERTRKKLRWQPPKGGKDSVL	cyto(12),cyto_nucl(11.333),nucl(9.5),cyto_mito(8.333),mito(3.5)	RRKREIKEHYERTRKKLRWQPPKG (597-620, prob:0.871)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1D8	Uncharacterized protein	Medium	12.2	2	53-76, 202-223	VGTVLVCLRKRRRRLPFLPRGVSP, ITSPKRTPSRRLSKPPPPNSAT	extr(8),nucl(6),plas(5),cyto(3),mito(2),E.R.(1),golg(1),vacu(1)	KRTPSRRLSKPPPPNSATGRRSHHARAR (206-233, prob:0.798)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q760	Uncharacterized protein	Medium	10.9	1	403-429	RTRENVWSRAWRRKKLREQQEGTKSKA	nucl(10.5),cyto_nucl(9),cyto(6.5),mito(5),pero(5)	RK (415-416, prob:0.607)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8I7	GAR domain-containing protein	Medium	10.8	2	672-692, 781-800	LAPARNSRPRHQRDNREIKVY, HSPVSPLKVRKTRRSPTVNS	nucl(12.5),mito(12),cyto_nucl(8)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD89	Uncharacterized protein (Fragment)	Medium	12.4	2	418-437, 796-820	HIRLHRKRARIRERARQATR, QDRASPPTPPQPRRRRAASRADGSS	plas(22),E.R.(2),nucl(1),golg(1),vacu(1)	LHRKRARIRERARQA (421-435, prob:0.874),RR (809-810, prob:0.605)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFB0	Uncharacterized protein	Medium	12.1	1	40-61	QNTDGNKPPKQKKRVRFVRGHD	nucl(16),cyto_nucl(12),cyto(6),mito(5)	KQKKR (49-53, prob:0.64)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH96	Sec3-PIP2_bind domain-containing protein	Medium	12.2	1	71-92	VAVRKSGRVRVHKSKENPNGTF	nucl(16),cyto_nucl(13.5),cyto(9)	KKRSRGEIAGALRK (462-475, prob:0.696)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNA9	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.4	1	2-64	LLYTRLAPPKQPKRRSRGGTKKKCDEKRPKCSRCQDQGVECVYEAVKPRQRRRRDSAAPSSPH	nucl(14),mito(8),cyto(4)	PPKQPKRRSRGGTKKK (9-24, prob:0.945)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNL7	TauD domain-containing protein	Medium	10.4	1	292-316	LSASSTHRIKKKRRAYEGRKRVDTH	mito(12.5),cyto_mito(9),nucl(8),cyto(4.5)	RIKKKRRAYEGRK (299-311, prob:0.89)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPD2	HIT-type domain-containing protein	Medium	12.8	2	12-34, 253-274	ICHTEPPKYKCPRCGVRTCSVPC, GPPAAKKRKTHHHNKNQFPTVC	nucl(8),mito(7),cyto(7),cyto_mito(7)	RPGPAKRPRRQGADGAGGRGGKRFRSS (436-462, prob:0.945)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q573	Nucleolar GTP-binding protein 1	Medium	11	1	611-633	RTKAERQAKLSQRKMNRMARQGE	cyto(14.5),cyto_nucl(14),nucl(12.5)	KHKLIRNEAKMRKSLKNRALIPRSKQKK (497-524, prob:0.9)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5V0	Uncharacterized protein	Medium	11.2	1	598-622	MLINTRTARWRRRAPTTPSRWRVAG	nucl(23),cyto_nucl(14)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8F0	Ubiquitin carboxyl-terminal hydrolase	Medium	11.8	2	234-260, 922-941	PDLPFPQRTSKLRRRKKHLGADAERVE, SSNGQKAKQQHKESMKENKV	mito(15),cyto_nucl(6.5),nucl(6),cyto(5)	KLRRRKK (244-250, prob:0.758)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC9	Uncharacterized protein	Medium	11.2	2	17-39, 50-73	EIVLCKKAQKSKKSKSSSPCTVV, DICKDCEKSKRQCHKEWDKRWEKI	nucl(15.5),mito_nucl(12),mito(7.5),cyto(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC83	Nuclear cap-binding protein subunit 2	Medium	13.4	1	13-36	QPSAYFASRNKRRRLEREQRDGDG	nucl(21),cyto(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF02	Protein BFR2	Medium	14.7	1	538-561	LKENKTRKTVDRRASKGRKLRYTV	nucl(18.5),cyto_nucl(13),cyto(4.5),mito(3)	RIKK (170-173, prob:0.614),KTVDRRASKGRK (545-556, prob:0.699)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIQ7	Alphavirus-like MT domain-containing protein	Medium	10.3	1	169-193	DYETANRRNAKKQRARAVQQNPAQF	nucl(22),cyto_nucl(14.5),cyto(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNR8	Zn(2)-C6 fungal-type domain-containing protein	Medium	10	1	5-34	HLTPNACLVCRRKRTKCDGQLPCRRCRSRG	nucl(14),mito(6),cyto(4),plas(2),cyto_pero(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQC3	Uncharacterized protein	Medium	13.9	1	22-50	ANSGNNNKNRVSKKKKDDGPKPKKEDDEN	nucl(22),cyto_nucl(12.5),mito(3)	KNRVSKKKKDDGPKPKK (29-45, prob:0.922)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1R2	DNA-directed RNA polymerase subunit	Medium	10.3	1	131-160	RDPKVRFKRVWDICKSKRRCDNDPPKQAED	cyto(12.5),cyto_nucl(11),nucl(8.5),cysk(5)	GRPVKAIRARLKGKEGRLRG (333-352, prob:0.876)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2P5	Uncharacterized protein	Medium	13.9	1	100-119	NFVPQKRKSWHKVYDKYEKL	nucl(22.5),cyto_nucl(13),cyto(2.5)	KRRPKGLSAAPG (400-411, prob:0.695)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q351	Uncharacterized protein	Medium	10	2	246-269, 895-922	VVGWHWFTSRRRRQRMRDAAARAH, GAWMGIAKAKRKQRKHPGTELRYKPYRI	plas(20),E.R.(4),mito(1),extr(1),vacu(1)	KAKRKQRKHP (902-911, prob:0.821)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4L4	Uncharacterized protein	Medium	10.8	1	11-35	NANLDHSKLPQPKKRSRPEVISLIS	nucl(15),mito(4),cyto(3),plas(2),cyto_pero(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6T0	WD_REPEATS_REGION domain-containing protein (Fragment)	Medium	11	2	1054-1078, 1185-1205	TDGHVAVWKKEKKKKNQNPTAASSG, SNDQRVKLWRAERRREKEEEE	cyto(11.5),cyto_nucl(8),mito(6),extr(6),nucl(3.5)	KEKKKK (1063-1068, prob:0.677)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q778	Uncharacterized protein (Fragment)	Medium	12.6	1	6-36	TYYNYGKKGHYKRECQSPKKEWKPVPRKEIA	nucl(19),cyto(6)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9H6	Uncharacterized protein	Medium	10.3	1	51-71	DGVAPRAKMNQQRARRFRTAL	cyto(10.5),cyto_nucl(10),nucl(8.5),cysk(4),mito(2),pero(2)	PRGGRGRGRGGARGRGDGPVFRGRGRG (1018-1044, prob:0.946)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAB0	AAA domain-containing protein	Medium	13.1	1	13-55	GGGKDGRDDKDKKKDKPKYEPPPRPTTRIGRKKKKAGGSSAAA	nucl(19.5),cyto_nucl(13),cyto(5.5)	GRDDKDKKKDKPKYEPPPRPTTRIGRKKKKAGGS (18-51, prob:0.994)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAX2	Uncharacterized protein	Medium	14.4	1	111-130	KPKGKDREKGAGKNNRPRPS	nucl(15.5),cyto_nucl(11),cyto(5.5),pero(3)	RAKGKAKPTDPHGKPKGKDREKGAGKNNRPRPSR (98-131, prob:0.993),R (465-465, prob:0.602)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ12	Adenine DNA glycosylase (Fragment)	Medium	10	1	339-361	AVNHARKFPLRKPKKKVPLEDIL	mito(22.5),cyto_mito(14),cyto(4.5)	KEEKRGPKSPAGGR (313-326, prob:0.759),ARKFPLRKPKKK (343-354, prob:0.872)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1V6	Uncharacterized protein	Medium	12.9	1	790-820	AWCVSCQTKRTERRAPKCRKCRTAVIGQYVR	nucl(23),mito(2),cyto(2),cyto_mito(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3J7	Uncharacterized protein	Medium	10.7	2	17-43, 168-190	GSPTDEQDSQKKPRRSQRLSQRADRDV, AAVTKRGSRKKQATPAKQQDQND	nucl(12.5),cyto_nucl(8.5),mito(4),cyto(3.5),pero(3),plas(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3R1	Uncharacterized protein	Medium	12.4	1	76-102	LLKDMLSKSYRQKRPKSRATMNERLAF	nucl(14.5),cyto_nucl(9.5),mito(9)	VSPRRRGRP (20-28, prob:0.73)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3S0	Anaphase-promoting complex subunit 2	Medium	12.2	2	148-172, 266-285	QQQQQQQQASSRRRRGRDRDVTTST, QGSRRRQIGRKEKGKGKGHH	mito(9),cyto(8.5),cyto_nucl(8.5),nucl(7.5)	GSRRRQIGRKEKGKGKG (267-283, prob:0.945)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9Z1	Uncharacterized protein	Medium	10.4	2	75-95, 1105-1126	NFVRRRHSSTWNKLTHRNQPS, IRDYERERRARERQRRLVEEEH	nucl(12.5),cyto_nucl(12.5),cyto(11.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE58	Uncharacterized protein	Medium	10	2	2-25, 663-694	TKLWLPRGLSRPLRRPVRRNGTGI, LGHVRRSQRRGPTPPPPPPRSEQQQQQQQREG	mito(24),cyto(3)	R (16-16, prob:0.605)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHC0	Vacuolar protein sorting-associated protein 27	Medium	11.1	1	43-67	VQPKEAMRSLKKRINNKNPNTQLSA	nucl(23),cyto_nucl(14.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI59	Uncharacterized protein	Medium	13.1	1	885-910	EELMQLMANKKKRKRRKGGGSGAGAG	nucl(19.5),cyto_nucl(13),cyto(5.5)	KKKRKRRKGGGS (894-905, prob:0.987)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZZ7	Pre-mRNA-splicing factor 38	Medium	12.6	1	240-260	SERSRSRSRSRSRSASATRRS	nucl(17),cyto_nucl(13),cyto(7)	RKLRKKG (145-151, prob:0.739)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E4	HTH La-type RNA-binding domain-containing protein	Medium	13.2	1	137-160	DSADGRKGRKGKKGRTADKDAPSD	nucl(11.5),mito(11),cyto_nucl(8.5),cyto(4.5)	GRKGRKGKKGR (141-151, prob:0.935),RGPKPRGGAPRGGRE (344-358, prob:0.805)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q302	SAC domain-containing protein	Medium	14.3	2	117-140, 1105-1131	GVGNGPGRRPKPKQRMHRFSLYET, EEDALKKRYKAYRKWLRGKSLFKQQPV	nucl(16.5),cyto_nucl(11.833),cyto(6),pero(4)	RRPKPK (124-129, prob:0.699)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q348	Uncharacterized protein	Medium	12	2	42-64, 98-123	ALGVKLGHRRKLQRRIANSRGIA, TVGTVVTKRKYRRHPKPDENAPERPP	nucl(20),cyto_nucl(14),cyto(6)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7K6	Uncharacterized protein	Medium	10.1	1	2-21	APIAKKTGAKKGPKVTKKFI	cyto(9.5),mito(9),cyto_nucl(9),nucl(7.5)	KTGAKKGPK (7-15, prob:0.702)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7U5	Uncharacterized protein	Medium	13.5	1	36-55	QRELEKKKRRSLFGFGKKKT	nucl(20.5),cyto_nucl(13.5),cyto(3.5)	EKKKRRSLFGFGKKKTTEAPAKAAPPSSKPP (40-70, prob:0.908)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7W7	H/ACA ribonucleoprotein complex subunit CBF5	Medium	10.5	1	437-489	SAPEERADEEKKKRKKHEGETPEEKAERKRLKKEKKEKKKAEKSKESKEAEES	cyto(15.5),cyto_nucl(13),nucl(9.5)	RADEEKKKRKKHEGETPEEKAERKRLKKEKKEKKKAEKSKES (442-483, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE17	Uncharacterized protein	Medium	11.6	1	304-328	RAELRMFKEKRRAKKEEKRRAWLRD	nucl(13.5),cyto_nucl(10.5),cyto(6.5),pero(3),mito(1),extr(1),golg(1),cysk(1)	KAERAGIKPSRAELRMFKEKRRAKKEEKRRAWL (294-326, prob:0.993)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE56	Uncharacterized protein	Medium	10	2	503-526, 622-652	PSLSHCQTKGRRQQPQPQPQPQAC, QTGRAERAGKRERRRMWWRRKAGREDREVSE	plas(26)	RAERAGKRERRRMWWRRKAGR (625-645, prob:0.964)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHH6	PNPLA domain-containing protein	Medium	10.7	1	17-41	EPASALRSSKPKPKRAPTRVSIVAP	nucl(8.5),plas(8),cyto_nucl(7),cyto(4.5),mito(3)	KPKPKR (26-31, prob:0.688)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP74	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.8	1	19-65	PVSASKEQQTRPPPRKRRRIVISCTECHRRKQKCDRKFPCTNCVSRN	plas(13),nucl(12)	PPRKRR (31-36, prob:0.712)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q098	R3H domain-containing protein	Medium	13.9	2	10-41, 202-223	SQRGSHRGRGWRGSRFRRGRQHGPRRSDPPAE, THLHCVKKWHTNQMKERRENPG	mito(18),nucl(5),cyto(4)	SHRGRGWRGSRFRRGRQHGPRR (14-35, prob:0.925),GRGSGGRGRRGGGRRGTGQR (82-101, prob:0.915)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4D4	RNA helicase	Medium	10.7	1	694-722	VEDLQRTKRQRMRKMAKKIEKKERTLLGP	mito(15),nucl(7),cyto(4)	KRQRMRKMAKKIEKKE (701-716, prob:0.891)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M1	Importin subunit alpha	Medium	12.7	1	11-30	RTQFKAKSTFKPEELRRRRE	nucl(16.5),cyto_nucl(11),cyto(4.5),pero(3)	LRRRREEQQVEIRKAKREENLAKRR (25-49, prob:0.772)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB41	Uncharacterized protein (Fragment)	Medium	12.9	1	400-423	VSAHRPTRADCHHRRPRPRASSLS	nucl(22),mito(2),cyto(2),cyto_mito(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN2	Alba domain-containing protein	Medium	14.3	1	6-45	VMQSSSPKPHHGKRKLHSDSNERSPKKRRAGEPRSHTQGQ	nucl(24),cyto_nucl(14)	KPHHGKRKLHSDSNERSPKKRRAGE (13-37, prob:0.913)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGI1	Ribosomal protein L19	Medium	11.6	1	160-179	DAKRARTKAARERKLERQAA	mito(16.5),cyto_mito(11),nucl(6),cyto(4.5)	RARELNLARRIGRHRGFGKRKG (62-83, prob:0.892),KRALVEHIHRAKAEKARERQIKEEMDAKRARTKAARERKLERQAAKR (135-181, prob:0.972)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q065	Uncharacterized protein	Medium	14.2	1	40-63	AIIKDIRRFKKRRARKSAVATPGT	nucl(24),cyto_nucl(14.5)	DIRRFKKRRARK (44-55, prob:0.937)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0D3	Mago-bind domain-containing protein	Medium	14.9	1	121-148	DPEAEKEKKVRNLKKKLRQAKELKEKKE	nucl(19),cyto_nucl(13.5),cyto(6)	SKNAKRREARKRAKAA (87-102, prob:0.957),EAEKEKKVRNLKKKLRQAKELKEKK (123-147, prob:0.974)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0M8	S1-like domain-containing protein	Medium	12.5	1	1-26	MPKNKGKGGKNRRRGKNENDNEKREL	nucl(17.5),cyto_nucl(11.5),mito(5),cyto(4.5)	KNKGKGGKNRRRGK (3-16, prob:0.936)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q956	Uncharacterized protein	Medium	10.4	1	201-222	VRVTMMHPKKRDKRRASLDEAG	mito(19),nucl(6)	KRDK (210-213, prob:0.624)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBV1	SNF5-like protein	Medium	14.8	1	144-176	IYPSQKPRPGKRTTPPLKFSKRDMKKQAEQHEE	nucl(19),mito(3),cyto(3),cyto_mito(3)	RPGKRT (151-156, prob:0.645)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDT7	Uncharacterized protein	Medium	10	1	179-204	GIEIVKRRNKRARRARLTYMRKPKHD	mito(23.5),cyto_mito(13)	KRRNKRARRARLTYMRKPK (184-202, prob:0.939),KRSRKVFSSGKAAGAAGGASKKATDSKKK (216-244, prob:0.845)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF79	Uncharacterized protein	Medium	11.2	1	104-146	STSVSRRDRRRSPPNLRRENKNMATRRRRRRLEQQRRGRQARG	cyto(11),nucl(10),extr(5),mito_nucl(5)	RRDRRRSPPNLRRENKNMATRRRRRRLEQQRRGRQAR (109-145, prob:0.991)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFY0	DNA-directed RNA polymerase subunit	Medium	13.3	2	2-23, 1519-1543	AVETRTRRRKEQLVDQLPKRFK, EDAWKKDESIRRKMRLEKRRSGMGG	nucl(11),mito(11),mito_nucl(11)	RRKMRLEKR (1529-1537, prob:0.675)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGF2	Uncharacterized protein	Medium	10	1	119-139	VFEKRFRAIVKRERERKLRAG	plas(24),E.R.(2)	FRAIVKRERERK (124-135, prob:0.72),RRPNKR (608-613, prob:0.649)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHB1	Uncharacterized protein	Medium	13.2	1	66-91	DHPVQRLRSKSSLRRRRRGLASPFVN	nucl(11.5),cyto_nucl(10),cyto(7.5),mito(4),extr(3)	SLRRRRR (77-83, prob:0.699),RRGGGGGGGTGRPGKQ (282-297, prob:0.663)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ74	DUF2235 domain-containing protein	Medium	12.8	1	47-72	GPEIHHRHQDSRRHHKPRKIVLCFDG	nucl(13),cyto(7),mito_nucl(7)	RGRRR (338-342, prob:0.637)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK32	Uncharacterized protein	Medium	12.2	1	107-127	AGTGTVRKKKKDRHAYHTVEA	nucl(11),cyto(9),cysk(4),pero(2)	K (115-115, prob:0.602)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK90	PCI domain-containing protein	Medium	11.6	1	14-39	GGYRGGKDLKPKGKKASKKEGDDEMT	nucl(12.5),cyto_nucl(11),cyto(6.5),mito(5)	GGKDLKPKGKKASKK (18-32, prob:0.907)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3G2	Uncharacterized protein	Medium	14.1	3	183-209, 349-370, 549-590	TPGSHQAQLRRRRSSRQHAPTRSSSPG, ESLSRPRRSFFHSQRRRLTESL, EASKNWKWKGKEPSPPKPRSHDTRKTRRSKKSDQPADLHQRP	cyto(7.5),extr(7),cyto_nucl(6),nucl(3.5),E.R.(3),mito(2),pero(2)	SKNWKWKGKEPSPPKPRSHDTRKTRRSKK (551-579, prob:0.969)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H0	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.9	1	136-158	CEVCRSRKSRCDGTKPKCKLCTE	nucl(18),cyto(6),mito(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6N1	Uncharacterized protein	Medium	13.5	1	24-50	ESEDYQPQPQPRKKRNQRAKAGQGPLD	nucl(21.5),cyto_nucl(14),cyto(3.5)	KKRN (36-39, prob:0.645)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBP1	Uncharacterized protein	Medium	13.3	2	199-221, 409-431	DTAEDTRRTKRRKLNPDRHTSAF, EDPSSHSRPPRQPPRRGNRYSVG	nucl(23.5),cyto_nucl(14)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBS2	Ribosomal protein	Medium	10.4	1	90-109	LKKLNKNKKLIKKLARKYDA	cyto(12.5),cyto_nucl(11.833),nucl(10),mito_nucl(7.833)	NKNKKLIKKL (94-103, prob:0.728)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCX1	Pre-mRNA-splicing factor	Medium	13.7	1	1280-1313	NDCKSRCPSRLIDHRFERKKEGKKKTNMPFSQTS	nucl(12),cyto_nucl(8.5),plas(5),mito(4),cyto(3)	KKRR (774-777, prob:0.668),RKKEGKKK (1297-1304, prob:0.708)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGK4	Uncharacterized protein	Medium	13.5	1	624-648	TPSQANKAAPKKKENKNAKAKATAQ	nucl(21),cyto_nucl(14),cyto(3)	KAAPKKKENKNAKAKAT (630-646, prob:0.895)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIL4	Uncharacterized protein	Medium	12.9	1	491-511	SEPNKKQRETSQERADRKRAE	nucl(16.5),cyto_nucl(10),mito(7)	KKQRETSQERADRKRAELQKEMERRAAAGPAKKKRKF (495-531, prob:0.986)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q252	TEA domain-containing protein (Fragment)	Medium	12.7	2	77-100, 910-937	GTPAYPRPQQRQEARLRGRKQGRG, QTVRSRRGSEQQQQHHHHHHQHHHPSGS	nucl(21.5),cyto_nucl(13),cyto(3.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E7	Nitrogen permease regulator 3	Medium	11.4	1	465-484	AIERRFRDKARKNRGVGKSD	nucl(12.5),cyto_nucl(9.5),cyto(5.5),mito(5),pero(4)	KARKN (473-477, prob:0.652)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBB8	Uncharacterized protein	Medium	11.1	1	2-49	VAAKKHIPIVKKRTKRFIRHQSDRFKCLDSAWRKPKGIDNRVRRRFKG	mito(16),cyto(7.5),cyto_nucl(6),nucl(3.5)	IVKKRTKR (10-17, prob:0.736),RKPKGIDNRVRRR (34-46, prob:0.665)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD11	Uncharacterized protein	Medium	12.3	1	263-311	GLCIWCRRPNPDRRKKGCPTCLPRRAGLTAEWRRKRKAAERRRRGELGD	nucl(16),cyto_nucl(10),mito(5),cyto(2),plas(2),extr(2)	AEWRRKRKAAERRRRG (292-307, prob:0.97)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD42	Uncharacterized protein	Medium	10.3	2	2-21, 147-169	QLNKERQRKVRNALHRSLPR, LDRFVMKEKRLPRPQRRAIRLLY	nucl(11),mito(11),mito_nucl(11)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT3	Uncharacterized protein	Medium	13.1	2	1004-1024, 1064-1086	STVIEAIKKRQQKNDRVKGPG, TQSPAGTPRRERHSRHQNPDGSP	nucl(17),cyto(4),mito(3),extr(2),cyto_pero(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJB5	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.1	1	40-63	CTIPPPRPMGRPPRRQNRSQSTSS	nucl(21),mito(3),cyto(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QME7	BZIP domain-containing protein	Medium	14.3	1	87-113	TTVTPEPEKKPVKKRKSWGQVLPEPKT	nucl(23.5),cyto_nucl(14)	KKPVKKRKSWGQVLPEPKTNLPPRKRAKTEDEKEQRRVERVLRNRRAAQSSRERKR (95-150, prob:0.955)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN28	ANK_REP_REGION domain-containing protein	Medium	13.8	1	406-431	CENCIGRERKRAGRKKSKHPQDEEAW	nucl(13.5),cyto_nucl(10),cyto(5.5),plas(4),mito(3)	RERKRAGRKKSKH (412-424, prob:0.947),RRKSAANTPARMRSPSRPRRR (1087-1107, prob:0.809)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q001	WD_REPEATS_REGION domain-containing protein	Medium	11.5	2	158-181, 569-595	GEGHRSSWGPRRNNKRFPKVPSDE, ATRASSVQPRPERRHRLHHRYSNGWES	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2S5	Uncharacterized protein	Medium	10	1	313-335	LLGLRREKRKEEVRSRSRTRSGT	extr(11),plas(10),mito(2),cyto(2),cyto_mito(2)	ARKEKSKGK (290-298, prob:0.703),RREKRKEEVRSRSRT (317-331, prob:0.767)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q447	Transcription initiation factor IIF subunit beta	Medium	12.5	1	227-247	FLKTREKPTKAKKMENKATRW	nucl(17),cyto_nucl(12.5),cyto(6),pero(2)	MEPPAERGKKGAYSRRPIPKKTRIAGKI (148-175, prob:0.955)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4M4	Uncharacterized protein	Medium	12	1	108-129	ASKMRPAAHCARRKNRIRFLDD	nucl(19),cyto(5),mito(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDM6	Myb_DNA-bind_3 domain-containing protein	Medium	14.8	2	83-103, 408-427	KTDNARKKYRLWRGLREDPEF, PDAVRRHWVKRLREVHNRIA	nucl(19),cyto_nucl(12.5),mito(4),cyto(4)	KRLTKPRRK (158-166, prob:0.699)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF52	Uncharacterized protein	Medium	12.1	1	1291-1317	SLPKAPPQKLSQKEKKRQQQVAQAAQA	nucl(15),cyto_nucl(12),cyto(7),mito(3)	GGSGKRARRGKAAGRGQRGGRGGGAGSRDDKAGESRGRGGGGRSGTGASGAGGSRGAKGKGNGKGRGGGGGSSSGGGRG (1517-1595, prob:0.995)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFL8	Carbohydrate-binding module family 48 protein	Medium	10	1	684-709	DGATDKATSDKKKKHRISGFFSKLKS	cyto(12),cyto_nucl(10.5),nucl(7),mito(3),pero(2)	KKKKHR (694-699, prob:0.715)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKA5	Flap endonuclease 1	Medium	12.7	1	366-395	LEEQNEAKKKKLKEEKKEKAKSKAKPRGAV	nucl(15.5),cyto(9),mito_nucl(8.5)	KAAHKRKLEEQNEAKKKKLKEEKKEKAKSKAKPRGAV (359-395, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNC1	AIP3 domain-containing protein	Medium	10.5	1	176-203	INLLHGLKRKQTRLRQRQQRERENAPLG	mito(17),nucl(7.5),cyto_nucl(5.5)	K (961-961, prob:0.606)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPU0	Uncharacterized protein	Medium	11.3	2	2-22, 113-144	TSDTRPPPAKRRRALSPHAAQ, REDEERTRRNREKREKKKRRKEQAAKEKSKSG	mito(19),nucl(4),cyto(4),cyto_nucl(4)	ERRRREREREDEERTRRNREKREKKKRRKEQAAKEKSKS (105-143, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQF1	Leucine carboxyl methyltransferase 2	Medium	11	2	86-112, 120-141	VLVRNFLRTLRRPRQQQHQQHGRPEEG, EEEEEREKRKRGRKGVVVNLGC	mito(12),cyto(10.5),cyto_nucl(7.5),nucl(3.5)	EKRKRGRK (126-133, prob:0.805)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q013	Uncharacterized protein	Medium	10	1	335-367	NTLSGRRRHGANHRRRRSSRSHRHKVSLKEAAA	plas(15),cyto(3),extr(3),E.R.(2),cyto_mito(2),cyto_pero(2)	KKH (127-129, prob:0.615),RRRHGANHRRRRSSRSHRHK (340-359, prob:0.963)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0U2	Uncharacterized protein	Medium	11.5	1	350-369	LARSFARYRRRQPQSPPPLV	mito(22),nucl(4)	AGEKRKRKR (193-201, prob:0.858),GKGKAVVGRQPPGGLKGGSGKHKEKRWLTAARQGGVNHGEQHRARVKKYKKPV (433-485, prob:0.937)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1N9	Class I unconventional myosin	Medium	13.6	1	969-988	SRPTPKGKPVPPRPITKGKL	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(4)	RAKDKAARAERAAGGGGQAAPSKPKK (6-31, prob:0.789),PTPKGKPVPPRPITKGKLIKPGGPGGRPSRNP (971-1002, prob:0.952)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2A0	Uncharacterized protein	Medium	10.2	1	302-325	CVEIRPPRKHSKQSESPSRKQRTV	mito(14),cyto(7),nucl(6)	RRRLEAGRRSGGKGSGKGGGKP (1008-1029, prob:0.893)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q542	Uncharacterized protein	Medium	12.7	1	6-28	GLKVGGKKKKSDDRPDSERQAQQ	nucl(17),cyto_nucl(11),mito(5),cyto(3)	PRRG (673-676, prob:0.631)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q600	SRP54 domain-containing protein	Medium	10	1	229-248	ATGRKGKPAKAAKRGRKWDA	cyto(12.5),cyto_nucl(7.5),mito(5),extr(5),pero(2)	AKMSRRARK (206-214, prob:0.69),TGRKGKPAKAAKRGRK (230-245, prob:0.965)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q661	Uncharacterized protein	Medium	11.1	1	1-32	MPVAPLRAWRVRRRRRFRVRYRYKYRLNILYR	nucl(14.5),mito_nucl(13.333),mito(10),cyto_nucl(8.666)	RVRRRRRFRVR (10-20, prob:0.836)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q839	Uncharacterized protein	Medium	10.1	1	60-88	APSQDTTPKLSKKERRKRKQAEREAAAEK	cyto_nucl(11),cyto(10),nucl(8),mito(5),extr(1),pero(1),E.R.(1),cysk(1)	KLSKKERRKRKQAERE (68-83, prob:0.957)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAE4	Uncharacterized protein	Medium	13.9	3	1-21, 589-612, 730-753	MEPSSKRRRLAPKVPDPPAVS, STPSAKTKARKPLQKQTPKQEVRC, QTTCLVTRRKPPQRSACPKPDCQS	mito(12),nucl(11),cyto(1),plas(1),extr(1),pero(1),cyto_pero(1)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG12	Non-ribosomal peptide synthetase	Medium	13	3	1381-1402, 7456-7475, 7657-7677	IDYASRKDRELQIRNNRQKLQY, LDPSSNKKSSKKSSRAGAGS, AGEAERPKLRRKKVASFPVGL	plas(21),mito(2),E.R.(2)	KLRRK (7664-7668, prob:0.663)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHP9	DBF4-type domain-containing protein	Medium	13.8	2	377-396, 599-623	RDRGREKDRNRDKGRDRDRD, ASVPVSQSKPRRDPKPGYCENCQEK	nucl(12.5),mito(12),cyto_nucl(8)	RDRGREKDRNRDKGRDRDRDRERTPSKTR (377-405, prob:0.919)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLL0	Uncharacterized protein	Medium	14.4	2	11-35, 71-90	FSFWKEKKNNTGDHRPKNEKQKEPA, CPYGRRRRSHVPPPRSPRSR	nucl(14),mito(10.5),cyto_mito(7)	RRRRSHVPPPRSPRSR (75-90, prob:0.736)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPC1	Uncharacterized protein	Medium	10.8	1	44-65	GGDGARPSKKRRFNPRLDEAVI	nucl(10),cyto_nucl(9),cyto(6),pero(6),mito(5)	GGAGRGGAHGGGGRGGR (153-169, prob:0.694)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q468	Uncharacterized protein	Medium	12.6	1	1751-1771	PPKGPVPKRSLEKLKAKRESI	nucl(12),cyto(7),mito_nucl(7)	KGPVPKRSLEKLKAKRESIEKR (1753-1774, prob:0.83)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B3	Uncharacterized protein	Medium	12.7	1	58-79	QTTAKPNHKDLKKNRKFDPTTQ	nucl(17.5),cyto_nucl(13.5),cyto(6.5)	RGSNTRGRGGRGGGRGRDGKSEGGDNTNGQKNGSNKNGRGRGRGGRGGRGGS (288-339, prob:0.956)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7R6	Uncharacterized protein	Medium	10.4	1	228-247	GPTTRSFRARRSTSRKGRAA	nucl(14),mito(9),cyto(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG46	Uncharacterized protein	Medium	11.4	1	199-224	MLDGANRHRRRRRRRRRFSGAPDPGG	nucl(12.5),cyto_nucl(12.5),cyto(11.5)	RHRRRRRRRRRFSGAPDPGGNGGDKKGG (205-232, prob:0.996)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGU0	ANK_REP_REGION domain-containing protein	Medium	13.2	1	535-563	AVMGVCVRKGKKKKKKSRNEGRAKSRGGG	cyto(15.5),cyto_nucl(10.5),nucl(4.5),mito(3),pero(3)	RKGKKKKKKSRNEGRAKSRGGG (542-563, prob:0.998),RSGGPR (778-783, prob:0.606),R (820-820, prob:0.601)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPF4	Uncharacterized protein	Medium	11.4	1	528-552	GGPRGGFRRGRGRGRRDYRGGRGGS	mito(11),extr(8),nucl(4.5),cyto_nucl(4.5),cyto(3.5)	GR (417-418, prob:0.609),PRGGFRRGRGRGRRDYRGGRGGSG (530-553, prob:0.959)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ31	DNA-directed RNA polymerase subunit beta	Medium	10.6	1	124-144	IVYSRDRKKIVRKDIPLCRIP	cyto_nucl(11.5),cyto(10.5),nucl(9.5),mito(3),pero(2)	KKGR (306-309, prob:0.637)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q454	DNA-(apurinic or apyrimidinic site) lyase	Medium	11.1	1	348-367	HAIGRRSRKRKVTTVVQVSE	cyto(12.5),cyto_nucl(8.5),mito(5),nucl(3.5),pero(3)	RK (355-356, prob:0.602),RRRTSKRIKPAGR (383-395, prob:0.797)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6A6	Ribosome biogenesis regulatory protein	Medium	14.9	2	111-132, 169-202	FAKRRGIKPKTREQRRNLRYNE, GTSVRGDKRREIRERVKRNERRMRRNQRIAEGRK	nucl(12.5),cyto_nucl(10.333),cyto_mito(7.333),cyto(7),mito(6.5)	KPVPAPKPETKWAAFAKRRGIKPKTREQRR (97-126, prob:0.945),KEGTSVRGDKRREIRERVKRNERRMRRNQRIAEGRK (167-202, prob:0.99)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6J4	Uncharacterized protein	Medium	11.9	1	768-790	LGAGEGGVRKRRKKPANRAVVGV	nucl(15.5),cyto_nucl(13),cyto(7.5),mito(2),pero(2)	VRKRRKKPA (775-783, prob:0.904)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFB6	Uncharacterized protein	Medium	13.6	2	57-83, 425-456	PPSGIHNTPSRRPKRNRALAERLKSSS, RAGQVAGQRNPRRRMRRRRRRRWVERGGEEAE	cyto(13),cyto_nucl(10.5),mito(7),nucl(6)	RRPKRNRALAERLKSSSP (67-84, prob:0.808),GQRNPRRRMRRRRRRRW (431-447, prob:0.995)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFH8	Glucosidase 2 subunit beta	Medium	10.6	1	162-185	EEERRQSKERSAKRKRTMAKEARE	mito(8),nucl(7),extr(6),cyto(2),pero(2),cyto_pero(2)	RRLEEERRQSKERSAKRKRTMAKEARELRRRV (159-190, prob:0.985)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMT5	HNHc domain-containing protein	Medium	13.8	2	325-349, 384-411	MCRKMWKNARSCSPRKRSAPRSADA, PAERQEDQPRGRSRKRRHSFEEEQDCKD	nucl(13.5),cyto_nucl(10),cyto(5.5),pero(4),mito(3)	RSRKR (395-399, prob:0.649)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY2	Type 1 phosphatases regulator	Medium	13.4	1	129-158	HSHLHRGRGHGKRSRRRKPSPNAYEKMPRY	nucl(20),cyto_nucl(13),cyto(4)	HRGRGHGKRSRRRKPSPNAYEKMPRYDKPRKDG (133-165, prob:0.989)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QND3	Glycosyltransferase family 90 protein	Medium	10.4	2	3-22, 85-109	AAPSWRRRRWFEPQPWALLR, AVAGMVGKRRRRRRSGAMRARADEG	plas(18),mito(5),nucl(1),cyto(1),cyto_nucl(1),E.R.(1),vacu(1)	GKRRRRRRSGAMR (91-103, prob:0.939)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3R9	Uncharacterized protein	Medium	10.1	1	362-381	RNGHVAEKKCKRMKESPKQD	nucl(21.5),cyto_nucl(15),cyto(5.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBJ1	Myotubularin phosphatase domain-containing protein	Medium	13	1	789-809	SSSTGRNRPAGNRKRRTEGKR	nucl(13),mito(7),cyto(4),pero(2)	RNRPAGNRKRRTEGKR (794-809, prob:0.922)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDI6	Uncharacterized protein (Fragment)	Medium	11.7	1	259-285	HKATKPFRGRGLRRRDKKKEEDDEDDC	nucl(12.5),cyto_nucl(10),cyto(6.5),pero(5)	KATKPFRGRGLRRRDKKK (260-277, prob:0.939)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE83	PHD-type domain-containing protein	Medium	14.3	1	650-673	LSELRKLRESRQKQSNSRPKRLGS	nucl(23.5),cyto_nucl(14)	RGKKT (445-449, prob:0.644)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGK2	Uncharacterized protein	Medium	12.9	1	57-83	LRMGNLFSKEKKRSKRRPDDSPPERYY	nucl(16.5),cyto_nucl(10),mito(7)	KEKKRSKRR (65-73, prob:0.827)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI18	Uncharacterized protein	Medium	12	1	353-372	QEQQRHQRQQQQQQQQQQQQ	cysk(11),nucl(6.5),cyto_nucl(6.5),cyto(5.5),mito(3)	RRLDKGKGPPGPKQKK (324-339, prob:0.806),KRHPR (516-520, prob:0.624)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIX4	Cation_ATPase_N domain-containing protein	Medium	12	2	315-339, 1106-1135	ALNQKERRVRPVKRKPNGKAGPHRY, VEAWKWAKRVFLRRRARKRTGRLWKDMDIE	plas(19),mito(3),E.R.(3)	KERRVRPVKRKPNGKAG (319-335, prob:0.904),KRVFLRRRARKRTGR (1113-1127, prob:0.89)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMS2	MFS general substrate transporter-like protein	Medium	10	2	47-66, 89-117	ETRPSGSRTRRRPAADPRSL, GQWSPRRPRAWYKRLFRLRGKKSDSRDEE	plas(17),mito(4),cyto(2),E.R.(2)	RPRAWYKRLFRLRGKK (95-110, prob:0.678)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QND2	HNHc domain-containing protein	Medium	10.2	1	368-394	ECGWLGEPPRGRRRKRSWEGLERDDGQ	mito(14),nucl(6.5),cyto_nucl(5),cyto(2.5),extr(2)	RGRRRKR (377-383, prob:0.778)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP92	Alkyl transferase	Medium	11.1	1	333-357	VLVEWQWRQKQKARDERPRRRVKQA	nucl(10.5),mito(8),cyto_nucl(8),cyto(4.5),pero(3)	KQKARDERPRRRVKQ (342-356, prob:0.837)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPE0	Uncharacterized protein	Medium	13.5	2	83-102, 105-133	SSLARHRRIHTGKRPYRCDH, CSKSFCRKTTMVKHWKRTHQRGPHSPELD	nucl(26.5),cyto_nucl(14)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0P0	Uncharacterized protein (Fragment)	Medium	14.2	2	493-523, 553-577	SSPALRRHPLHRPDDRRKRFARPRERWDPAT, QGFPVWHRFRGKRLKKQIGNAFPPS	nucl(15),cyto_nucl(12),cyto(7),mito(2)	RHPLHRPDDRRKRFARPRE (499-517, prob:0.855)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2V7	Uncharacterized protein	Medium	12.6	1	31-57	GSNNDNRASRPLKRRKLAKTDVSEPQQ	nucl(17),cyto_nucl(13),cyto(7)	KRR (43-45, prob:0.621)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3E9	Uncharacterized protein	Medium	14.2	2	249-273, 301-322	ATRNSGEAKRPPKHRQKKIHLVVLT, DAKARKARERAARRRARKGATT	cyto_nucl(9.833),nucl(9.5),cyto(9),cyto_mito(8.333),mito(6.5)	AKRPPKHRQKK (256-266, prob:0.783),DAKARKARERAARRRARKG (301-319, prob:0.984)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q652	Uncharacterized protein	Medium	10.4	1	637-675	NDDPRTEKRKEMDRKKREAKKKKKKAGKRKSRAGDEAET	nucl(8.5),cyto_nucl(8.5),cyto(7.5),pero(6),mito(5)	EKRKEMDRKKREAKKKKKKAGKRKSR (643-668, prob:1)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9H1	Uncharacterized protein	Medium	11.1	1	567-588	STPSTSSSRRQQTKTRKRGEST	nucl(8),extr(8),mito(7),cyto(3)	KRRSAGGKR (425-433, prob:0.702)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBI3	Ubiquitinyl hydrolase 1	Medium	14.9	2	862-883, 1115-1138	ETPKVLKRFNKRRPKWVNPVEF, QDTWYCPRCKEHRRASKKFDLWKT	nucl(18),cyto_nucl(13),cyto(6)	GRKRGGKHKTYGKGKGRFNKQNRLSRGK (989-1016, prob:0.969)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEW0	zf-primase domain-containing protein	Medium	10.1	1	580-599	AARRGDKSPVRKKTRFVTDK	nucl(19.5),cyto_nucl(13),cyto(5.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFB5	Oxidoreductase-like domain-containing protein	Medium	13.6	2	100-126, 370-396	AAASEDKKPARRTRKPKQETSTPNSKA, VGIREFMKQEKRLKEKHRREGTLGGKD	mito(21),nucl(4)	KKPARRTRKPK (106-116, prob:0.847),RLKEKHR (381-387, prob:0.638)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD4	AAA_16 domain-containing protein	Medium	14.3	2	400-427, 442-463	LFSTHYHGSRRGRRRRHRQRGPGLSSSF, HGRGRGRGRAKHRKIARKLLGA	mito(8),nucl(6),extr(5),cyto(3),plas(2),pero(2)	RRGRRRRHRQRGP (409-421, prob:0.946),HGRGRGRGRAKHRKIARK (442-459, prob:0.981)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Q7	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.8	2	32-65, 83-114	ATVVRRRAPIACRRCRRMRSKCIHEKAKPPCRAC, PDQDREYRHPRARAEKSKKRDDTKARREGRDG	nucl(9.5),cyto_nucl(8.5),cyto(6.5),mito(6),plas(2),pero(2)	RHPRARAEKSKKRDDTKARREGR (90-112, prob:0.936)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5A5	RanBD1 domain-containing protein	Medium	12.1	2	87-106, 124-146	QISSPKKKRARDELDENKDA, QDRTDRSEPEKKRPRDRQASASA	nucl(19.5),cyto_nucl(13),cyto(5.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5G1	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.5	1	1-33	MLRRSHKKSRAGCLECKRRHVKCDEQRPKCIIC	nucl(22),mito(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7B1	Uncharacterized protein	Medium	13	1	16-51	LSQRRGETCKKDKTQRRQGKRNEKGQRQKRHHLPPF	nucl(19.5),cyto_nucl(13),cyto(3.5),mito(3)	KDKTQRRQGKRNEKGQRQKRH (26-46, prob:0.877)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7I6	SH3 domain-containing protein	Medium	11.6	2	87-110, 439-460	SSNTPSPKGTPQKSRTFRKPFEAY, DMVQHLSRRKRDQQHRPQTSMG	nucl(12),mito(11),cyto(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q942	Homeobox domain-containing protein	Medium	11.5	1	181-205	QTAAERTAQRRKMKRFRLTHQQTRF	nucl(25.5),cyto_nucl(14)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBN7	Uncharacterized protein	Medium	13.3	1	6-32	EFFADPNKPKNAKKKPILKELFRVAKM	nucl(22),cyto_nucl(14.5),cyto(5)	KPKNAKKKPI (13-22, prob:0.754)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDJ4	Uncharacterized protein	Medium	12.7	2	233-255, 261-294	DEEGRTRAPRRQRRGRAGQGDAK, HSSHRHCHHHHQQQQQQQQQKRQQQSQQHKQDPL	nucl(8.5),mito(7),cyto_nucl(7),extr(5),cyto(4.5)	RAPRRQRRGR (239-248, prob:0.757)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDP9	Fungal transcriptional regulatory-like protein	Medium	13.5	2	28-51, 54-75	QACALSKVKCPKEKPSCSRCESRL, CEYFFTKRPGRRRGNSTAGPKT	nucl(25.5),cyto_nucl(14)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEI7	Uncharacterized protein	Medium	13	2	21-46, 205-231	EESISQRVTRWKTKQKKIPGRELAAQ, ARPMAECKWKPLRRRPNDVKLMKRESR	nucl(15),cyto(6),mito(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ77	Uncharacterized protein	Medium	13	3	91-110, 714-739, 792-812	DGTLRRSKPIDRRDHRVFKG, SCVWSFCARCSRRRRSRSNKLAAMSP, GSAPPPPYPHQHQQQPQQDMR	extr(23),plas(3)	RRRSRSNK (726-733, prob:0.677)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1R1	Uncharacterized protein	Medium	13.5	2	158-183, 207-242	SESREERKARRAARRLRKAEKAARKA, ASETKEERRARRAERRARKEERRRKRAEAAQKADQG	nucl(12.5),mito(10),cyto_nucl(9),cyto(4.5)	KKEKQSESREERKARRAARRLRKAEKAARKAAEARAAQKAAEKAAKKELKRARKASETKEERRARRAERRARKEERRRKRAEA (153-235, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2H8	tRNA 4-demethylwyosine synthase (AdoMet-dependent)	Medium	11.7	1	22-49	TGNNRRAAKHGPRRIRGDINKKKRESAE	nucl(13.5),cyto_nucl(12.5),cyto(10.5)	RRAAKHGPRRIRGDINKKKRE (26-46, prob:0.945)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4S8	C2H2 transcription factor	Medium	14.4	1	360-386	FGSGSSIPRGRRRRRRRAPVTAAHGGP	nucl(24.5),cyto_nucl(13.5)	PRGRRRRRRRAP (367-378, prob:0.971)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9J0	USP domain-containing protein (Fragment)	Medium	10.2	1	601-641	QHPFDHNKKEERARNKSKTRDREEKKEKGKGKAKNAGKEKE	cyto_nucl(11.833),cyto(11.5),nucl(10),cyto_mito(8.666),mito(4.5)	NKKEERARNKSKTRDREEKKEKGKGKAKNAGKEK (607-640, prob:0.997)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA48	Poly [ADP-ribose] polymerase	Medium	11.9	1	148-170	SDNDAAPKPKRTRGRKAAAVQAD	extr(10),mito(7),nucl(5),cyto(2),plas(2)	GKK (6-8, prob:0.611),KPKRTRGRK (155-163, prob:0.746)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPW4	Sde2_N_Ubi domain-containing protein	Medium	13.7	1	167-188	IKPEMDRREREKRRKRWEEIVE	nucl(12.5),cyto_nucl(9),mito(8),cyto(4.5)	GRMSKRRKG (126-134, prob:0.763),RREREKRRKR (173-182, prob:0.849)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZP5	Protein kinase domain-containing protein	Medium	13.1	2	74-94, 189-210	ESPDQGSRSRRNQPPHDQYGT, DETRRGGRSRHDHSRREKQTKF	extr(9),nucl(8),mito(6),cyto(3)	RGRKRA (835-840, prob:0.686)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0J0	Uncharacterized protein	Medium	13.1	1	477-496	KDPDEPPKRVSRFKKERAAA	nucl(19.5),cyto_nucl(13),cyto(5.5)	KRVSRFKKERAAASSR (484-499, prob:0.765)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1S1	1-phosphatidylinositol-3-phosphate 5-kinase	Medium	14.9	1	1919-1944	SREFEKERLKDRKQRAAKMHHTRAFL	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	LKSHRKAGP (1886-1894, prob:0.681),RK (1930-1931, prob:0.617)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E1	Uncharacterized protein	Medium	12.2	1	620-648	EDIERIQKQMPRKTKKKRKLDDDTWEEYV	nucl(16.5),cyto_nucl(13.5),cyto(9.5)	PRKTKKKRK (630-638, prob:0.872)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4D2	Uncharacterized protein	Medium	11.4	1	833-858	EELSRRQLQRAKQTRRQRLEGCEKES	nucl(12),mito(10.5),cyto_mito(8),cyto(4.5)	SAKRVEGGRRREI (765-777, prob:0.728)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6A3	Peroxin-1	Medium	11.1	2	252-272, 1150-1169	STSTARRKSARQEKKPVLFFR, EGIRLAKKRAKQQLAKGPAA	cyto(10),cyto_nucl(7.833),cyto_mito(7.833),extr(7),nucl(4.5),mito(4.5)	VGGASRKSGKSSTSTARRKSARQEKK (241-266, prob:0.826)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE43	Uncharacterized protein	Medium	11.2	3	7-26, 462-482, 490-512	TSALSRTRSLRKPTKTETTG, VESRRNRGRLHPSRRTSREQS, EEDEEQQQRRRQRQQQEKEEEGE	mito(23),nucl(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHS5	Uncharacterized protein	Medium	11.6	1	191-219	EAAEARTRRRWPRPRQRRLRLRLRLKSLV	mito(13),nucl(9),cyto(3)	RTRRRWPRPRQRRLRLRLRL (196-215, prob:0.958)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ5	Tr-type G domain-containing protein	Medium	14	2	605-631, 636-656	REDGSERREKPKKPKNRRRQEEEEDDD, YYEQRRRKKAEKAERERQRKA	mito(21),cyto(4)	ADKQGREDGSERREKPKKPKNRRR (600-623, prob:0.986),RRRKKAEKAERERQRK (640-655, prob:0.931),RER (1041-1043, prob:0.609)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL34	Rab-GAP TBC domain-containing protein	Medium	12.9	1	217-236	SKATEKRQSRESRPRPPSMA	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	KGGRSKATEKRQSRESRPRP (213-232, prob:0.757)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QML9	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.8	1	6-42	PDLEREMPAKRRRVRKGTRSCWECKRRKIRCMLPAPG	nucl(15),cyto(8),mito(3)	AKRRRVRKG (14-22, prob:0.777)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN53	KOW domain-containing protein	Medium	10.6	1	319-338	QEYNRKMRELRRQRGKPVLT	mito(13),nucl(8.5),cyto_nucl(7),cyto(4.5)	KKARRKGA (302-309, prob:0.749)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP49	Uncharacterized protein (Fragment)	Medium	10.6	1	654-676	HTTLWRFSRRAVCKQLNNRENEF	cyto_nucl(9.5),nucl(9),cyto(8),mito(5),pero(3)	KGKRK (370-374, prob:0.664)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4L6	Uncharacterized protein	Medium	12.2	1	330-357	HGSTPIQVRRPTRRRRRLSKVSFPFPPE	nucl(11),cyto(10),mito(5)	RRPTRRRRR (338-346, prob:0.798)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIW0	Uncharacterized protein	Medium	14.3	1	338-365	RAFGEREKGGRRRRWGRRESRGSTCRTP	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(4)	K (195-195, prob:0.606),REKGGRRRRWGRRESR (343-358, prob:0.942)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK59	Glycosyltransferase family 71 protein	Medium	10	2	71-98, 503-533	YANYNHHHHQHRHQQHHQHHQHHNNDDE, MTVIREKKVEGKKKKKEKKKKNGEEEEEEEL	extr(11),plas(8),E.R.(3),mito(2),golg(2)	EKKVEGKKKKKEKKKKN (508-524, prob:0.997)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKH4	Clr5 domain-containing protein	Medium	12.8	1	554-573	AEELRKKRREHSWLERVRLE	nucl(15),cyto(8),mito_nucl(8)	KKR (559-561, prob:0.628)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP91	Chromatin modification-related protein	Medium	13.2	2	12-32, 759-778	VTGSSRRQPVRQTRVNPPRTS, GNAKWYCEDCKKRLKITERR	nucl(24),cyto_nucl(14.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ95	Uncharacterized protein	Medium	13.4	1	17-40	NGSPPPAQSKRDKRRQMLADRLAS	nucl(21.5),cyto_nucl(13.5),cyto(4.5)	RKGGRGGRG (545-553, prob:0.696)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5D9	Uncharacterized protein	Medium	10	1	244-267	GGSGMRRRRSRSRSRNRSRSSTST	extr(14),golg(5),mito(2),plas(2),E.R.(2),vacu(2)	MRRRRSRSRSRNRSR (248-262, prob:0.901),RGRAEKAGGRERGRAR (299-314, prob:0.8)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5T0	Uncharacterized protein	Medium	13	1	818-848	KLAEIFKQRAKKTNKKKAKKDAKDTVVNFKH	nucl(20),cyto_nucl(14),cyto(6)	KQRAKKTNKKKAKKD (824-838, prob:0.957)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8J4	Uncharacterized protein	Medium	11	1	21-40	SSARIKKNPKTQQIKFKVRC	nucl(22.5),cyto_nucl(12),mito(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAY5	Uncharacterized protein	Medium	13	1	15-34	GERRARKEIEREQKRKEGAK	nucl(19.5),cyto_nucl(14),cyto(5.5)	RRARKEIEREQKRKEGA (17-33, prob:0.782)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB55	Uncharacterized protein	Medium	12.1	1	11-34	ADDRKARLAKLKSLKRKQPTGADA	nucl(15),cyto_nucl(12),cyto(7),mito(3)	RLAKLKSLKR (17-26, prob:0.661)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD55	HMA domain-containing protein	Medium	10.8	2	189-218, 227-252	CLPSRRPSTGSARRRRRRSKESALRSRTSA, ADAACCSTKKRPGSRKKNECRSSSDG	plas(18),cyto(3),E.R.(3),nucl(2)	PSTGSARRRRRRSKES (195-210, prob:0.943)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIN5	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	Medium	14.2	2	16-39, 41-69	GYACQACTKRKVKCDKAAPTCSSC, KSKLSCGYEPPRPRTRKRKPSEDVLERLA	nucl(11),cyto(8),mito(7)	RPRTRKRK (52-59, prob:0.727)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ57	Uncharacterized protein (Fragment)	Medium	10.1	1	5-30	AAKLPGRTNKDCRKRWINKVCGNLKR	nucl(19.5),cyto_nucl(12),cyto(3.5),mito(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKH1	Uncharacterized protein	Medium	13.7	2	110-140, 220-241	AEVLQNKERVKKRKKYERKQKLRKFFCQGEK, RWASCKRSEKLGRPPNKKRLFL	cyto(11),nucl(10),pero(3),mito(1),golg(1),vacu(1)	KERVKKRKKYERKQKLRK (116-133, prob:0.969)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKH8	SWIB domain-containing protein	Medium	12.5	1	143-165	AKTKMKAKATKKKSAKRVRSDDD	nucl(18),cyto_nucl(14),cyto(8)	RVTRGAGTAKTKMKAKATKKKSAKRVR (135-161, prob:0.978)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP14	SWIB domain-containing protein	Medium	14.7	2	26-47, 175-196	QANHLAKLRSRKPTDKNLPDGV, TDSPSKTKAKPAPTKRPRLSHF	nucl(20),mito(4),cyto(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2M2	Uncharacterized protein	Medium	12.3	1	293-313	ARPAQPEKRKSWFARRFSKHG	nucl(19),extr(4),cyto(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B1	ATP-dependent DNA helicase II subunit 1	Medium	11.7	1	574-594	ERPAAKRTKVAPKKADRGQMS	nucl(12.5),cyto_nucl(9),pero(8),cyto(4.5)	PAAKRTKVAPKK (576-587, prob:0.715)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q681	Glutamine--tRNA ligase	Medium	10.1	1	34-63	WVSKGELKKRLAKRAKKALKEKNKDAKDTT	cyto(18.5),cyto_nucl(14),nucl(8.5)	ELKKRLAKRAKKALKEKNKDAK (39-60, prob:0.986)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7D5	RanBD1 domain-containing protein	Medium	10.6	1	703-722	GSNADKAKKNKSPWKVQGVG	mito(13.5),mito_nucl(13.333),nucl(12),cyto_nucl(6.833)	KRPRAPESPAKNKRK (365-379, prob:0.755)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q896	WD_REPEATS_REGION domain-containing protein	Medium	12.6	2	21-42, 95-117	ASSPPRAPSSRAKERRNPSITP, SEDAHRGKRRKFNHSTPEKQAGA	mito(14),nucl(8.5),cyto_nucl(6.5),cyto(3.5)	SSRAKERRNPSITPR (29-43, prob:0.712)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD54	Uncharacterized protein	Medium	10.6	1	7-27	QSQLKKKASFRDRLKAWQKPP	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEK6	Uncharacterized protein	Medium	12	1	430-449	LERERERELKRSMKKQTLRA	cyto(11),cyto_nucl(10),nucl(7),mito(4),E.R.(3)	LAAERERAKKAKRD (402-415, prob:0.858),KAQKKYLERERERELKRSMKK (424-444, prob:0.78)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL86	RING-type domain-containing protein	Medium	14.5	1	184-207	ILRRKVSKLFRRAKEQNQKVKGRW	nucl(17),pero(7),mito(2)	KKRR (384-387, prob:0.667)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN45	GRIP domain-containing protein	Medium	12	1	15-45	ARGPAAASKSKKKGNKKKKGNKGNTAGDDTN	nucl(15.5),cyto_nucl(12),mito(6),cyto(5.5)	GPAAASKSKKKGNKKKKGNK (17-36, prob:0.992)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPC6	Uncharacterized protein	Medium	10	1	218-239	SGNPGEKQVRIRQRHRRAMSDS	nucl(15),cyto(7),mito(4),cyto_pero(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0I0	Uncharacterized protein	Medium	12	1	270-289	QCGKCGKKKVSYSQAQTRSA	nucl(19),mito_nucl(12.333),cyto_nucl(11.833),mito(4.5)	KEAKKRK (82-88, prob:0.712)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q287	AAA domain-containing protein	Medium	13.9	1	3-30	ASDATGSVRRRRVRRRRHDKAAVSARLV	mito(19),nucl(5),cyto(3)	RRRRVRRRRHDK (11-22, prob:0.912),KDKEKEKEKGKEKGNGKEVGGAP (1309-1331, prob:0.911),LAGRRTASGASARSAGGKGKGRAGAGGKGKGK (1348-1379, prob:0.976)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8P0	Uncharacterized protein	Medium	10.3	1	375-401	KGSTETIRPKKEKKRPTRKQPTVAAGN	nucl(7.5),cyto_nucl(6.5),mito(6),cyto(4.5),plas(4),extr(4)	RPKKEKKRPTRK (382-393, prob:0.935)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAR6	Protein kinase domain-containing protein	Medium	12.9	1	1187-1213	GKPRLTVSSKGRRRRPSSKTLQQVLKC	nucl(18.5),cyto_nucl(11.5),mito(4),cyto(3.5)	SKGRRRRP (1195-1202, prob:0.755)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBF7	Uncharacterized protein (Fragment)	Medium	12.7	1	10-42	VTYYNYRKKGHYKRECRSPKKEWKPAPRKEITA	nucl(18.5),cyto_nucl(10.833),mito(5.5),cyto_mito(4.333)	KKGHYKRECRSPKKEWKPAPRK (17-38, prob:0.8)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBP7	BHLH domain-containing protein	Medium	14.2	1	184-204	EEWHKMRKDNHKEVERRRRET	nucl(23.5),cyto_nucl(14.5)	KRKRAAESASPDSRRAKR (22-39, prob:0.683)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFT9	Uncharacterized protein	Medium	13.2	2	4-26, 266-314	LADGSQRQGRQPRRRNASTNSNM, VEVGYLMWRRRRRRRRGHGDESDEKTPAPARRRWWKRRSKDESDRGLFI	nucl(8),mito(6),plas(6),cyto(3),pero(2)	RRRRRRRRGHGDESDEKTPAPARRRWWKRRSK (274-305, prob:0.984)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGY1	Uncharacterized protein	Medium	10.5	1	16-39	KCQVPGCHKKHTGHTQHNKRKVYS	cyto(9),nucl(7),pero(6),cyto_mito(6)	RRRQRELAAERARVERA (316-332, prob:0.649)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHW7	Uncharacterized protein	Medium	11.2	1	378-408	DSDSDNERPKKQSKKKRKKGKGAQGKTVAFP	nucl(11),cyto_nucl(10.5),cyto(8),extr(5)	RPKKQSKKKRKKGKGAQ (385-401, prob:0.996)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ7	Uncharacterized protein	Medium	13	1	536-561	GPDGRREKGLQPRKRLKKPLFEILNP	nucl(15),mito(5),cyto(5),cyto_mito(5)	GRREKGLQPRKRLKK (539-553, prob:0.864)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKG7	Uncharacterized protein	Medium	11.2	1	5-30	GLAYKLGKKEKGKNKYRSYKEVGQII	nucl(10),mito(7),cyto(7),cyto_mito(7)	KEKG (13-16, prob:0.621)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMB7	Uncharacterized protein	Medium	13.4	1	53-112	DSYHQSSRPRDSHRNRDRDHRNRDHRDRDHRDRDHRDRDHRDRDHRRRERSRPPETGRTR	nucl(20.5),cyto_nucl(13),cyto(4.5)	HRNRDRDHRNRDHRDRDHRDRDHRDRDHRDRDHRRRERSRPPETGRTRPAPR (65-116, prob:0.98)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q015	Uncharacterized protein	Medium	10.6	1	188-212	HPSRADDPAAKRHRRRKRKEKCAIL	cyto(12),cyto_nucl(12),nucl(10),cysk(4)	AAKRHRRRKRKEK (196-208, prob:0.977)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Y9	Uncharacterized protein	Medium	14.6	3	318-339, 1476-1498, 1526-1548	SLNPHRRYKIFRHPRLQYRHSD, IAVDIRTKSRRRVQRQRELEGVR, MATLQNKKGKKRFLLPFTKQYNH	nucl(15.5),cyto_nucl(10),mito(8)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2W9	SPT3-like protein	Medium	11.2	1	282-303	QEAFRRLQQRPKKSRAMLNGTR	nucl(16),cyto(10)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N4	SAP30_Sin3_bdg domain-containing protein	Medium	11.4	1	158-179	LHKVRSQGVKKGRPPRREYIHL	nucl(12),cyto_nucl(11),cyto(6),pero(6)	KKGRPP (167-172, prob:0.635)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB73	MMtag domain-containing protein	Medium	14.2	1	141-253	KDSDRHRDSDRRHRRRHRSRERDHDRHRDRSRSRHRRRDSLDRDEKDSYRRRRSRSPEYGRHREERRHGSRSRSRDRHHRRRDSRSHGRSRSRDRAERSRHHDRRRSRTRYQD	nucl(24),cyto_nucl(14.5)	DRHRDSDRRHRRRHRSRERDHDRHRDRSRSRHRRRDSLDRDEKDSYRRRRSRSPEYGRHREERRHGSRSRSRDRHHRRRDSRSHGRSRSRDRAERSRHHDRRRSR (144-248, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBD1	Enhancer of mRNA-decapping protein 3	Medium	11.3	1	191-214	YGEVTAQKKKRRQRKPGSAKTATQ	cyto(7.5),cyto_nucl(6.5),extr(6),nucl(4.5),plas(3),mito(2),pero(2),E.R.(2)	KKKRRQRKPGS (198-208, prob:0.92),RRGGEGKSAAAGKRSRSRKAH (389-409, prob:0.924)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE93	CRIB domain-containing protein	Medium	11.4	1	310-329	TSLTRKPSVVKKRSSRRVLS	nucl(23.5),cyto_nucl(13.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG75	Uncharacterized protein	Medium	10.2	1	84-106	AAAQTERPRRRRGKRRQGCCIEG	mito(13),nucl(7),cyto_nucl(7),cyto(5)	RPRRRRGKRR (90-99, prob:0.923)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHL3	Uncharacterized protein	Medium	14.1	2	630-678, 830-867	ADAEEEKKKKKQKQKSNSNDEAEKKDEGAEQPKKKRRYKKDEEYGVSRG, GFVPLKKLDGKDRRHRKGKPKGRSFKVGGKKDPLKTFK	cyto(15),cyto_nucl(12.833),nucl(9.5),cyto_mito(8.833)	KKKKKQKQKSNSNDEAEKKDEGAEQPKKKRRYKKD (636-670, prob:0.968),KKLDGKDRRHRKGKPKGRSFKVGGKKDPLKTFKVRRKAR (835-873, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKW8	Non-structural maintenance of chromosomes element 1 homolog	Medium	10	1	321-345	VTSRSGFQRGRGRRRRQTEAAEVAH	cyto(12),nucl(5),pero(5),mito(3)	RR (333-334, prob:0.606)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPC4	Vesicular-fusion protein SEC18	Medium	13.9	2	739-759, 783-827	GAARHHYRVRPPDPRARRPGH, EPPPRVLQLGPRRRRHQDHPDHGRNGPPERRARRVVCRADRHADC	nucl(14.5),cyto_nucl(11.5),cyto(7.5),pero(4)	KGPPPPHPRHHLTAVRHGAARHHYRVRPPDPRARRPGHARAVGRAGRVGRLRRAGRRQPGAEPPPRVLQLGPRRRRHQDHPDHGRNGPPERRARR (722-816, prob:0.996)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPD0	Nucleolar protein 58	Medium	14.1	2	477-514, 571-608	VEMKDAPSKKDKKDKKDKKDKKEKKDKSQKSKESEAPA, QAETPVKSKSSKRKHEPEEETPAKEEKPKKKKKKSSKE	cyto(17.5),cyto_mito(9.833),nucl(8.5),mito_nucl(5.333)	PSKKDKKDKKDKKDKKEKKDKSQKSKES (483-510, prob:0.998),SKSSKRKHEPEEETPAKEEKPKKKKKKSSKE (578-608, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2T5	Uncharacterized protein	Medium	10.7	1	101-124	ASRVLEKTKKRQTHFPQRKFAVKA	nucl(22),cyto_nucl(12.5),mito(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2U3	Uncharacterized protein	Medium	11.4	1	579-598	SSNLSKHKRTHEVRGRFTCA	nucl(24.5),cyto_nucl(14)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3X2	Uncharacterized protein	Medium	11.1	1	27-50	ILKNREGRPSKRADRKHAEEQPYV	cyto(13.5),nucl(10),cyto_mito(8.5)	K (37-37, prob:0.601)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6H2	Uncharacterized protein	Medium	13.7	1	724-745	HYETRVGKRKFNDRMRAEREAD	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	GRRSGRRPGASSKRGR (628-643, prob:0.829)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q868	Uncharacterized protein	Medium	10.4	1	535-556	FLPSRWQGDKKKKKEGGNEGGG	cyto(17),nucl(6),mito(2)	KKKKK (544-548, prob:0.67)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8E1	Ribosomal_L18_c domain-containing protein	Medium	11.8	2	10-37, 270-294	SAYYSRFQTKYKRRRQGKTDYYARKRLI, WKQESLKYKQKKLTNAERKARVQAR	nucl(13),cyto(8),mito(6)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBY3	60S ribosomal protein L2-like protein	Medium	11.3	1	180-201	LKASRAKHKFAVKRNRWPKTRG	nucl(10),mito(10),mito_nucl(10)	KPLLKASRAKHKFAVKRNRWPKT (177-199, prob:0.886)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCI2	Uncharacterized protein	Medium	13.5	1	651-678	MSSDSLRNSRRPKCSKRQHTPNDPGPSG	nucl(22),cyto(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN64	Uncharacterized protein	Medium	10	1	58-82	LSDEESTRTRRRKHQEESEVSKPPQ	nucl(13),mito(6),cyto(4),extr(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1R0	tRNA(His) guanylyltransferase	Medium	11	1	238-263	VQQSKTQTENDKKRRAKARIVVQHLD	nucl(15),cyto(10)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7B6	Uncharacterized protein	Medium	11.7	1	785-809	APQARAQPSRSRQPQQRQHQPPSLP	nucl(12.5),cyto_nucl(8.5),mito(4),cyto(3.5),pero(3),plas(2)	RRGK (925-928, prob:0.62)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9B0	Uncharacterized protein	Medium	10.3	1	95-116	MFLSKRADEKRPENRRRHCGLG	mito(9.5),cyto_mito(9.5),cyto(8.5),nucl(8)	ENKRRMFLSKRADEKRPENRR (90-110, prob:0.752)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBZ8	Uncharacterized protein	Medium	10.8	1	160-188	FVWRYHRSIRIRRRGGHHRRTSKGSRSSA	mito(9),nucl(7),extr(7),cyto(2)	IRIRRRGGHHRRTSKG (168-183, prob:0.865)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL80	AAA domain-containing protein	Medium	14	2	13-43, 1003-1025	SSSPAPSSKRPRPADAPKPPKPPKPRVLGGF, ETDANAGKRIKRKQDAGKAGRVW	mito(22),cyto(2),pero(2),cyto_pero(2)	SKRPRPADAPKPPKPPKPR (20-38, prob:0.933),PGRRKKK (450-456, prob:0.751),IKR (1012-1014, prob:0.62)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM79	Ubiquitin carboxyl-terminal hydrolase	Medium	11	1	375-398	EEEDVERARKRRKRNPTLDNGQGE	cyto(12.5),nucl(11.5),cyto_mito(7.333),cyto_pero(7.333)	ERARKRRKRNPTLDNGQGEEKKESAKKDGKK (380-410, prob:0.956)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD0	Uncharacterized protein	Medium	14.4	2	124-158, 617-640	EQKAGGHQRRKPPKNSTPKKSSKPARATIRSPRKL, RPPDAEKITKRTPKKSRKLGGVLP	mito(15.5),cyto_mito(10),nucl(8)	GGHQRRKPPKNSTPKKSSKPARATIRSPRKL (128-158, prob:0.98),SLREKPRPPDAEKITKRTPKKSRKLGG (611-637, prob:0.962)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1I5	DNA polymerase	Medium	11.9	1	275-296	GLWRDETKRRLKRMGKLKPGSS	nucl(14.5),cyto_nucl(11.5),cyto(7.5),mito(4)	KRRLKRMGKLK (282-292, prob:0.727)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1Z1	Uncharacterized protein	Medium	13.9	1	1008-1037	IDTSRYGWEQKRQYRRRLAKKGLRKPFVER	nucl(14.5),cyto_nucl(10.5),cyto(5.5),mito(3),plas(1),pero(1),cysk(1),vacu(1)	RRRKRTLSSRGERAPGRSSLLSTRRRARS (731-759, prob:0.869),QYRRRLAKKGLRKP (1020-1033, prob:0.854)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6U7	DNA polymerase lambda	Medium	12.4	1	142-166	QSPSASTALRKRKRQPSTKSVPEAA	nucl(17.5),cyto_nucl(13.5),cyto(8.5)	RKKAGAAAKRMP (47-58, prob:0.725)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA59	TAFII28 domain-containing protein	Medium	10.7	1	95-120	VSTAAPLKKKRGRKSKAEKAREQTPS	mito(10),nucl(9),cyto_nucl(8.5),cyto(6)	LKKKRGRKSKAEKAR (101-115, prob:0.975)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC46	Uncharacterized protein (Fragment)	Medium	10	2	31-54, 131-158	DEEHRRFHWMRRHGRKMALRDDRS, KNCVGREISKHQKKKKRMMMGARSRYSR	extr(10),cyto(4),plas(4),E.R.(4),mito(3)	KHQKKKKRM (140-148, prob:0.82)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDK9	Uncharacterized protein	Medium	12.4	1	152-175	ASSGNTPKRPEKRKASPEPDKGTP	nucl(17.5),cyto_nucl(12.5),mito(5),cyto(4.5)	PKRPEKRKASPEPDKGTPAWIKRRI (158-182, prob:0.901)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEM0	Uncharacterized protein	Medium	14.5	2	63-94, 527-556	LPYQPPPPRKAGGRKPKPRRTTGPRKAAKLPP, RGPYGPRKPREGKPRPRRPRDPNKKSNYVP	cyto(9.5),cyto_nucl(9.5),nucl(8.5),pero(6)	PPPRKAGGRKPKPRRTTGPRKAAK (68-91, prob:0.994),GRRRGPYGPRKPREGKPRPRRPRDPNKKSNYVPRR (524-558, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF54	Uncharacterized protein	Medium	12.8	1	80-100	LTAKLERARKHHKRVRSDPNP	nucl(19.5),cyto_nucl(14),cyto(7.5)	ERARKHHKRVR (85-95, prob:0.779)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM88	Uncharacterized protein	Medium	13.3	2	87-107, 300-324	ARQQQPQQHPQQQQQQQQPQQ, IYTPTSPARRHKPPQEQQNQQSQQS	nucl(23),cyto_nucl(13.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPS3	Uncharacterized protein	Medium	14.9	3	55-79, 894-913, 1208-1238	RDHLPADQRKPGKNRRTVRDPTTGK, AHHPRSSRRVRLPVRFRYRS, GSSSSKNPIKQYKDYRTRSRDLHRKHRGLMQ	plas(20),nucl(5.5),cyto_nucl(3.5)	GPRRRKK (926-932, prob:0.731)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZX3	Vacuolar fusion protein MON1	Medium	10.4	1	23-45	SSRSPSRSPSPPPLPPRRKPSSD	nucl(20.5),cyto_nucl(13),cyto(4.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q440	Vps8 domain-containing protein	Medium	12.1	1	1511-1535	WEGREREAARARRRKRELNGKGVGH	nucl(14.5),cyto_nucl(10.5),cyto(5.5),pero(5)	EREAARARRRKREL (1515-1528, prob:0.918)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5W9	Uncharacterized protein	Medium	12.3	1	12-51	SETCSSRSSRKSRSPGAHRRRRFRSRSRSRSRSESRDRDT	nucl(16.5),cyto_nucl(13),cyto(8.5)	SRKSRSPGAHRRRRFRSRSRSRSRS (20-44, prob:0.989)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM54	Uncharacterized protein	Medium	13.4	2	24-53, 84-103	VEADASQDGKKKKKNKKRSAGAKKRGTGFE, IEECIQRYRARRRLNSDREY	nucl(13),cyto_nucl(12),cyto(9),mito(2),pero(2)	GKKKKKNKKRSAGAKKRG (32-49, prob:0.996)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNR7	Uncharacterized protein (Fragment)	Medium	12.6	1	42-68	QQACNRLSQRFRKRRARAKGREPKPTA	nucl(17),cyto_nucl(12),cyto(5),pero(3)	RFRKRRARAKGREPK (51-65, prob:0.954)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2X1	CCHC-type domain-containing protein	Medium	14.9	1	347-366	PSRNRSPSPGRKARRHRGND	nucl(17),cyto(9),mito_nucl(9)	RNRSPSPGRKARRHRG (349-364, prob:0.872),RKK (402-404, prob:0.633)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q664	Uncharacterized protein	Medium	11.1	2	17-44, 654-678	LKNQVKFKGGRWRDRLKAQRNAKQWQGN, EDGKAKAKAKAKQRSKPRDNPLLES	cyto(15),cyto_nucl(10.5),nucl(4),mito(4),pero(3)	KAKAKAKAKQRSKPR (657-671, prob:0.899)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q723	Uncharacterized protein	Medium	14.6	2	7-33, 435-466	SSLFPNRPIRPLPKRRLRERLSPEVAE, EEQRRAQWERMKKGKHKGRKNSKLPAKNSHAG	mito(16),nucl(9),cyto_mito(9)	RFGRPR (210-215, prob:0.625),QRRAQWERMKKGKHKGRKNSKLPAK (437-461, prob:0.987)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC19	Uncharacterized protein	Medium	11.5	2	1-20, 323-349	MFGKKVRRKQQYHLLRIPGE, KEDKQKMMMKERKKKDKRGFSAKWDVT	mito(17),cyto(6),nucl(4)	KQKMMMKERKKKDKRG (326-341, prob:0.915)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEE7	Uncharacterized protein	Medium	10.1	1	44-72	AYRRSFITPSKGKRKRSKKARGSETPSNA	mito(11.5),cyto_mito(9.166),nucl(9),cyto_nucl(8.333),cyto(5.5)	SKGKRKRSKKARG (53-65, prob:0.974)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHJ8	Uncharacterized protein	Medium	10.5	1	577-596	ARFQHTKARVHRRRLRDVER	mito(13.5),cyto_mito(11.5),cyto(8.5),nucl(2),plas(2)	TKARVHRRR (582-590, prob:0.683),RRKVGEALKQDREAKRKRAR (616-635, prob:0.848)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIB7	Condensin complex subunit 1	Medium	11.6	1	201-225	KSSTTVPTRGRGKPKSRKDLGKDGT	nucl(13.5),cyto_nucl(12),cyto(9.5),mito(2)	GRGKPKSRK (210-218, prob:0.743)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLV5	Uncharacterized protein	Medium	12.6	1	192-213	IHPFPPFKKERRPAFNLPQVRT	nucl(19),cyto(6)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZX6	Uncharacterized protein	Medium	11.1	1	288-313	VAPAEAPPRSKKKERPHRGGPNLMDD	mito(12),cyto(6),nucl(3),extr(3),pero(3)	PRSKKKERPHRG (295-306, prob:0.882),PSGRNSPLPPPPKGGPPRGGPPRAGST (329-355, prob:0.888)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5P2	Uncharacterized protein	Medium	14.6	1	22-43	EFFSKLRPSKRPERGGTFRPTT	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(3)	ARRALRRR (102-109, prob:0.676),GRLGRYKGEQGRGIVKGKERGNREAKSK (534-561, prob:0.845)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q732	WD_REPEATS_REGION domain-containing protein	Medium	12.8	1	1462-1482	SGTPRSSTRSRRKSAPADAAK	nucl(12),mito(9),cyto(4)	K (811-811, prob:0.605)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8T2	Uncharacterized protein	Medium	14.9	2	128-155, 174-197	AREAEKRKRDEERERKRREKEEADKLKA, EKEQEKRQRAEERERKRREKEEEE	nucl(18.5),cyto_nucl(13),cyto(6.5)	EPPKKKRLTAEEKAAREAEKRKRDEERERKRREKEEADKLKAQQKAAKAEERAAKAADRAEKEQEKRQRAEERERKRREKEEEELRKA (114-201, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q934	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.9	1	10-58	PPAAKDAASARKRRRRAPAGGAADDCFTCAKRNVKCDRRRPYCSQCLEI	nucl(17),mito(9),cyto_nucl(9)	ASARKRRRRAP (17-27, prob:0.902)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q992	Peptidyl-prolyl cis-trans isomerase	Medium	14.5	2	429-460, 469-499	THGERYKPSYDNRRRDPKRRSLSPRGGRYRDD, GGSRDDREWPRRDRRDHDRDRRDGKDRDRYH	nucl(8),cyto(8),cyto_nucl(8),cysk(8)	AKRRKAAARRGGGGWGGIKELEKR (345-368, prob:0.926),NRRRDPKRRSLSPRGGRYRDDRHDRREDVGGSRDDREWPRRDRRDHDRDRRDGKD (440-494, prob:0.943)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBX0	Fork-head domain-containing protein	Medium	11.5	1	646-669	THTGSPAKRSVKKQRAERSQSTSA	nucl(26.5),cyto_nucl(14)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD70	UDENN domain-containing protein	Medium	12.7	2	82-104, 166-196	RSDAALRRPRKLRSQYPRGSSEN, EDDAERRAKEERRARRRRKRDREKGIIHESD	mito(12),nucl(8.5),cyto_nucl(7),cyto(4.5)	RRAKEERRARRRRKRDREK (171-189, prob:0.995)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFC3	Uncharacterized protein	Medium	11.1	1	292-311	VTPSLPKKGHTRSKHTLNSW	nucl(21.5),cyto_nucl(12),pero(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW2	F-box domain-containing protein	Medium	13.5	1	1190-1219	TSTGRLSRRLPSLRRRRSRAGRSAAKNVAD	nucl(21),cyto_nucl(13.5),cyto(4)	SRRLPSLRRRRSRAGRSAAKNVADAKRRGWSGQSTRSKSTKRGGG (1196-1240, prob:0.982)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q255	tRNA-dihydrouridine synthase 3	Medium	11.9	1	96-122	QEATQTSKKDGKRKKQKGQNKDRDFGT	nucl(14.5),cyto_nucl(11),cyto(6.5),pero(5)	KKDGKRKKQKG (103-113, prob:0.867)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2F0	WD_REPEATS_REGION domain-containing protein	Medium	10.6	2	53-76, 242-267	EEEAKQGKGSKKEQKEKPSKEDDE, GNAEEDSKKKKKKKKSKRANDEYHVD	cyto(16),cyto_mito(11),mito(4),extr(3),nucl(2)	KKKKKKKKSKR (249-259, prob:0.995)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q398	Uncharacterized protein	Medium	12.6	1	407-446	DWLIKRLSDKYKKDKGHWSHDLWKKMKGRDNKGRREKVEL	nucl(8),cyto(7),cyto_mito(7),mito(5),extr(4)	KDKGH (419-423, prob:0.615),SHDLWKKMKGRDNKGRREK (425-443, prob:0.863)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Q0	AMP deaminase	Medium	12.5	1	305-327	GGGAARKSKAKKRKPGQDIGEDF	nucl(17.5),cyto_nucl(12),cyto(5.5),pero(4)	AARKSKAKKRKP (308-319, prob:0.941)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Q6	Methyltransf_11 domain-containing protein	Medium	14.8	1	35-60	EDTRDSFVERRRKRRSVEKIEQWLSP	nucl(17),mito(8)	RK (46-47, prob:0.609)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4T6	Polynucleotide adenylyltransferase	Medium	10.4	1	74-99	NPGGSSSSKPARKRPNQAQRRQMSAQ	nucl(18.5),mito_nucl(11),cyto(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5V1	Uncharacterized protein	Medium	10	1	131-150	MTRPGERVARRRRAKARIGA	mito(10),cyto_nucl(7),nucl(6.5),cyto(6.5),cysk(3)	RVARRRRAKARIG (137-149, prob:0.895)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAF5	Uncharacterized protein	Medium	14.2	2	1147-1169, 1363-1388	DVDMPMPKRKTRRVRDPYAIDLS, ASGISKVFSRRKKPSVSHPRRMPESE	nucl(13.5),mito(10),cyto_nucl(8.5)	K (1374-1374, prob:0.605)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBA5	Uncharacterized protein	Medium	14.9	1	14-41	LKLKGGAGVTKKKKKKDKGKTTDLEKNL	nucl(17.5),cyto_nucl(10),mito(8)	PLKLKGGAGVTKKKKKKDKGK (13-33, prob:0.985),VKRKRLKELAESKRIR (115-130, prob:0.814)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEE3	Uncharacterized protein	Medium	13.9	2	99-121, 701-721	TVGPGMATKRRRRREHMEEDDSS, VATNYKKYTVWRKQPMRLLSE	nucl(18),cysk(5),cyto(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEN7	Uncharacterized protein	Medium	14.6	3	5-24, 86-138, 892-912	QSIYPASPKHRNTTKQNTST, GSDSDYSDKKKKTCRKYSRRATRRTATSNQSCTPQRNVQRQRRQPSNKGSHDV, AQNWLRSKKPARFRPSPVSDA	nucl(15.5),cyto_nucl(9.5),mito(4),cyto(2.5),plas(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH64	Uncharacterized protein	Medium	10.1	1	51-72	GEHQPEDDKKRYRPRTFSYFRL	cyto(11),cyto_nucl(10.5),nucl(8),mito(4),plas(1),pero(1),E.R.(1),golg(1)	KERRTK (1241-1246, prob:0.629)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKI8	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.8	1	36-62	RRQADSCRYTAPRRRRPRPRSDDVAVE	plas(12),nucl(7),mito(3),E.R.(3)	RRRRPR (48-53, prob:0.699)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPD5	Uncharacterized protein	Medium	14.4	1	150-220	AQLAYQAQPRRRRRRRWRRRRMLRKQRQMRRTPRRLYEEEKKKKKKKKKKKKKKKKKKRNGGDRLNDHDGG	nucl(25),cyto_nucl(14)	PRRRRRRRWRRRRMLRKQRQMRRTPRRLYEEEKKKKKKKKKKKKKKKKKKRNG (158-210, prob:1)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD5	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.9	1	14-54	VTNAAGKPYHAKRPHRKSRTGCRNCKARKVKCDEGRPACRM	nucl(9.5),cyto_nucl(8.5),cyto(6.5),plas(5),mito(3)	KRPHRK (25-30, prob:0.649)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q195	Uncharacterized protein	Medium	11.3	1	379-401	GQQGELSKRQAKKQRKEAAQAKA	nucl(11),cyto_nucl(8.5),mito(5),extr(5),cyto(4)	LSKRQAKKQRKEAAQAK (384-400, prob:0.846)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1T7	WD_REPEATS_REGION domain-containing protein	Medium	11.8	1	14-42	REPKDDPALSQKKHRRKSKLQEVNVNGED	nucl(12.5),cyto_nucl(9),cyto(4.5),mito(4),plas(3)	KRKREPKDDPALSQKKHRRKSK (11-32, prob:0.891)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4T3	XPG_I_2 domain-containing protein	Medium	11.9	1	558-589	RSVQEPQNDNKSKKRKRRAPPGGTTKPRSGNP	nucl(13),cyto(8.5),cyto_mito(7),mito(4.5)	KSKKRKRRAPPGGTTKP (568-584, prob:0.97)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9L2	RNB domain-containing protein	Medium	12.3	2	463-487, 507-526	DEVWAQKREKEEKKKRKDITDTRSG, GGIRRRGSLRQRPTQKKNDD	cyto(11.5),cyto_nucl(11.5),nucl(8.5),mito(5)	KREKEEKKKRK (469-479, prob:0.821)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKT6	ECM11 domain-containing protein	Medium	13.6	1	422-445	TVMQRLREARRTKRRLVQQYEEEI	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	LARERERQREREREREREREREKERQ (202-227, prob:0.925)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN89	Required for respiratory growth protein 9, mitochondrial	Medium	11.1	1	225-249	DPETERKRQERWFRRGKRVWTQWAA	mito(21.5),cyto_mito(12),nucl(4)	KKGKRQSSKPETSEEQSGRPKPKREKEPWMIQKEALKKKFPEGWNPRKR (130-178, prob:0.945),ERKRQERWFRRGKRVWTQWAALGKKPPRKWRAEGIVRDPIWNRPRGPNHKDKAARAEAQRRLA (229-291, prob:0.972)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNL3	Uncharacterized protein	Medium	10	2	337-359, 472-492	GRPAGLRQRCRQQQQRQRRPGAL, AILPRRTAIRREGRREHKGEP	extr(14),mito(10),cyto(3)	ARRAAALGRGRGRGRGRGGRGRG (180-202, prob:0.977)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2C4	EF-hand domain-containing protein	Medium	10	2	455-474, 1531-1553	FQPQRQKSVRQPPKEQQFVP, YDDKKNKWKMWCHKRAIEKRGKW	plas(25)	TRKSGGRKS (2197-2205, prob:0.68)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3S5	Small nuclear ribonucleoprotein Sm D1	Medium	10.7	1	82-103	DDAPKPKNKARKEAERGRGRGR	nucl(9.5),cyto_nucl(9.5),cyto(8.5),mito(8)	PKPKNKARKEAERGRGRGRGRGMGRGRGRGRGRG (85-118, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7D6	Uncharacterized protein	Medium	10	1	114-143	AYYSGRYGSCRRRRRRRRRRCQTTTATPLV	mito(10),nucl(6),cyto_mito(6),extr(4),cyto_nucl(4)	RRRRRRRRRR (124-133, prob:0.956)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q979	Uncharacterized protein	Medium	11.9	1	324-346	RASLGGKSKPRGKRRFHELEGSD	nucl(14.5),cyto_nucl(10.5),mito(7),cyto(5.5)	KSKPRGKRR (330-338, prob:0.775)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9R8	Uncharacterized protein	Medium	13.6	2	100-125, 1305-1324	AHLVRLSKYQERKRANTRIRLQRSLV, AIQRRARKAQAKEKRKSAKS	nucl(11.5),cyto_nucl(8),mito(6),cyto(3.5),plas(3)	QRRARKAQAKEKRKSAKSS (1307-1325, prob:0.961)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC8	Uncharacterized protein	Medium	11	2	17-44, 49-73	KTRSVCSQAQAQHNRRRRPRDGECLNVC, EHLQLKCRDCHRKWRKAQAANFESR	mito(15),nucl(10)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC90	Uncharacterized protein	Medium	10.2	1	91-110	HAKRLCTDDRERRLRRFYRR	nucl(20),cyto_nucl(13.5),cyto(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV9	Ribonuclease H2 subunit B	Medium	13.9	1	431-450	QDARAEKRRKQEAEEKARKA	nucl(22.5),cyto_nucl(13),cyto(2.5)	AEKRRKQEAEEKARKA (435-450, prob:0.787)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF39	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.5	2	225-248, 853-877	ATPPRKRSKVSRACDECRRKKIKC, QEPQQSEPKQQQQQQQRQRQSPEEQ	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(3),plas(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF80	Uncharacterized protein	Medium	10.4	1	10-31	QGEVRLSRQRSERNRKKGSGQL	cyto_nucl(9),nucl(8),cyto(8),mito(5),pero(4)	RKEGGRARVRG (191-201, prob:0.688)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJT1	Uncharacterized protein	Medium	12.4	1	345-374	TLVARLPRELERRRRRRRRQGSRSGLDQHP	cyto(14),nucl(11)	RELERRRRRRRRQGSRS (352-368, prob:0.983)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM33	Protein kinase domain-containing protein	Medium	12.4	1	208-234	LWQGIKAPKKEKNDRIKQKKQEITIED	cyto(14),nucl(11)	PKKEKNDRI (215-223, prob:0.659)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q215	FAM192A_Fyv6_N domain-containing protein	Medium	11.5	1	56-77	QLEEDRRRRREQQQQQQQSSQE	nucl(12.5),cyto_nucl(11),cyto(6.5),mito(6)	GRKRRKGDAGKEKKRLRGVGV (189-209, prob:0.979)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4M1	C2H2-type domain-containing protein	Medium	12.1	2	851-876, 946-965	EAEKPHPCTQCKKRFKSPTEAERHLN, DCDRNKKFYRADNFRQHLKN	nucl(18.5),cyto_nucl(12.5),cyto(5.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4W8	Uncharacterized protein	Medium	12.8	2	14-38, 154-176	VRTSASGIRPRPRRRMPSRPLAPAP, VRSSTLVLRGKKRSRRWLVSSWA	mito(23),nucl(2)	IRPRPRRRMPSRPLAP (21-36, prob:0.871),GTKRNHPKRAA (52-62, prob:0.726)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q502	Uncharacterized protein	Medium	13.1	1	688-715	SPARHRPSPSATRRPSRRHRPSGGEIHS	nucl(18.5),cyto_nucl(12.5),cyto(5.5)	PARHRPSPSATRRPSRRHRP (689-708, prob:0.858)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAH2	Uncharacterized protein	Medium	12.2	2	1-21, 208-229	MPRTRHHRSSRRVPPLKDSDF, WNSFVRRRAWIRKRVKKNEGYS	mito(14),nucl(7),cyto_nucl(6.5),cyto(4)	RRAWIRKRVKK (214-224, prob:0.732)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBD8	Histone-lysine N-methyltransferase, H3 lysine-79 specific	Medium	13.2	2	1-23, 118-144	MSILNKKSKFKVKTEVRKVQQAV, DDWRERLDPSKRRKRAHTEDPGRRLRH	mito(17),nucl(8)	SKRRKRAHTEDPGRRLRHP (127-145, prob:0.875)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFM9	Uncharacterized protein	Medium	13.5	2	24-46, 274-295	HKTQQTKAGKRMPRRAQTQHEYF, SKPGDPRRCGRHYVRKNTVQLR	nucl(12.5),cyto_nucl(11),cyto(8.5),pero(4)	RRPP (93-96, prob:0.628)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFQ5	Uncharacterized protein	Medium	11.8	2	8-47, 77-102	EGGPAKGTRSSRRRQRTSEPSSQQQPKAKRQRVPPAETSS, VAPPRKELSVRSKKPKPGERSTKGDG	mito(10),cyto_nucl(6),nucl(5.5),cyto(5.5),plas(4)	SVRSKKPKPGE (85-95, prob:0.784)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLT4	Transcriptional adapter 2	Medium	11.6	1	151-172	REEFQARKKRRIEERREAAKNA	nucl(12),mito(9.5),cyto_mito(7.5),cyto(4.5)	RKKRRIEERREAAK (157-170, prob:0.851)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q110	Uncharacterized protein	Medium	10.8	2	145-167, 205-231	DEFSKSKKQRRLALKRQRQQEAR, VDKREELRKAMRKERRAKIKESNYLKA	mito(24),nucl(2)	LRKAMRKERRAKIK (211-224, prob:0.878)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2C8	Ribosomal_L2_C domain-containing protein	Medium	14	2	63-82, 345-382	KMRTYKPRTPGLRHLKRPIN, WGQPAKGGFKTRKKSNVNKWVVTPRARNMGKRRNKNTA	mito(23),cyto(3)	KR (78-79, prob:0.603),KGRPFLPLTFPKKGHGKGGRNNSGKITVRHRGGGHKRRIR (87-126, prob:0.96),GGRGKSKGNRHPVSPWGQPAKGGFKTRKKSNVNKWVVTPRARNMGKRRNK (330-379, prob:0.936)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDX6	Uncharacterized protein	Medium	14.4	2	278-300, 1204-1230	ALEKRIPKPNPKPPQTHRPRSSS, PSPQLPQPPPQPQPKPPPPPRSQPAGA	nucl(16.5),cyto_nucl(11.5),cyto(5.5),extr(2),pero(2)	KPPPPPRSQPAGAGVGNAKKAVAAAGSSSPRKRTRSEVAAAAAAASRSLRRGVRSSSRKK (1218-1277, prob:0.905)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKF8	Uncharacterized protein	Medium	10	2	434-458, 512-536	GGGSAQGNNKKRKKPNRVAFRAFGG, QDIPVELRPRDPRRKWRVVYSGSDK	plas(12),cyto(4),mito(3),extr(3),E.R.(3)	KKRKKPNR (443-450, prob:0.826)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q231	UBD domain-containing protein	Medium	10.4	1	43-68	VDEPLPSGSRHRRRHSHQPLDQHINK	nucl(14),cyto(7),mito(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2S8	Uncharacterized protein	Medium	11.9	2	927-949, 1014-1034	GGAFSFFRRKKPPQKQEWEVYED, SGPSPPPKTAPRQSRRESKSV	plas(15),nucl(5),cyto(4),E.R.(1),golg(1),vacu(1)	RRKKP (934-938, prob:0.688)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6J3	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.3	2	48-74, 849-871	AHTLTACCRCRQRKTRCDPALPRCLPC, TPPPPPQSHSRHQPQQRPPPSHA	nucl(19),mito(4),cyto(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAZ5	Enhancer of polycomb-like protein	Medium	10.6	1	218-240	DPYVCFRRREVRQTRKTRARDVQ	nucl(14),mito(11)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE20	tRNA-dihydrouridine synthase 3	Medium	13.1	1	349-368	GPEARPKKRRSEVGKENPAL	mito(17.5),cyto_mito(11.5),cyto(4.5),nucl(4)	KKR (355-357, prob:0.629),KKERKR (490-495, prob:0.672),KRR (509-511, prob:0.619)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE89	Uncharacterized protein	Medium	11.5	1	126-151	IPCADRDRDRQRRTTKQQARLRRGST	nucl(17),cyto(5),mito(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPF5	Uncharacterized protein	Medium	13.5	2	1-20, 80-111	MASRQLRKIRKQQELLSLQN, VEEAEPAKKTKKKQKKKKKKGKQAGQPAPAQD	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(5)	AKKTKKKQKKKKKKGKQ (86-102, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZS6	Uncharacterized protein	Medium	11.3	1	8-27	RGSHASSKPKHISRLRKEML	nucl(23),cyto_nucl(13.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZX9	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.4	1	88-109	TSVACGHCRRRKIRCVPSQNDV	nucl(26),cyto_nucl(14.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5M7	Uncharacterized protein	Medium	10	1	74-98	LSQVVNGKKKEKKIRFPLTNRSHAQ	plas(14),extr(5),E.R.(4),mito(3)	KKEK (82-85, prob:0.628),RKDGREAKSRKGKRGDGRKGIGEVVEKKEKEKK (281-313, prob:0.991)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N7	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.3	1	69-97	VECRVVPPQPPRRRKKKPHERDLIERLRK	nucl(22),cyto_nucl(14.5),cyto(5)	PPRRRKKKPHER (78-89, prob:0.951)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7R2	Telo_bind domain-containing protein	Medium	10.2	1	214-237	DGGVKGRGRKRARFGRNSNTWRYS	cyto(14.5),cyto_nucl(12.333),nucl(9),mito_nucl(5.833)	KGRGRKRAR (218-226, prob:0.782)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJG5	Cytochrome c oxidase assembly protein COX20, mitochondrial	Medium	12.3	2	127-146, 151-172	QYEYCQFRRHQEREKVKRVV, AKQAREKKEKEEQERREREKAL	mito(14),nucl(7.5),cyto_nucl(6.5),cyto(4.5)	KQAREKKEKEEQERREREKALAKEREEAEKRRRWWR (152-187, prob:0.964)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNG0	Uncharacterized protein	Medium	10	2	46-66, 145-166	QLRFEKKYKRRLKLATARPRW, VLQFLRRLYRRREKAHHEEPAF	mito(16),plas(6),extr(2),pero(2)	YKRRLK (53-58, prob:0.657)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2A9	TRP_N domain-containing protein	Medium	10	2	729-748, 984-1012	TPDPYYRPPRQRRQTMETSS, DLRVPEVPRKSSKRNSWTRSQSRESHPKQ	plas(21),E.R.(4)	KKRKDKGK (854-861, prob:0.729)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5G2	Uncharacterized protein	Medium	12.7	1	7-33	VAKGSSSKAKSKDKRKEKSVKKESSSE	nucl(16.5),cyto_nucl(10.5),mito(8)	SSSKAKSKDKRKEKSVKK (11-28, prob:0.945)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9M9	TP6A_N domain-containing protein	Medium	13.8	1	353-375	ISDSRREKPMKRARHSKEQESSE	nucl(15),mito(7),cyto(4)	K (363-363, prob:0.6)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA61	Uncharacterized protein	Medium	12	2	65-86, 293-345	GAYKLKSKKTIPKKMGAKKTGD, TDQPESRKAKFRLRRRKRVVHFKGIKKRKMAKAARRREYRKMVREKRAARMAQ	mito(24.5),cyto_mito(13.5)	LKSKKTIPKKMGAK (69-82, prob:0.765),RKAKFRLRRRKRVVHFKGIKKRKMAKAARRREYRKMVREKRAARMAQR (299-346, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAP5	Branchpoint-bridging protein	Medium	13.1	1	51-78	RSPERSEHDGPRRRKKRNRWGEATENKA	nucl(20.5),cyto_nucl(14.5),cyto(5.5)	AKRGRSPERSEHDGPRRRKKRNR (47-69, prob:0.982)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE82	Uncharacterized protein (Fragment)	Medium	14.5	1	592-613	AYKCHTHPKIKDAPKRKREGGG	nucl(25.5),cyto_nucl(14)	IKDAPKRKR (601-609, prob:0.754)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV3	Protein kinase domain-containing protein	Medium	10.2	1	28-48	AGPWKIYPAKNKKTGKECSVF	nucl(15),cyto_mito(5),mito(4.5),cyto(4.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHC1	Uncharacterized protein	Medium	12.2	2	176-197, 860-882	ASPPPRSKPVVHPKPKNLHGNA, VCETCNKPGRTRKAKFARLPDRL	nucl(21),cyto_nucl(14),cyto(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ03	Kinesin motor domain-containing protein	Medium	10	1	648-669	GKSPLRGKGGKKKGSRSRAFEH	mito(15.5),cyto_mito(12.333),cyto(8),cyto_nucl(6.333)	GGRRKKERK (617-625, prob:0.789),SPLRGKGGKKKGSRSR (650-665, prob:0.938)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKP1	Ribosome biogenesis protein RLP24	Medium	14.2	1	26-64	GKSFRFCRSKCHKNFKMKRNPRKLKWTKAYRKNAGKEMV	nucl(17),cyto_nucl(14),cyto(9)	FKMKRNPRKLKWTKAYRK (40-57, prob:0.869),RARRERMFYKKRMAGKRAREVAAARK (100-125, prob:0.916)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP78	HMG box domain-containing protein (Fragment)	Medium	11.5	1	46-72	LAEEEKQRHQRQHPDYRYQPRRGNKVG	nucl(17),mito(7),cyto(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q276	PX domain-containing protein	Medium	13.5	2	789-810, 860-886	IAWQEARKKWHHDKTRQKMAAE, MDPIDAERKRRARRQARLRRNAGEPEK	nucl(13),cyto_nucl(13),cyto(11)	RKRRARRQARLRRNA (867-881, prob:0.934)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2J8	Peptidase A1 domain-containing protein	Medium	12.4	2	495-520, 539-567	VLWFCLSRKRKERRKEKQKEAPVQEE, QSPIKRMLTKIIRKKRSRRPVSQQTNETN	plas(12),extr(12),nucl(1),cyto(1),cyto_nucl(1),golg(1)	RKRKERRKEKQK (502-513, prob:0.928),KIIRKKRSRR (548-557, prob:0.826)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q306	SEC7 domain-containing protein	Medium	13.3	1	1344-1369	EQQNDRKQGRKSGRPGKPEKPRWVVL	cyto_nucl(13),nucl(12.5),cyto(12.5)	RERRRRKK (670-677, prob:0.815),KQGRKSGRPGKPEKP (1350-1364, prob:0.873)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4D7	Uncharacterized protein	Medium	12.5	2	357-384, 392-418	RVEKQQALKRAKEKREEKRREEEAKRAA, LIGAIKKGKAKENQKKGAKKGKAAGNN	cyto(12.5),cyto_nucl(7.5),mito(7),plas(2),pero(2),nucl(1.5)	LKRAKEKREEKRREEEAKR (364-382, prob:0.941),AIKKGKAKENQKKGAKKGKAAGNNAK (395-420, prob:0.99)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7I4	Uncharacterized protein	Medium	10.6	1	16-37	LEAASKVPAKRRQTNIKSTVEK	nucl(14),cyto(9),pero(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDE5	Uncharacterized protein	Medium	12	2	387-411, 537-556	PTAVGLRPWWRRRKGDKKRSVEDGP, FAAAVLRNRRRKNSVRGEEE	plas(21),E.R.(2),vacu(2)	RRAR (277-280, prob:0.624),WRRRKGDKKR (396-405, prob:0.862)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDZ5	Uncharacterized protein	Medium	14.8	2	3-22, 35-60	QMNGGSRSRQRIRKPAPALD, RILNVLAQRRYRQRKREARLAARAES	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	RKR (48-50, prob:0.625)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI11	Protein transport protein SEC24	Medium	12	1	38-60	ASTHHAPEHGKKKKRTYAAGAFE	nucl(15),cyto_nucl(11.5),cyto(6),pero(5)	KKKK (48-51, prob:0.658)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMF6	F-box domain-containing protein	Medium	12.3	1	198-222	QLRSPRVDWKRQYKIRHNWARGKCV	nucl(16),cyto_nucl(13),cyto(8)	RRRRR (241-245, prob:0.674)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0C6	Uncharacterized protein	Medium	11.1	1	169-189	LELQKRKQKLIAENKKRRDDL	nucl(22.5),cyto_nucl(12.5),mito(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0M0	Pre-rRNA-processing protein IPI1	Medium	13.6	1	1-36	MGSSNKKKKEKKKDFQKPKLKVGKPKPKASNFTDTS	nucl(20.5),mito_nucl(11),cyto(5)	KKKKEKKKDFQKPKLKVGKPKPK (6-28, prob:0.994)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1A5	Rif1_N domain-containing protein	Medium	12.5	2	59-79, 1510-1537	DATTSTSRRARKKVGFSAQAE, MTSSQPRARVGRPKRKRATSKAQETGAK	nucl(8.5),cyto_nucl(8.5),cyto(7.5),mito(6),plas(2),extr(2)	RARVGRPKRKRATSKAQETGAK (1516-1537, prob:0.946)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2W0	Nuclear protein localization protein 4	Medium	11.2	1	143-168	DRLDKKDGKIPRKRDKMCRHGPKGMC	nucl(12),cyto_nucl(12),cyto(10),mito(2),pero(2)	GKIPRKR (150-156, prob:0.668)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Z7	DNA polymerase delta subunit 3	Medium	11.3	1	360-385	AVSANGRRRGKRRVMRKKQIMDDQGY	nucl(15.5),cyto_nucl(13.333),mito_nucl(9.666),cyto(9)	GRRRGKRRVMRKK (365-377, prob:0.926)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3N5	Uncharacterized protein	Medium	11.1	1	35-56	QIPSAPRPRLKLRRRVVSQLSA	nucl(23),cyto_nucl(14.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3V3	Uncharacterized protein	Medium	10.9	1	702-726	GVDAGGKKKDKDKEKKKRNIFGLKK	cyto_nucl(11),nucl(10.5),cyto(10.5),pero(4)	GGKKKDKDKEKKKRNIFGLKK (706-726, prob:0.987)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q644	Uncharacterized protein	Medium	10.4	1	245-273	ADAPPAPPAKKRGRPKKQATKPAAPVGRT	cyto(14),cyto_nucl(13.333),nucl(10.5),mito_nucl(6.666)	APPAKKRGRPKKQATKPAAPVGRTARKT (250-277, prob:0.99)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Y8	Uncharacterized protein	Medium	11.7	2	2-31, 61-81	PGGKERAEERRENKRRPKEVQMRRTKEDPR, EAHRYRCRCRRTRAAPPHQAK	plas(14),nucl(5),cyto(5),cyto_nucl(5)	KERAEERRENKRRPKEVQMRRTKED (5-29, prob:0.921)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8E9	SAE2 domain-containing protein	Medium	13.2	1	605-627	QDLADRYGRHRHRFARRPSPPGY	nucl(21.5),cyto_nucl(14),cyto(5.5)	RKRK (249-252, prob:0.638)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q933	Nucleolar protein 16	Medium	14.9	1	1-33	MGRELQKRKRRSSRPKIKMPNRRKKALNPLGND	nucl(20),mito(3),cyto(3),cyto_mito(3)	KRKRRSSRPKIKMPNRRKKA (7-26, prob:0.992)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCZ2	Uncharacterized protein	Medium	12	1	350-369	QPAPKPRKEVAPPRKKLARV	nucl(15.5),cyto_nucl(13),cyto(7.5),pero(3)	PKPRKEVAPPRKKLAR (353-368, prob:0.838)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE87	Iwr1 domain-containing protein	Medium	10.9	1	68-93	QTSRAGDENRRPKRPRQQGEPPVKDD	nucl(17),mito(4),cyto(4),cyto_mito(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEA2	Uncharacterized protein	Medium	13	1	22-61	PQSPTPSSSSQRHKKRRSSPSSTGQRRDKRRREVKAVIDG	nucl(17.5),cyto_nucl(10.5),mito(7)	QRHKKRRSSPSSTGQRRDKRRRE (32-54, prob:0.935)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEJ3	W2 domain-containing protein	Medium	10.7	1	139-165	GFMLKHVPKKTKKDKAERRAARKAKQN	nucl(9.5),cyto(9),mito_nucl(9),mito(7.5)	HVPKKTKKDKAERRAARKAKQ (144-164, prob:0.98)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFY6	Uncharacterized protein	Medium	11.4	1	71-96	DLTCPVPRQRTARRRRRPTPDEYPDS	nucl(11.5),cyto_nucl(7.5),mito(6),extr(6),cyto(2.5)	RRRR (83-86, prob:0.636)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHG8	Uncharacterized protein	Medium	13.5	2	2-26, 298-326	PQDPNLYGQRPPKRQKKEMAISGSV, RTEALRREREEKARKRKQEIEERRKEILE	nucl(14.5),mito_nucl(11.833),mito(8),cyto_mito(6.833)	EALRREREEKARKRKQEIEERRKEILERKTKK (300-331, prob:0.981)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHX6	DNA polymerase kappa	Medium	11.6	1	589-615	RGMPGVQKAKGKKRGRPLALADPRQKK	nucl(14.5),cyto_nucl(13),cyto(8.5),mito(2),pero(2)	KAKGKKRGRPL (596-606, prob:0.906)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ1	FHA domain-containing protein	Medium	13.7	1	36-106	DESGKRVDRSRSRERDHRRRSRTPESRDRRSRSRDRERRRERDRDRHRDSRRQRSEERRDRRNREHDDDWK	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	ESGKRVDRSRSRERDHRRRSRTPESRDRRSRSRDRERRRERDRDRHRDSRRQRSEERRDRRNREHDDDWKERRSGRSPDNRSRRLPA (37-123, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKB9	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.6	2	152-178, 182-213	EEALEHSKQKRPRGRPRKHPFVPNVVT, ITKGRSKTGCLTCRKRKKKCDEAKPRCMNCEK	nucl(12.5),cyto_nucl(10),cyto(6.5),mito(6)	KQKRPRGRPRKH (159-170, prob:0.922)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQG9	Uncharacterized protein	Medium	14.3	1	245-265	HDPRRQFRVARPKRAPRRLTT	nucl(25),cyto_nucl(14.5)	RVARPKRAPRR (252-262, prob:0.766)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2D3	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.9	1	38-67	SSVPKPKRLACMICRKRKLKCDGIKPSCST	nucl(24),cyto(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5G3	Uncharacterized protein	Medium	10	2	135-154, 192-211	GACVWRRRYLRKKDRAYALN, SAAVYGEKPKKKKWTLKKRT	extr(21),plas(3),cyto(2)	KPKKKKWTLKKRT (199-211, prob:0.934)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAP8	Uncharacterized protein	Medium	12.4	1	268-287	EEAKRRMLEKQEKKKQELTN	nucl(10.5),cyto_nucl(10.333),cyto(9),cyto_mito(7.833),mito(5.5)	KKRKR (114-118, prob:0.705),DRKKLEAMRGKKAK (311-324, prob:0.754)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFZ6	Uncharacterized protein	Medium	10.5	2	188-211, 238-259	TFDSREKLKRHARWHTKNYQCPYD, ERCPRCDKAFTRKYNMQRHYRA	extr(10),nucl(9),cyto(3),mito(2),pero(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG52	CUE domain-containing protein	Medium	13.7	2	301-320, 670-702	GGLTKPKRLIKRKIDKGKGI, SDLARRRKEANKGSRANHNRRDQRARKMARAGF	extr(13),cyto(6),nucl(5),mito(3),cyto_pero(3)	KKPGGGLTKPKRLIKRKIDKGK (297-318, prob:0.939),GGRGRGRGRGGRGGSRGGGAAASPGPDSDLARRRKEANKGSRANHNRRDQRARKMARA (643-700, prob:0.978)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHV2	J domain-containing protein	Medium	14.3	2	232-254, 470-505	SAHEGKRKDKKHKSGLTKEQREQ, VAEAAMKKEKESKKKGKDKKDEKKEKGDRPGSKAWE	cyto(15.5),cyto_nucl(12.5),nucl(8.5)	KRKDKKHKS (237-245, prob:0.804),KKEKESKKKGKDKKDEKKEKGDRPGS (476-501, prob:0.995)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI70	Uncharacterized protein	Medium	13.1	2	41-66, 736-762	ATRTVATDRPARKRRKVDYRGADGEE, TRSDTHDTFKCKRCRPDGKQHIKAQAM	nucl(11.5),cyto_nucl(10.5),cyto(8.5),pero(7)	RKR (52-54, prob:0.621)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKS5	CULLIN_2 domain-containing protein	Medium	10.2	1	673-694	SAIVRIMKARKRMKHQQLVSET	nucl(18.5),mito_nucl(11),cyto(6)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E6	BHLH domain-containing protein	Medium	14.3	1	274-293	TQEARRKRRRESHNLVERRR	nucl(25),cyto_nucl(14.5)	RRKRRRESH (278-286, prob:0.826)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q578	Spindle pole body component	Medium	11.4	1	777-815	ANYNLSYHRHRHRHRRRSQSQSRSRSESRSRTRRDHARV	nucl(12.5),cyto_nucl(12),cyto(10.5),pero(2)	RHRHRHRRRSQSQSRSRSESRSRTRR (785-810, prob:0.864)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q674	RNA_ligase domain-containing protein	Medium	10.2	1	575-601	GNGNNSNGNNNKKRKKNRRADAASALA	cyto_nucl(10.833),cyto(10.5),nucl(9),cyto_mito(7.666),mito(3.5)	KKRKKNRR (586-593, prob:0.882)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9E5	SNRNP27 domain-containing protein	Medium	11.5	2	27-46, 201-223	RGEFDRPDRDRQQRDRDGRS, VGAARKEKPTKYRQYMNRIGGFN	nucl(18.5),cyto_nucl(12.833),cyto(6),cyto_pero(3.833)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBM8	Uncharacterized protein	Medium	10.2	2	1-29, 41-79	MIGPEANAPKQRRRQQQLRSRQAGKQQPQ, AATQEPKKRAASQRQRRVTYQRPEQQQQKEQRQARPQGT	nucl(9),mito(6),cyto(5),plas(4),cyto_pero(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHF6	mRNA cap guanine-N7 methyltransferase	Medium	11.2	1	10-57	PQPFDAKKLAPAKKRQRSQSPNRSGSAGTSGEPPRKLKRPGQRARITE	cyto(12.5),cyto_nucl(12.5),nucl(11.5)	KKLAPAKKRQRSQSPNRSGSAGTSGEPPRKLKRPGQRAR (16-54, prob:0.922)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHF8	WD_REPEATS_REGION domain-containing protein	Medium	14	1	166-190	APAAQKDAGKRRKPKNNMTKSNSSF	nucl(15),cyto(7),mito(3)	GKRRKPK (174-180, prob:0.733)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL93	SUN domain-containing protein	Medium	14.5	1	193-222	DRNGTQPERRSPRKPQPRDVRKRARDDEDE	nucl(8.5),cyto_nucl(8.5),cyto(7.5),extr(3),mito(2),plas(2),pero(2)	RRRSKDQARAARAARAT (128-144, prob:0.736),RRSPRKPQPRDVRKRARDDEDEARAEKERKERDA (201-234, prob:0.919),LKRPPRRPGGTTPAPRHERR (408-427, prob:0.856)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0S2	ATP pyrophosphate-lyase	Medium	13.5	1	429-450	TSPGHHHKRRFLGRLRGKRDKD	nucl(22.5),cyto_nucl(14),cyto(4.5)	HKRRFLGRLRGKR (435-447, prob:0.751)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6A4	DNA replication licensing factor MCM7	Medium	10.4	2	58-86, 646-666	DDDAQQERRRQRVQKQQPRHKYREMLQQL, MVKTYVRLRNNQRRAEKRAAA	nucl(12.5),cyto_nucl(12.5),cyto(11.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6C6	Uncharacterized protein	Medium	10.5	1	313-337	ADEPRARARARRRSRSRANENHADT	cyto_nucl(11.5),cyto(10.5),nucl(9.5),mito(3),extr(3)	RGERRLDDRPGPEADEPRARARARRRSRSR (300-329, prob:0.947)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBE5	Uncharacterized protein	Medium	11.4	1	76-99	SSLETPPTPPRRRRVQPTRRSLEP	nucl(23.5),cyto_nucl(13.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKM1	N-alpha-acetyltransferase 40	Medium	10.4	1	80-103	DYEKSTFKWQPKKKLKEMKSPGLR	nucl(18.5),mito_nucl(11),cyto(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPM6	tRNA(Ile)-2-lysyl-cytidine synthase (Fragment)	Medium	13.6	2	433-458, 682-707	NNAGGREKEKQRRPRRWLLARAPHPS, LSKLGGRRIGRREMRHRLRCLYRWVR	cyto(11.5),cyto_nucl(9),nucl(5.5),mito(5),cysk(3)	REKEKQRRPRRWL (438-450, prob:0.837),LGGRRIGRREMRHRLRCLYRWVRLGRAKEAPRRRRMA (685-721, prob:0.924)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZK6	Uncharacterized protein	Medium	12.8	1	173-192	GEFAEPKKARKKPSKLDLSA	nucl(16.5),cyto_nucl(10),mito(8)	KKARKKPS (179-186, prob:0.789)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q035	Uncharacterized protein	Medium	10.4	2	30-55, 455-475	DEKVPYDVRRPPYRRRRWQLGMAMFI, LSSPRGNFRRRRKSTGFPGFT	plas(20),mito(2),extr(2),nucl(1),E.R.(1),vacu(1),cyto_mito(1)	RRRRK (463-467, prob:0.655)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0H6	Uncharacterized protein (Fragment)	Medium	13.7	1	27-48	AQQLPSKSPRKRKAEAPPENNE	nucl(21.5),cyto_nucl(13),cyto(3.5)	PRKRK (35-39, prob:0.694)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q413	Uncharacterized protein	Medium	11	1	31-52	PTPQPGEKGRAKKVRKPHAIDD	cyto_nucl(14.5),cyto(13),nucl(12)	KGRAKKVRK (38-46, prob:0.75)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4U6	Uncharacterized protein	Medium	14.3	2	260-279, 691-711	IPPTIPPKTRRSKTVKPCTA, ADEFRPNRHTWRKQYHEPNDA	nucl(19),cyto(5),mito(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5F8	J domain-containing protein	Medium	14	2	58-103, 420-439	EEINKAYKKKSRQLHPDKVRQQLTAERAKAQKEKNKQNKGKPGVHV, KSSGTQKPGGKASKRKNKRK	extr(15),E.R.(4),mito(2),cyto(1.5),cyto_nucl(1.5),plas(1),pero(1),golg(1),vacu(1)	KKSR (66-69, prob:0.632),AERAKAQKEKNKQNKGKPG (82-100, prob:0.847),RKMRRMQERDAKKEAQGAGRKARRGRPSPAASG (250-282, prob:0.979),KPGGKASKRKNKRK (426-439, prob:0.986)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6V9	Uncharacterized protein	Medium	14.4	2	230-254, 275-303	TETPPNPRDRDTRRRHRRSSSGGGG, SVPQPCCSSRRPRRYRYHHYHHRLRVLFF	nucl(7.5),cyto_nucl(7.5),cyto(6.5),mito(5),extr(5)	RRRHRRSS (242-249, prob:0.74),LRGRRRAENRGGSDAR (315-330, prob:0.763)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA21	CYCLIN domain-containing protein	Medium	10.6	2	338-358, 398-418	QITPLRKKLNKCRDPERWNLI, EPLAASRDNKRRKVQGNGTGL	nucl(14),cyto_nucl(12.5),cyto(9),pero(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEA1	Uncharacterized protein	Medium	10	2	205-230, 471-491	ANVDPAKKPPTRRKRKIPRSGTPAML, ASPAKTTLKKKIEQRNAKAGV	plas(21),E.R.(3),vacu(2)	AKKPPTRRKRKIPR (210-223, prob:0.955)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHU6	Uncharacterized protein	Medium	10	1	7-29	DWSGNAKRRDGPKQAPKQVVRNA	nucl(13),mito(7),cyto(4),pero(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKA2	USP domain-containing protein	Medium	11.3	1	839-863	AETQSSLFKRRKRKWDIKTRLSEMV	nucl(11),mito(11),mito_nucl(11)	KRRKRKW (847-853, prob:0.761)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL38	TPR_REGION domain-containing protein	Medium	11.8	1	121-144	AEERRRAKGEKKRVKKAAEKPVSI	nucl(14.5),cyto_nucl(13),cyto(10.5)	RRRAKGEKKRVKKAAEK (124-140, prob:0.979)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPI0	Uncharacterized protein	Medium	12.2	1	34-72	AADNAHRTPKKRRKVNHACLYCRRSERPCTRCIKRNIGH	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(2),pero(2)	PKKRRK (42-47, prob:0.713)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0N9	ENDO3c domain-containing protein	Medium	11.5	2	50-74, 504-523	SQVTKGTTKSKRGGKKQPQRVKGGW, GQVCFKCRKATKPGTRDWNE	mito(13),cyto(8),cyto_nucl(7.5),nucl(5)	KSKRGGKKQPQR (58-69, prob:0.793)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M2	Protection of telomeres protein 1	Medium	12.6	2	347-372, 388-410	LKEAIRRCRDYHKKKRQQIKAIKAAE, DLPPNSKERRKQKRTAKEQSESE	nucl(11),cyto_nucl(10.333),cyto(8.5),mito_nucl(8.333),mito(4.5)	HKKKRQQIKAIKAAEAAGMKRKASLSSKKEDLPPNSKERRKQKRTA (358-403, prob:0.964)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8H7	Uncharacterized protein	Medium	12.6	1	48-69	PENEKAPKRPGLRRNHPSVPPP	nucl(19),cyto(4),pero(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8X8	Fe2OG dioxygenase domain-containing protein	Medium	12.8	1	54-76	RDSKSEAKAAKRRRVSRHFGYHF	nucl(13),cysk(7),mito_nucl(7)	KAAKRRR (61-67, prob:0.697)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAF8	Uncharacterized protein	Medium	12.2	1	470-490	CPTRLRCTKCKQLGHQKKDCS	nucl(15.5),cyto_nucl(11.5),cyto(6.5),pero(3)	RSGGRRRGGGRR (693-704, prob:0.838)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH68	CYCLIN domain-containing protein	Medium	13.6	2	212-237, 376-398	HIEMQKEQRRRRQKREQEMRERKLEE, QQQQSRGRMHHHHHHHHHHQPQV	nucl(12.5),cyto_nucl(9.5),cysk(7),cyto(5.5)	RRRRQKREQEMRERK (220-234, prob:0.796)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHD7	Uncharacterized protein (Fragment)	Medium	14.3	1	26-56	VSPRHFTRIEREREKRHRKFRFRRYESDTQI	nucl(17),cyto(6),mito(2),pero(2)	REREKRHRKFRF (36-47, prob:0.825)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK89	RING-type domain-containing protein	Medium	12.7	1	367-393	RGAHASPVGKRKRRASGKPREGRVSRA	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(2),extr(2)	RRGAHASPVGKRKRRASGKPREGRVSRARAR (366-396, prob:0.995)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNA8	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.4	1	19-56	NNQGQPPSKRRRINAACLTCRKRKTRCAGEKPDCSTCK	nucl(16),mito(6),cyto(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ17	PseudoU_synth_1 domain-containing protein	Medium	11.9	2	17-37, 56-87	ERQPQQQQQQQQQQQQQQQQQ, APPAGPNPYPPKEKKKKAKKASKIDPSKYSTR	pero(10),cyto_nucl(7),nucl(6.5),cyto(6.5),mito(4)	PPKEKKKKAKKASK (65-78, prob:0.982)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQH1	DNA-directed RNA polymerase subunit	Medium	13.3	3	325-345, 1357-1380, 1482-1503	AVKTRRSKSKAAKPAQRYLST, LLSALTRKEIKKKQKQNSAATPEI, EGRSRSREARIKNKNEHVARFR	nucl(12.5),cyto_nucl(11.5),cyto(9.5),cysk(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q114	Uncharacterized protein	Medium	10.2	1	33-52	RPPFYTRPRTPPRPNPPPTN	nucl(21),cyto_nucl(14),cyto(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q366	Uncharacterized protein	Medium	10.2	2	2-21, 702-721	TPPASQCRRALQRQIVPSKD, AWSCRLALRRWRARLMQKLV	mito(17),nucl(8)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q539	Polynucleotide adenylyltransferase	Medium	10	2	875-894, 927-950	GPPARQQQQQQQQQQQQQQS, ESFGGWQKSKSRKKGVSDLKHAAG	extr(16),nucl(8),cyto(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5C3	Uncharacterized protein	Medium	11.6	1	229-281	VLDNRKKKAKSGKGEIKKGSKAWIIKKKEQMERKGKIVKATSKYTGRKRRPQF	nucl(13.5),cyto_nucl(13),cyto(11.5)	RKKKAKSGKGEIKKGSKAWIIKKKEQMERKGKIVKATSKYTGRKRRP (233-279, prob:0.996)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Q9	Uncharacterized protein	Medium	11.9	1	1185-1211	VGDAMDKMLRRRRRRFRWVRRAGWLVV	nucl(13.5),cyto_nucl(8.5),mito(6),cyto(2.5),plas(2),pero(2)	RRRRRRFRWVR (1194-1204, prob:0.875)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q867	60S ribosomal protein L36	Medium	13.2	1	65-88	ELLRNSKDKRARKLAKKKLGTFGR	nucl(14),cyto(7),mito(6)	NSKDKRARKLAKKKLGTFGRAKAK (69-92, prob:0.974)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8J7	Uncharacterized protein	Medium	13.1	1	152-174	DEEEEEKKKKKKEEKEGLRTGED	mito(11),nucl(9),cyto_mito(9)	RAPRPKGRKA (138-147, prob:0.81),EKKKKKKEEKE (157-167, prob:0.944)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8R9	Splicing factor YJU2	Medium	10.7	1	277-304	VAQPPPPPSFKRQVKKKKDHAALLGIKK	mito(12),nucl(9.5),cyto_nucl(8),cyto(5.5)	KRQVKKKKDHAALLGIKKK (287-305, prob:0.852)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI71	Glycosyltransferase family 24 protein	Medium	10.8	3	194-214, 1241-1264, 1418-1437	EGTYRVRYKRNPAQRREALSV, MVTYKWPHWLRQQKEKQREIWGYK, CNNPQTKEPKLDRARRQVPE	mito(11),cyto(7.5),cyto_nucl(5.5),nucl(2.5),extr(2),plas(1),pero(1),E.R.(1),golg(1)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPU6	Uncharacterized protein	Medium	11.2	1	570-598	AEEIRRRNRAARRAQKRQRGQAGNKNNNS	mito(11),nucl(8),cyto(6)	RRRNRAARRAQKRQRG (574-589, prob:0.901)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q460	Uncharacterized protein	Medium	14.9	1	243-267	TYTPRMAPAPKGKRRKLDPDTAVKS	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(3)	KEKEKEKEKEKENDEEKEKDEEKAKGSKPAP (91-121, prob:0.799),PKGKRRK (252-258, prob:0.734)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4D8	G-patch domain-containing protein	Medium	14.2	1	198-225	PPPPGEKQREEEKKKKKAQLLDAKKVRK	nucl(23),cyto_nucl(14)	SPPPPPGEKQREEEKKKKKAQLLDAKKVRKMALDDRKKAAR (196-236, prob:0.986)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q696	DNA helicase	Medium	10.3	1	13-35	ATPSRATRSSQQQQQQQQQQQQS	nucl(19.5),cyto_nucl(10.5),mito(7)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8J1	Uncharacterized protein	Medium	10.2	1	127-155	GFLARKRSRTGRNILKRRMAKGRKKLSHG	mito(19),nucl(6.5),cyto_nucl(4)	QKRRHGFLARKRSRTGRNILKRRMAKGRKKLSHG (122-155, prob:0.994)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBC9	Usp domain-containing protein	Medium	14.7	1	176-201	VVVRPDDKRLKKKEKRSQDPTRQSYA	nucl(18),cyto(5),mito(4)	KRLKKKEKR (183-191, prob:0.761)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC57	Uncharacterized protein	Medium	10	1	16-72	TPATRKTSLAPERKYKCQFCNRAFSRSEHRSRHERSHTKERPFKCMKCRSTFVRRDL	mito(10),cyto(6),nucl(5),plas(2),extr(2)	KRRGGPKTAR (94-103, prob:0.691)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM74	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.1	1	223-245	QRTSIACRYCRKRKIRCSGYAHT	nucl(23.5),cyto_nucl(15)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q019	Uncharacterized protein	Medium	11.8	1	6-28	STDGPRRTTQRLSKPRTGNHATP	nucl(13.5),cyto_nucl(9.5),mito(8),cyto(4.5)	RGRPSRVHSTPKRPAPR (682-698, prob:0.738)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3N2	Uncharacterized protein	Medium	12.7	1	206-230	GSPPAAPDKRKRKSWFPGVRLRANS	nucl(7),mito(7),mito_nucl(7),plas(5)	PDKRKRKSW (212-220, prob:0.814),KEKKKKK (1039-1045, prob:0.798)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7W4	Uncharacterized protein	Medium	13.6	1	1183-1203	RLYREQQKEVRRRQQEEKEKA	nucl(14),mito(9),cyto(2)	TKRILREGREKMRLYREQQKEVRRRQQEEKEKADREAKRAAKR (1171-1213, prob:0.865)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF63	S5A_REDUCTASE domain-containing protein	Medium	10	3	59-79, 335-357, 429-452	TTYLDDKKKPAKKAHLAVRIV, WQLTKWRLDKYRKRHDEVFCRRG, DKMYMERKDYRDWRRNRTFRLWLD	plas(23),mito(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHY7	Histone H2B	Medium	14.3	1	27-52	AGKKTAPSGDKKKRSKARKETYSSYI	nucl(23.5),cyto_nucl(14)	ADKKPASKAPANVASKAPEKKDAGKKTAPSGDKKKRSKARK (5-45, prob:0.993)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKB1	PIPK domain-containing protein	Medium	14.4	1	305-330	RWAEAYRQKRASKRRRRELEDDDRVL	nucl(23.5),cyto_nucl(13.5)	KRASKRRRR (313-321, prob:0.806)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL63	Uncharacterized protein	Medium	11.3	1	383-403	ASDKKRKKLTAGAKSRPPRVE	cyto(8.5),mito(7),cyto_nucl(7),nucl(4.5),pero(2),golg(1),E.R.(1),extr(1),plas(1),vacu(1)	RRALLRAKLKERDRKLSKQKGGWFWWLPGRRVADKPPATSHEKAHHPRHA (278-327, prob:0.896),DKKRKKLTAGAKSRPPR (385-401, prob:0.91)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QML5	Uncharacterized protein	Medium	11.2	1	140-161	YDVVYVRPRRPKPIRRPPEYDP	nucl(9),cyto(7),mito(6),cyto_pero(6)	RRPKPIR (148-154, prob:0.657)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J5	Uncharacterized protein	Medium	10.7	1	388-410	ARRPEPEREDRDRDRDRNRHHRR	mito(13),nucl(9.5),cyto_nucl(8.5),cyto(4.5)	RRDPLRDSEPRDPRGARRPEPEREDRDRDRDRNRHHRR (373-410, prob:0.933)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2S9	Uncharacterized protein	Medium	13.9	2	210-255, 262-289	GGAGRDDEPKKKKKKRYGPKGPNPLSVKKPKKKTPAVPPPKPKATA, GTIEAPTEKKAKRKRRKKSKGGMGSGES	mito(18.5),mito_nucl(13.5),nucl(7.5)	RPNKRK (182-187, prob:0.642),KKGGAGRDDEPKKKKKKRYGPKGPNPLSVKKPKKKTPAVPPPKPKATAPPRAEEGTIEAPTEKKAKRKRRKKSKGG (208-283, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q321	Uncharacterized protein	Medium	13.9	1	147-166	SSDRSRSRSRSRSRSRSSSG	nucl(22.5),cyto_nucl(12.5),mito(3)	RSRSRSRSRSRSRSSSGSGSGGGGGRKKSR (150-179, prob:0.879)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q392	Uncharacterized protein	Medium	13.1	1	153-178	ITNAAMLKKKPKRGLNPKHERRSSIE	nucl(21),cyto_nucl(14.5),cyto(6)	KKKPKRGLNPKHER (160-173, prob:0.885)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4V1	Uncharacterized protein	Medium	13.4	1	6-32	NRKGEKAQGEGRRKKKEKKTYNTEDSL	nucl(19.5),cyto_nucl(11.5),mito(5)	RKGEKAQGEGRRKKKEKK (7-24, prob:0.965)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8L8	Thioredoxin domain-containing protein	Medium	12	1	3-23	MELRKRKEAPAPPPPVRRKMT	nucl(13.5),mito(12),cyto_nucl(8)	RKRKEAPAPPPPVRRKMTKT (6-25, prob:0.852)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDT4	YL1_C domain-containing protein	Medium	14.9	1	118-172	LERQARAKRAAERKRKAQDAIPARFRKKVRIEQPAPRPPRPKKKSERLSWLPSPA	nucl(18.5),cyto_nucl(13),cyto(6.5)	QARAKRAAERKRKAQDAIPARFRKKVRIEQPAPRPPRPKKKSER (121-164, prob:0.993),RRKKQLERMERKAK (201-214, prob:0.71)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEF7	Uncharacterized protein	Medium	11.9	1	197-223	FSQSSRRHHHHRSPSRSHSRRRPPGPS	cyto(7.5),cyto_nucl(7.5),nucl(6.5),mito(6),extr(2),golg(1),E.R.(1),pero(1),plas(1),vacu(1)	RHHHHRSPSRSHSRRRPP (203-220, prob:0.801),RAKREEAIRRDIEEARRLRAENEARERRRLEEERAKREEAEKEKERERERERERERAK (295-352, prob:0.982)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFI9	Helicase ATP-binding domain-containing protein	Medium	11.6	1	136-168	VPALDRHLKQQQPKEGKRRATKKQGSGKRTTSD	cyto(10.5),cyto_nucl(8.5),nucl(5.5),mito(3),plas(2),pero(2),E.R.(2)	PKEGKRRATKKQGSGK (148-163, prob:0.885),RKDPKRAGVKTSEVSREKKARGGSKGNAPSERPSRKK (1027-1063, prob:0.967)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT4	Uncharacterized protein	Medium	11.4	1	140-159	EKAERKIAAKQKKKTFKTVE	nucl(16),cyto_nucl(13.333),cyto(9.5),mito_nucl(8.833)	KVDKRKLEKAERKIAAKQKKK (133-153, prob:0.955)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKJ9	Protein kinase domain-containing protein	Medium	12.7	1	344-374	TLLIEKEERKQRRRERKRKEREMENRSSRRF	nucl(17.5),cyto_nucl(13.5),cyto(6.5)	ERKQRRRERKRKEREM (351-366, prob:0.985)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN82	Uncharacterized protein	Medium	14.9	2	46-72, 89-109	LDLKKDKYIRQPKPKAARKTAKKTAKA, KAPKARSKGATKGKGRPKKKA	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	DKYIRQPKPKAARKTAKKTAKAGDDDRKEEKEEEEENDKAPKARSKGATKGKGRPKKKA (51-109, prob:0.997)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNT9	Uncharacterized protein	Medium	10.9	1	61-80	VKKLVRRQWISNRKRKRGEE	nucl(10.5),cyto_nucl(9),cyto(6.5),mito(5),pero(5)	RKRKR (73-77, prob:0.683)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP56	BZIP domain-containing protein	Medium	13.3	1	213-234	AASARFRIKKKQREQALERSAK	nucl(21.5),cyto_nucl(14.5),cyto(4.5)	KRRRNTAASARFRIKKKQR (207-225, prob:0.83)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ91	DDB1- and CUL4-associated factor 13	Medium	12.7	2	380-407, 412-446	ERYSHMPEIRRIRRHRHLPKVVKKASEI, LAAIKRREENERKHSNKKFEKRKSEREKAIIAKQQ	mito(13),nucl(8.5),cyto_nucl(6.5),cyto(3.5)	RRIRRHRHLPKVVKKASEIKREELAAIKRREENERKHSNKKFEKRKSEREKAI (389-441, prob:0.989)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQB3	Uncharacterized protein	Medium	13.9	1	226-246	SEGHKPAPSRRTKRKALEDAS	nucl(14.5),cyto_nucl(11.5),mito(6),cyto(5.5)	SRRTKR (234-239, prob:0.645),RRSPSSPKLRQAQGPEPKSRPAAPRRAGKGKDFVIHPPKNPVRKAKA (312-358, prob:0.981)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1G9	Chitin synthase	Medium	13	3	12-35, 64-86, 164-183	SYEERHSYRHSQSRRQSRPADLEA, IDPPFQRKRSLVRPERNRIGKDH, AKHGKISKDLKSKRQREVDE	plas(25)	PRRHRSTKHRAAEAEKSGRTRGKASSGAKHGKISKDLKSKRQ (137-178, prob:0.978)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E0	Nop domain-containing protein	Medium	11.9	1	405-428	PAPDDKPSRKRGGRRARKAKEATA	nucl(15),cyto_nucl(13.5),cyto(10)	KAARPLPAPDDKPSRKRGGRRARKAK (399-424, prob:0.99)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4F3	DUF1713 domain-containing protein	Medium	12.4	1	315-350	MQAISVKRQRKLKMKKKKYKKLMRKTRNIRRKLDRL	mito(14),nucl(11)	KRQRKLKMKKKKYKKLMRKTRNIRRKLDR (321-349, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5B1	Uncharacterized protein	Medium	10.1	1	299-318	EEEKKKKKGGYKPVPFPPRV	cyto(11.5),cyto_nucl(11),nucl(7.5),pero(6)	KKKKKGG (302-308, prob:0.761)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5H5	Uncharacterized protein	Medium	10.3	1	103-128	EQQQEQQSTKKKKRPPRQARGRLFLA	mito(14),nucl(6),cyto(4),pero(2)	KKKKRPPRQARG (112-123, prob:0.917)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5Q8	Uncharacterized protein	Medium	10	2	20-43, 686-711	VEETPKPKYYFPRHVKRQFTNDTI, VVMFVVARRYKRKKQAHRRASSISNP	extr(13),plas(5),mito(4),E.R.(2),cyto_mito(2),mito_nucl(2)	RYKRKKQAHRR (694-704, prob:0.783)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Q9	Uncharacterized protein	Medium	13.6	1	349-375	LGDYSMHGKKRVKKGKWKNGLEQFDEI	nucl(13.5),cyto_nucl(11),cyto(7.5),mito(5)	KK (249-250, prob:0.605),GKKRVKKGKWK (356-366, prob:0.868)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7R9	Uncharacterized protein	Medium	12	2	305-327, 834-857	AAEQRKKDMARQAKKSRKGPAGK, QVPGDKGPAKKKKQKKGGLMQAEE	plas(26)	AAEQRKKDMARQAKKSRKGPAGKPP (305-329, prob:0.97),KGPAKKKKQKKG (839-850, prob:0.934)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8W2	Uncharacterized protein	Medium	12.4	1	55-81	QDPPALQSKGRKRKQRIEPGAARERRG	nucl(17.5),cyto_nucl(12.5),mito(5),cyto(4.5)	SKGRKRKQRIEPGAARERRGPKRQP (62-86, prob:0.983)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBI5	CCHC-type domain-containing protein	Medium	12.7	1	246-266	AQQLAGKRRKKEIKLNQLTSI	nucl(16.5),cyto_nucl(9.5),mito(9)	AERRRPRSSISARREEERRKAQQLAGKRRKKE (226-257, prob:0.973)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDN8	Rho-GAP domain-containing protein	Medium	13.1	1	585-611	GVILDNKGKDQKKKPVRRNVQPTLALA	nucl(21),cyto(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIW4	Uncharacterized protein	Medium	11.4	1	477-496	VVPGKTKDKKDKTRSTGPKV	nucl(11),mito(7),cyto(7),cyto_mito(7)	TKDKKDKTRSTGPKVRNKNAK (482-502, prob:0.791)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKC1	Uncharacterized protein	Medium	12.9	1	424-443	DEKESKMKRLKKVLSFSKLR	nucl(17),cyto_nucl(11),mito(7)	KRLKK (431-435, prob:0.635)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H3	J domain-containing protein	Medium	14.5	1	217-236	GGGSGDGPEKKKKKKLKPIG	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	RRK (184-186, prob:0.618),GDGPEKKKKKKLKPIG (221-236, prob:0.986)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3X4	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.9	2	5-25, 78-104	ESREPRSPDLQPSKRPRQSSP, FRNVSACNRCRLRKNRCDQKLPSCASC	nucl(17),plas(5),mito(1),cyto(1),pero(1),golg(1),vacu(1),cyto_mito(1),cyto_pero(1)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4S9	Sister chromatid cohesion protein	Medium	13.9	2	38-58, 1697-1748	QSAPAVQKPAQPKKQPNSISS, QLPSSSGRGRKRKAQHGGAAGPKKKMARSGSQQPRKRGRPRKQSADAQLQAP	nucl(13.5),cyto_nucl(8.5),plas(6),cyto(2.5),E.R.(2),golg(2)	GRGRKRKAQHGGAAGPKKKMARSGSQQPRKRGRPRK (1703-1738, prob:0.996)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X8	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.5	2	48-77, 674-702	SKRECIFKTGPRTRRPRQLNKRLNNQPAAP, KSKYRERVARLERKQQQQQQQQQQQQKEL	nucl(15.5),cyto_nucl(10.5),cyto(4.5),mito(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9F4	Chromo domain-containing protein	Medium	13.1	1	1-28	MTKRSPAKSTKQKRRGRAAPRSATREQT	nucl(18),cyto_nucl(11.5),mito(6)	RSPAKSTKQKRRGRAAPR (4-21, prob:0.908)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCG8	HABP4_PAI-RBP1 domain-containing protein	Medium	14.3	1	211-232	VPSTGGKTKRERERKAKQYIEI	nucl(16),cyto_nucl(13),cyto(8)	RAKPTDAPQRGGRRGGFRERGDRRPY (79-104, prob:0.873),KTKRERERKAKQYIEIDNRYKEPERPRGGRGGRGGARGDGGRGRGRGGAPRGGRGGR (217-273, prob:0.993)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ93	Uncharacterized protein	Medium	13.7	1	108-127	DDNPSPKKRARTNKSSKSAA	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	PKKRARTNKSSKSAAGGSKRGARAKK (113-138, prob:0.962)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK70	Component of oligomeric Golgi complex 3	Medium	12.5	1	82-109	VRAQLAVHAPKKKRKRRRSDRSWEALAV	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	PKKKRKRRRS (91-100, prob:0.98)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Q5	Uncharacterized protein	Medium	11.3	1	214-243	AQQATPVRRRPPPPKRKAKGPGRGRRKGKL	mito(13),nucl(10.5),cyto_nucl(8.5)	RRRPPPPKRKAKGPGRGRRKGKLP (221-244, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0S7	Ubiquitin carboxyl-terminal hydrolase	Medium	13.1	1	850-876	VSQLRRTPDKHDREKDRDGKENQNQKP	nucl(11.5),cyto_nucl(10.5),cyto(8.5),mito(7)	LAKEKKEAKAREKAEEKARKAAEKEQARLAAKERNEAQRRRIEAA (615-659, prob:0.987),RR (683-684, prob:0.616)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X3	Uncharacterized protein	Medium	11.1	1	255-276	APPAQPSRPRAPQKPDPFQERI	nucl(23),cyto_nucl(14.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9C0	Uncharacterized protein	Medium	14.9	1	887-908	IQRNWRSRRQLRSWRDYRRKVI	nucl(18),cyto(6),pero(2)	KPKR (1108-1111, prob:0.627)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAR0	DUF1279 domain-containing protein	Medium	11.6	1	21-40	APLPKPRRPFHSTRPRRADS	mito(17),nucl(4),cyto(2),plas(2)	RPRLALTRAPLPKPRRPFHSTRPRRA (13-38, prob:0.885),K (207-207, prob:0.602)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEF3	STE like transcription factor	Medium	11.4	1	417-436	EGSPTYKQRRRRSSIPPSLS	nucl(26),cyto_nucl(14.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI76	Uncharacterized protein	Medium	10.2	1	193-212	LKTARRPKYLRSRMGSQRSS	nucl(21.5),cyto_nucl(14),cyto(5.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLQ0	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.8	2	8-32, 396-415	RSGCQICKLRRLRCDETKPGCRNCA, GKALALCRRSRNRWRLSGAT	mito(16),nucl(10)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP90	Uncharacterized protein	Medium	10	1	128-147	FSSHNPTRPTKRGQNRPGEA	nucl(13),cyto(7),pero(4),mito(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZK0	Uncharacterized protein	Medium	10.4	1	43-68	AAAPDTHHHRRRHHHHHRHRHHLLGN	nucl(14),cyto(7),mito(3),extr(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW1	Uncharacterized protein	Medium	12	2	559-586, 654-683	KKEEEKKEEKEKEKEKEEKKEERKEEED, QRVTAHKSPRRTSTPRPRSQNRQQVGKANG	mito(19.5),cyto_mito(12.5),cyto(4.5)	KKEEEKKEEEKKEEEKKEEKEKEKEKEEKKEERK (549-582, prob:0.98),AASKPRAPHAGRLTGRKPHVPQAKPSTGQRVTAHKSPRRT (626-665, prob:0.841)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3S3	Uncharacterized protein	Medium	13.2	1	92-113	STSPLKSRTRAGTQKKRKAAAT	nucl(21.5),cyto_nucl(14),cyto(5.5)	TQKKRK (104-109, prob:0.679)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4J9	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.2	2	9-35, 53-85	RSAGGCWTCRLRRKKCDEARPICKGCV, GGEKQKQKADWLKREVKRKAAHRRERRYLQGLE	mito(17),nucl(8)	KADWLKREVKRKAAHRRERR (60-79, prob:0.917)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5F4	Uncharacterized protein	Medium	12.4	1	156-177	GGKEGHKTRRRRRPTTTIIRIQ	nucl(15.5),cyto_nucl(10),mito(6),cyto(3.5)	RPGPGGKEGHKTRRRRRP (152-169, prob:0.938)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7S6	Uncharacterized protein	Medium	13.6	2	44-73, 283-306	QERALRERESRYQKHRRSKAKQAIRVKMGH, GEQGEQPPTKKRKKTNEGRAEPMM	mito(14.5),cyto_mito(10.5),nucl(6),cyto(5.5)	QKHRRSKAKQ (56-65, prob:0.756),KKRKK (292-296, prob:0.669)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBQ4	E3 ubiquitin protein ligase	Medium	11.3	1	624-644	KEISKECHKWKVKSQSNSSEE	nucl(23.5),cyto_nucl(14)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC32	Uncharacterized protein	Medium	10.1	1	133-152	PEPARVPKPCLKRRRPVTDV	nucl(20.5),cyto_nucl(14.5),cyto(5.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJH1	Uncharacterized protein	Medium	12.6	1	51-95	TVSASRQKQSKRDEAIRRKMENDLSKKKHLTTRARQSRKAPPGTV	nucl(8.5),cyto_nucl(8.5),mito(8),cyto(7.5)	RRKM (67-70, prob:0.642),LSKKKHLTTRARQSRK (74-89, prob:0.726)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR6	Bms1-type G domain-containing protein	Medium	12.8	2	9-38, 55-80	HHHSHRPTTKVTHKPFKSRHATKGQLRDAA, QVMSKLDRRNQAKQRQLEKAREHQKE	nucl(9.5),cyto_nucl(8.5),cyto(6.5),mito(5),plas(2),pero(2)	KPFKSRHATKGQLRDAAKGRIAGEKGQRK (22-50, prob:0.769)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ48	Uncharacterized protein	Medium	10.2	1	673-703	GDGRVKRWDPNCYRRRRRRHHDHHDHHDHHD	cyto(13),nucl(6),mito(4),extr(2),pero(2)	ARLRAKVRERERMLRAR (199-215, prob:0.741)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Z6	Uncharacterized protein	Medium	12.9	1	127-157	SSATPPPTAKRSKKQRKRGKSKNKANSGGEP	nucl(19),cyto_nucl(13.5),cyto(6)	AKRSKKQRKRGKSKNKAN (135-152, prob:0.993)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E2	CP-type G domain-containing protein	Medium	13.6	2	1-60, 68-89	MAGSINKPKKPKSKRTPVRLRHKIEKASAAKQRKARKLAKKNPQWRSKLKKDPGIPNLFP, QIEETRIRKKEEQQRRRELAKA	nucl(13.5),cyto_nucl(10),mito(8),cyto(5.5)	KPKKPKSKRTPVRLRHKIEKASAAKQRKARKLAKKNPQWRSKLKKDP (7-53, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3M3	Uncharacterized protein	Medium	10.1	1	6-29	QESPTVQSSKKRRRDDNDHQMHPA	nucl(19),cyto_nucl(13),cyto(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Z7	Uncharacterized protein	Medium	10.5	1	659-691	NSWIHKPKYNDDNDKQPRSKSKSRKSIFSRKKD	mito(17),nucl(7.5),cyto_nucl(5.5)	PRSKSKSRKSIFSRKKD (675-691, prob:0.845)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q670	ANK_REP_REGION domain-containing protein	Medium	11	1	2-41	ASSQRKTGTLKKPAAKAKTKKPDGKACKGKTKKALSAPIL	mito(9),nucl(8),plas(5),cyto_nucl(5)	TLKKPAAKAKTKKPDGKACKGKTKK (10-34, prob:0.97)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8Q0	WD_REPEATS_REGION domain-containing protein	Medium	11	2	21-40, 406-430	TPEQRYWRSFKNQKSHTSTA, AQGGRGRRPKLKPWQRYFRQGRYAA	cyto(11.5),cyto_nucl(8),mito(4),nucl(3.5),plas(3),extr(2),pero(2)	RRPK (412-415, prob:0.616)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9M1	DUF4048 domain-containing protein	Medium	12.8	1	57-101	LATLARPGRRRRILPKTSHSFDTINTATKRAKTARRDPREFKDMD	nucl(13),extr(6),cyto(4),mito(2),cyto_pero(2)	GRRRR (64-68, prob:0.653)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDB2	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.3	1	41-61	TIPPPRPMGRPPRQYRSQSSS	nucl(24),cyto_nucl(14)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDU2	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.1	2	7-34, 134-156	KYKGCETCRLRRVKCDNQRPHCRKCLDG, DLVQLDCRRPRQRRGRYSTQLAG	plas(10),nucl(8),mito(5),cyto(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGE2	Uncharacterized protein	Medium	13.6	1	309-338	STRRRPPGGLPSRPQRKRKRDEPESNSGGG	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	RRRPPGGLPSRPQRKRKR (311-328, prob:0.935)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJG6	DNA polymerase epsilon catalytic subunit	Medium	11.4	1	1-20	MPNTSLRRPQKGYRRGGKVA	nucl(11),mito(10.5),cyto_mito(7.5),cyto(3.5)	R (1298-1298, prob:0.601)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP13	Non-specific serine/threonine protein kinase	Medium	10.4	1	786-808	EEVNVKRNRFSKRQSKNGLGAAF	nucl(20.5),cyto_nucl(13),cyto(4.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPJ4	Rab-GAP TBC domain-containing protein (Fragment)	Medium	12.1	1	512-532	GFIYDQRRKKRQREAAQMARH	nucl(13.5),mito(11),cyto_nucl(8.5)	RRKKRQREAAQMARHAKK (518-535, prob:0.815)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ13	Uncharacterized protein	Medium	14.5	1	148-175	EADAQRRRPGPKRRTSSSRKATKSKLSA	nucl(25.5),cyto_nucl(14)	RRRQAEADAQRRRPGPKRRTSSSRKATKS (143-171, prob:0.971)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0J8	Uncharacterized protein	Medium	11.2	1	373-401	LNRPEARRSWDRQRKRRRKQHGLGPPNGD	plas(17),nucl(8)	ARRSWDRQRKRRRKQH (378-393, prob:0.948)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2I7	WD_REPEATS_REGION domain-containing protein	Medium	14.4	1	130-152	PDFTEEGKKHRRRVSRGRRLLDE	nucl(11),cysk(6),cyto(5),pero(3)	KKHRRRVSRGRR (137-148, prob:0.83),KKKLRSIRRK (287-296, prob:0.708)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2P1	Uncharacterized protein	Medium	13.9	2	20-57, 243-262	ASHPPPPSAPAPRRRKNHRGGRRKKQRRKSFAAPADEI, RDSASRQRTRRRCGKWPDLS	nucl(12.5),plas(12),cyto_nucl(7.5)	SAPAPRRRKNHRGGRRKKQRRK (27-48, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4E1	Uncharacterized protein	Medium	10.7	1	581-606	GSRKGMRQGRRIRRSVRVLRRIDRIL	cyto(8),cyto_mito(7.333),plas(6),cyto_nucl(5.833),mito(5.5),nucl(2.5),E.R.(2)	KQKRL (256-260, prob:0.634),KGMRQGRRIRRSV (584-596, prob:0.75)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4P0	AAA domain-containing protein	Medium	12.7	1	54-90	EEGQEEKKDDKKKNDKKKVKKKKDKKKEDEDSKEDGD	nucl(19.5),cyto_nucl(10.833),mito(6.5),cyto_mito(4.333)	KKDDKKKNDKKKVKKKKDKKK (60-80, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5J9	EST1_DNA_bind domain-containing protein	Medium	12.4	1	7-33	WNEHLRREAQKKLKPRIRCPDCGHGFL	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(4)	AAAEGRKNKSPSPGFKREGSRSRSVSPPKRKARA (116-149, prob:0.962)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5Y6	Uncharacterized protein	Medium	13.4	2	7-36, 81-111	LPPLPPLQAGDRKKRSRRPDSPPPPPHSSS, DETQPRYPPPRGTKPPKPQKREFRRQLDSGV	mito(11),cyto(9.5),cyto_nucl(7.5),nucl(4.5)	RKKRSRRP (18-25, prob:0.777),RGTKPPKPQKR (91-101, prob:0.743)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8T9	DNA_LIGASE_A3 domain-containing protein	Medium	12.7	2	985-1006, 1040-1062	STPNTRRKTKIVLVDRRRREAT, RDEERKLYNNKWKPERQFELNHH	nucl(18),cyto(8.5),cyto_mito(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9R3	Uncharacterized protein	Medium	11.5	2	34-56, 493-523	GSFSKPASTLRSRKRSNHSAGMP, QGANWHRRPQPPPQQQQQQRGRNLRRKVQGA	nucl(15.5),mito(10),cyto_nucl(9)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBI8	Uncharacterized protein	Medium	12.4	2	249-275, 951-971	PPPPPPPQAQPPKPKQSTRKLIKNILN, KDRRGDKRSAHPPPKDPGKVR	mito(10.5),nucl(9.5),cyto_mito(7.833),cyto_nucl(7.333),cyto(4)	GGSGGKDRRGDKRSAHPPPKDPGK (946-969, prob:0.882)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC07	Uncharacterized protein	Medium	12.3	1	1211-1232	MAEFKRDRTKRRFLTFLRRDKG	nucl(14),mito(7.5),cyto_mito(6.5),cyto(4.5)	RVGRPPAHASKSTEPGGSSKKATGPRSLKRK (955-985, prob:0.815)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC38	Uncharacterized protein	Medium	14.4	1	26-50	QSPYQQPQPQPPQPQQQQPPPPPPQ	nucl(24.5),cyto_nucl(13.5)	K (134-134, prob:0.602)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDG1	Uncharacterized protein	Medium	14.8	2	1-28, 360-384	MGSPDEGRYRRRRRRRRRPSGILSGFGI, TTAINGRRPRPRRCRLQSRRTASSS	nucl(9.5),cyto_nucl(8),extr(6),cyto(5.5),mito(5)	RYRRRRRRRRRP (8-19, prob:0.983),RRPRPRRCRLQSRRTASSSRSRSRSPG (366-392, prob:0.782)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFH9	Replication termination factor 2 (Fragment)	Medium	12.8	1	199-224	GLTHSLKKDKSNGKKKRKAEGLNGGA	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	KKDKSNGKKKRKA (205-217, prob:0.934)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI31	Uncharacterized protein	Medium	10	1	56-77	SGHDRRGQSRRGKDKKGGEVGC	mito(13),cyto(7),nucl(5)	RGQSRRGKDKK (61-71, prob:0.713)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJM4	C2H2-type domain-containing protein	Medium	10.7	1	721-744	DQEKQLKSRKHTARRQTDEEKWRD	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLU1	Mannosyltransferase	Medium	14	2	5-31, 592-613	QAAPQVPAPKKQKKEFVHPSAKHARKK, WEIVPERLRRKWGRHCLLKRRK	plas(22),mito(3)	KKQKKEFVHPSAKHARKK (14-31, prob:0.734),RRKWGRH (600-606, prob:0.646),LLKRRK (608-613, prob:0.734)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMU8	Uncharacterized protein	Medium	13.6	1	172-198	LPKFACPYFKRNPRKYRKWTSCPGPGW	nucl(15),cyto(7),mito(5)	RRKKSKR (154-160, prob:0.764)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNP1	Uncharacterized protein	Medium	10.1	1	542-566	LTGEVMKKMRKKKEKEAVKEGAKRE	plas(15),nucl(6.5),cyto_nucl(5.5),cyto(3.5)	KKMRKKKEKEAVKEGAKRES (548-567, prob:0.966)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ81	Uncharacterized protein	Medium	14	2	13-42, 111-141	SLAYLPRKRAARHRGKVKSFPKDDPKKPVH, SDEVKRRFYKNWYKSKKKAFTKYAKKHSENN	mito(18.5),mito_nucl(11.5),cyto(5)	PRKRAARHRGKVKSFPKDDPKK (18-39, prob:0.944),KKK (126-128, prob:0.634),KKLPRKTHKG (237-246, prob:0.685)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZN8	Clr5 domain-containing protein	Medium	10.5	1	197-221	AEAHERWVTKKRRRHTRPYGGLPAD	mito(9),nucl(8.5),cyto_nucl(7.5),cyto(5.5),pero(3)	TKKRRRHT (205-212, prob:0.798)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1H6	Uncharacterized protein	Medium	10.6	1	252-274	EAAPARRRLSRRKQHESSRKAAR	extr(11),nucl(7),mito(3),cyto(3),cyto_mito(3)	ARRRLSRRKQHESSRKA (256-272, prob:0.843)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1M2	zf-TFIIIC domain-containing protein	Medium	12.1	1	141-166	RSSVLFGYKPRRKRQPRRGPCSGQHD	nucl(15.5),cyto_nucl(12),cyto(7.5),pero(3)	KPRRKRQPRR (149-158, prob:0.806)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBU5	Uncharacterized protein	Medium	14.3	2	107-132, 358-379	FRSTTSTTHHHRRYRHRHHHDYGGNS, IPTPPASKRKNSKPGRKPKGEG	cyto(13),nucl(6),extr(4),pero(3)	TPPASKRKNSKPGRKPKG (360-377, prob:0.959),KGIKAREDRIKTGGRWGRGGAAAGGK (539-564, prob:0.788)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC27	Uncharacterized protein	Medium	14.2	2	9-40, 93-125	GAVSPPAPRRGRREKPWPPGKQKKLLRLYVCT, RVRFLRSVRAERRIRNRRVRRRLEAQSRNPIAH	mito(11),cyto_nucl(8),nucl(7.5),cyto(7.5)	APRRGRREKPWPPGKQKK (15-32, prob:0.951),RAERRIRNRRVRRR (101-114, prob:0.87)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE53	F-box domain-containing protein	Medium	13.6	2	38-57, 691-712	RPEPQLKKRDRLLRGLQRMS, GGAGGWRRRRRAREAQMAHDEE	nucl(13.5),cyto_nucl(12),cyto(9.5),mito(3)	WRRRRRA (696-702, prob:0.734)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEN0	TLC domain-containing protein	Medium	10	1	67-94	AASPATTTKRFSKRRKARSALRRAKSIA	plas(25)	KRFSKRRKARSALRRAK (75-91, prob:0.951),KKRK (453-456, prob:0.683)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHI2	Transcription initiation factor IIE subunit beta	Medium	10.4	1	261-292	PRLKAAQAPKAEKKKKKTQRRTGKSTNVHMEH	mito(15.5),cyto_mito(9.5),nucl(8)	LKAAQAPKAEKKKKKTQRRTG (263-283, prob:0.979)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK05	Uncharacterized protein	Medium	13.5	1	1-23	MARTLEKTRKQIAKKRHGKIEAL	nucl(19.5),cyto_nucl(12),mito(4)	TRKQIAKKRHGKIEALHEKSRDSKRLHRAQVRDDRLEKLAEARRKK (8-53, prob:0.943)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKI9	Uncharacterized protein	Medium	14.3	1	26-59	LQESPTARRAKRVRKNRKRRSKRSEDKRLELEKW	nucl(17),mito(6),cyto(4)	ARRAKRVRKNRKRRSKRSEDK (32-52, prob:0.997)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E4	Homeobox domain-containing protein	Medium	13.3	1	107-128	RINNWFQNRRAKEKQIRKTAEF	nucl(21.5),cyto_nucl(14.5),cyto(4.5)	AGRRKSRRP (392-400, prob:0.763)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1F6	Uncharacterized protein	Medium	12.9	1	344-370	LPEHVTPCRDMRRKNPRKHVTISKGLT	nucl(22),cyto(2),pero(2),cyto_pero(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1I7	S4 RNA-binding domain-containing protein	Medium	10.2	1	159-184	NSPFGGGRPGRVRRKKAKAAEKGDEG	mito(14),cyto(7),nucl(6)	GRPGRVRRKKAKAAE (165-179, prob:0.947)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1T4	Uncharacterized protein	Medium	13.3	1	643-663	IPDRPQPQPHHHHHHHHHPSD	nucl(19.5),cyto_nucl(12),cyto(3.5),mito(2)	KKRPAKRK (232-239, prob:0.825)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3I4	Arrestin_C domain-containing protein	Medium	11.8	1	222-246	TIYLEPISKRSKRKRQPVVGEKCSA	nucl(15),cyto_nucl(14.5),cyto(10)	KRSKRKR (230-236, prob:0.699)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9Q4	Uncharacterized protein	Medium	14.1	3	55-79, 398-419, 1475-1498	GQPTACPEPVKKKNRPHGLQEAPTY, DGESGSRRSKRLKKNTVPTVAG, VLEVSKSTRKPRPTKLQKLLAQYG	mito(12),nucl(11),cyto(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB52	Uncharacterized protein	Medium	10.3	1	291-310	DLQYRPSKRRRTTSRIPEQH	nucl(19.5),cyto_nucl(12.5),cyto(4.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBP9	Histone-lysine N-methyltransferase, H3 lysine-36 specific	Medium	12.9	1	344-365	WDTTVAKKPRKKKAHEGDEEYV	nucl(18.5),cyto_nucl(13),cyto(6.5)	KKPRKKK (350-356, prob:0.822)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPQ4	DUF4050 domain-containing protein	Medium	10	1	173-192	IEMKRARRRRAVREEMKWNP	mito(17),nucl(6.5),cyto_nucl(5.5),cyto(3.5)	KRARRRRA (176-183, prob:0.753)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZU6	Uncharacterized protein	Medium	13.9	1	186-215	VAWYMRDRVLRRRRRRRRAFRRALRARSVA	nucl(16),cyto(7),mito(4)	LRRRRRRRRAFRRALRARSVAAGGPAGRAARGERLRR (195-231, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q332	DH domain-containing protein (Fragment)	Medium	12.3	1	36-56	AKPFQKWMKTLHKRVLRQQEA	nucl(19),cyto(7)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3U8	Uncharacterized protein	Medium	10.6	1	193-225	MERRHSGKSSRRDHSRHHSHSSRHHKDEQKTVG	nucl(8),cyto(8),cyto_nucl(8),plas(7)	KMERRHSGKSSRRDHSR (192-208, prob:0.753)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAN3	O-acyltransferase	Medium	10	3	13-33, 73-92, 534-555	SDPFARPRARRPPHSQLSQTS, LSTARKQVRAEQQRRRLFPT, VMLQRTKWVRGRKTFNNVCFWC	plas(24),E.R.(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBQ8	RRM domain-containing protein	Medium	14.1	1	56-82	YHPTESWLERRDRKKREKQEQVERLLT	nucl(14.5),cyto_nucl(9.5),mito(8),cyto(3.5)	RIK (180-182, prob:0.609),VERGRTVKGWKPRRLGGGLGGR (185-206, prob:0.841)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGV5	Uncharacterized protein	Medium	12.6	1	133-154	PPAAVRKRHHVAKGKSKGNRAD	nucl(18.5),cyto_nucl(13),cyto(4.5),mito(4)	RKRHHVAKGKSKGNR (138-152, prob:0.836)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N3	Fungal_trans domain-containing protein	Medium	14.8	1	76-105	QHSSNSDGPARKRRRSRKGLDKKFECPEKG	nucl(17),mito(5),cyto(3)	ARKRRRSRKGLDK (85-97, prob:0.94)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6G4	Uncharacterized protein	Medium	10.1	1	135-154	GSGGRRRRRGWRIAWKQRHG	cyto_nucl(7.5),nucl(7),mito(7),cyto(6),pero(6)	GRRRRRGWRIA (138-148, prob:0.837)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7S7	Pol_alpha_B_N domain-containing protein	Medium	12.3	1	160-182	YAQACGGKKKSRRPPPPSLDEVF	nucl(16.5),cyto_nucl(11),mito(6),cyto(4.5)	KKKSRR (167-172, prob:0.662)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7T8	Glycoside hydrolase family 10 protein	Medium	10.6	1	91-115	KTFEKLIREKPKPGFKRKRKTVAAN	cyto_nucl(11),nucl(9.5),cyto(9.5),mito(6)	IREKPKPGFKRKRKT (97-111, prob:0.951)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q970	Peptidase_M14 domain-containing protein	Medium	10	2	60-79, 304-326	VFGRPPTKTKDQRPGPQLQS, TWKVDRLWRKSRQPTKMRFCRGL	extr(17),plas(3),mito(2),E.R.(2),golg(2)	KRRRR (531-535, prob:0.721)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB92	CID domain-containing protein (Fragment)	Medium	11.2	1	315-335	YGWSRAFCERMKRRRRGGSGQ	nucl(11),cyto(10.5),cyto_mito(8),mito(4.5)	KRRRRG (326-331, prob:0.686)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBT8	Glycosyltransferase family 1 protein	Medium	10.2	1	23-56	ALRPHVLKNPPTRKMRKQARKRGKDEDDRFRRFR	cyto(10),nucl(6),mito(5),cysk(3),plas(1),extr(1),pero(1)	KNPPTRKMRKQARKRGKDEDDRFRRFR (30-56, prob:0.966)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF19	Polyadenylate-binding protein	Medium	12	1	423-444	KEGEKKTEKKPERKLGKSKGFG	nucl(15),cyto_nucl(12.5),cyto(8),mito(2)	GKDKENKKEGEQEAKKEGKEEGEKDGEAKEGEKKTEKKPERKLGKSK (395-441, prob:0.983)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHS0	Methionine aminopeptidase 2	Medium	12.5	1	75-111	DPAAADGRANKKKRRKRSKKKSKKKSKANAPIEQSWP	nucl(16.5),cyto_nucl(14),cyto(6.5)	RANKKKRRKRSKKKSKKKSKA (82-102, prob:1)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNB2	Kynurenine formamidase	Medium	10.3	1	249-270	GASGRRRSRRSDARPRRQRWIL	cyto(13),nucl(6),extr(4),pero(3)	GRRRSRRSDARPRRQ (252-266, prob:0.871)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNG8	Cytochrome b5 heme-binding domain-containing protein	Medium	12.3	1	249-268	TEPRRKLCDQAAKGRKKRVV	nucl(15),cyto_nucl(10.5),cyto(4),mito(3),vacu(2)	KGRKKRVVSGK (261-271, prob:0.796)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q384	Uncharacterized protein	Medium	13.5	2	208-230, 295-316	NFACWAKRQHHTHKQDRHKEEQG, DDISNFKRRNPRRDRSPSEDVV	nucl(17),cyto(7),extr(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B9	Uncharacterized protein	Medium	13.9	1	3-36	SSSPPATQDRRNRDRVRDNQRRSRARKREYIQEL	nucl(15),cyto_nucl(11),mito(7),cyto(5)	QRRSRARK (22-29, prob:0.7),RGGRHGRGPPAPPAPPAPAPKP (95-116, prob:0.804)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6C3	Metallophos domain-containing protein	Medium	12	1	729-750	YGGGKWKARLKKGGRWQPRSVV	plas(19),mito(4),cyto(1),pero(1),E.R.(1),vacu(1),cyto_pero(1)	RPRRRRK (241-247, prob:0.714),GRGPSPNKKSHGHGHGHGHGQGHGKGSAARKWGWAGAGRARA (668-709, prob:0.872),KWKARLKKGGR (733-743, prob:0.737)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE44	Uncharacterized protein	Medium	11.5	1	145-167	KCDFCGKSFKRPQDLKKHVKTHA	nucl(25.5),cyto_nucl(14)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEF2	Uncharacterized protein	Medium	12.8	1	258-283	ILEREVKKTKTTKKKGRGERPVDLPA	nucl(19),cyto_nucl(14),cyto(7)	AAKEEKRRREARENGIILEREVKKTKTTKKKGRGERPVDLPAVGRMRGAELRVSAREARAIAESVRGPAGKGKGKRRRR (242-320, prob:0.996)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHZ0	Uncharacterized protein	Medium	13.1	1	470-493	LEGGKKMGKAKLKREKKAARLAAA	nucl(19),cyto_nucl(13),cyto(5)	GKKMGKAKLKREKKAAR (473-489, prob:0.962)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIC2	Mtf2 domain-containing protein	Medium	11.2	1	33-53	HSSNRTNHPRERPRSVKPARG	mito(17),nucl(8)	SKRGKNGSSSKRKRG (316-330, prob:0.874)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJU4	WD_REPEATS_REGION domain-containing protein	Medium	10.8	2	93-114, 446-470	TLTNREQKEVNKRLRREREDKG, AYSSGPEKFRQHRRKAWRGHNTAGS	nucl(14),cyto_nucl(13),cyto(10)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKJ1	CHCH domain-containing protein	Medium	11.8	1	58-83	QAYRDCKKAWIEKRKMEKKKAGGFFS	nucl(14),cyto_nucl(13),cyto(10)	KRKMEKKKA (70-78, prob:0.757)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL04	VASt domain-containing protein	Medium	14.5	2	8-33, 959-979	LTKLLPKSIAAKRRRKKSTSPGEVVS, AAGARGKKRSRKSKSALASSP	mito(11),nucl(7.5),cyto_nucl(6),cyto(3.5),extr(2)	IAAKRRRKK (16-24, prob:0.866),AAGARGKKRSRKSK (959-972, prob:0.944)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ32	Uncharacterized protein	Medium	12.7	1	234-260	IALFRRPVPLRRRRPVRDHHHHHHPHS	nucl(14),cyto(8),mito_nucl(8)	LRRRR (243-247, prob:0.668)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q066	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	Medium	10.5	1	71-91	RLPVNPRRKKVAPDERKRVAT	mito(8),nucl(7.5),plas(6),cyto_nucl(5.5),cyto(2.5)	RKK (78-80, prob:0.619)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1H8	ATP-dependent DNA helicase	Medium	14.9	2	926-954, 1078-1102	AVNGETTPQRRRRRGGRTARKSHGRLKSV, YSLSELSPRRPQAKRRRQVLADSDD	cyto_nucl(12.5),cyto(12),nucl(11),mito(2)	KKTAAELRKKPAKRK (714-728, prob:0.863),RRRRRGGRTARKSHGRL (935-951, prob:0.955)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2B7	Uncharacterized protein	Medium	10.7	1	1-25	MAPTKPKKKSQSDRARDRARVKPAA	mito(12),nucl(9.5),cyto_nucl(8),cyto(5.5)	KPKKKSQSDRARDRARVKPAA (5-25, prob:0.839)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4C6	Uncharacterized protein	Medium	12	2	114-133, 487-508	RAPDMRTQRRAERRKTQTAI, GCGRSGKRYQNQHQHHHHRDHD	nucl(13),cyto(11),mito(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6C0	RRF domain-containing protein	Medium	10.4	1	81-111	SHTPACQKKKTAKQVLKRQKKNKRDDDDDAD	mito(19),nucl(6)	KKTAKQVLKRQKKNK (89-103, prob:0.768)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8B6	Methionine aminopeptidase 2	Medium	11.4	1	52-85	PGAAAEGAKKKKKKKPKKKKKKPTQQSDPPRVLI	cyto_nucl(14.5),nucl(14),cyto(13)	GAKKKKKKKPKKKKKKP (58-74, prob:1)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAI0	Protein kinase domain-containing protein	Medium	11	2	11-34, 540-559	SISLSPSQIRRRRRPGEGQDQSTD, LTPVNPPKKNKPIRWQFGIR	nucl(14.5),cyto_nucl(11.5),cyto(7.5),mito(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAN5	HATPase_c domain-containing protein	Medium	10.4	1	241-265	DDEEEKKEKKPKTKKVKETKIEEEE	cyto(16),cyto_nucl(15),nucl(10)	KKEKKPKTKKVKE (246-258, prob:0.923)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAT3	CDT1_C domain-containing protein	Medium	10	1	111-131	PNCAAPTPSSRRKRRFESDET	nucl(17.5),cyto_nucl(10.5),mito(7)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBX4	Protein kinase domain-containing protein	Medium	14.6	2	74-96, 147-169	VQSFPSPMRHHRRTPSAHREIKE, IKAFSKARLRKRAQSNILRQGPR	nucl(18.5),cyto_nucl(14.5),cyto(7.5)	KRSGSRRAGAGARGSRGQ (627-644, prob:0.784)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC04	Arrestin_C domain-containing protein	Medium	12.6	1	74-137	RSPKTSRGTAARQEKRKRRKREKEEAKQRKKGEKERERQEKERRRADKENSEKQQKRRSLRSLS	nucl(17),cyto_nucl(13),cyto(7)	KTSRGTAARQEKRKRRKREKEEAKQRKKGEKERERQEKERRRADKENSEKQQKRRSL (77-133, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV4	Deacetylase sirtuin-type domain-containing protein (Fragment)	Medium	11.1	1	338-363	SSGGSRKRKVQRDGTDKKPRRRPGDY	nucl(11.5),cyto_nucl(7.833),mito(5.5),cyto_mito(4.833),cyto(3),plas(2),golg(2)	SRKRKVQRDGTDKKPRRRP (342-360, prob:0.878)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH74	Palmitoyltransferase	Medium	10	2	87-106, 335-360	ATCRRLKPARSKHCSVCRRC, RDPYVPVAENRLRRKKKRRARKIYLA	plas(19),E.R.(3),mito(2),extr(1),pero(1),vacu(1),cyto_mito(1),mito_nucl(1)	RLRRKKKRRARK (345-356, prob:0.988)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK51	Uncharacterized protein	Medium	14.7	2	580-604, 641-670	TAKSDTPKAAKKRKHGDVDKGANKE, STKTTEQTSPSKKKSKGKDKAKKDGPASSE	nucl(11.5),cyto_nucl(9.833),cyto_mito(7.333),cyto(7),mito(6.5)	KAAKKRKHG (587-595, prob:0.798),SKKKSKGKDKAKKD (651-664, prob:0.947)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0I3	Uncharacterized protein	Medium	10.8	1	83-102	EECGIPQRRWHRQHGPIIRY	cyto(8),nucl(7),mito(5),pero(5)	RRERGARPGARRA (664-676, prob:0.771)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q603	Uncharacterized protein	Medium	10.7	1	480-508	EREWRDDWDHRNHHHHRRRRYSVDYEDDR	nucl(21),cyto_nucl(13),cyto(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Q1	Uncharacterized protein	Medium	11.9	1	302-326	DDVGVGGRRRRRGRRTGQGLREWEE	nucl(15),cyto_nucl(14),cyto(9)	GRRRRRGRR (308-316, prob:0.871)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q977	Transcription elongation factor 1 homolog	Medium	10.3	1	1-23	MGKRKSSRKPQAPKKREPLPTTF	mito(16.5),cyto_mito(10),nucl(8)	KRKSSRKPQAPKKR (3-16, prob:0.884)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD18	Uncharacterized protein	Medium	10.5	1	121-143	NNPNTKYCYRHRPDSKCRRAADE	nucl(20.5),cyto_nucl(12),cyto(2.5),pero(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF49	Uncharacterized protein	Medium	12.9	2	21-54, 120-143	ETRQQKPKVLPCKYCSKRFRRVEHVQRHERTHTK, MPQQQHQQQRQQQQQQQQQKPRLV	nucl(17),mito(4),cyto(2),plas(2),pero(2),cyto_pero(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHZ9	Autophagy-related protein 9	Medium	10	2	66-89, 108-132	GGVTGPSTKRRPHKDDRPTWMPQE, DAAGSPSQPRKKKVKQPSAIPGPSN	plas(21),mito(4)	KK (118-119, prob:0.613)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKX0	Protein SSH4	Medium	11.3	1	56-79	QVTGREKRAKKDSLKKRESKGTSD	nucl(11.5),cyto_nucl(11),cyto(9.5),pero(3)	REKRAKKDSLKKRESK (60-75, prob:0.857)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPY2	Uncharacterized protein	Medium	11.4	1	496-520	EPLEKRLRPPSPKRRAKPSPRNVTS	nucl(11.5),cyto_nucl(9),pero(8),cyto(5.5)	FKRRKEVKEEPLEKRLRPPSPKRRAKPSP (487-515, prob:0.985)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q513	Brr6_like_C_C domain-containing protein	Medium	13.5	2	165-189, 452-471	GEIPRVSRDKVRKRKRLNGDRDVGS, TPSGRRSPSKGDRGRSPSKG	plas(19),nucl(4),cyto(2),mito_nucl(2)	PRVSRDKVRKRKRL (168-181, prob:0.885),RRSPSKGDRGRSPSKGTRVRSP (456-477, prob:0.829)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAZ8	Carbohydrate-binding module family 48 protein	Medium	10.2	1	17-38	SQTHSQHDRPVRRENKNPIPVQ	nucl(22),cyto_nucl(15.5),cyto(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEU5	Uncharacterized protein	Medium	12.7	2	1242-1265, 1937-1959	GSASRKPPRPVTQRPPRRNKRVTL, AASQRAQRRRTLQKKQRTQEVLA	plas(11),nucl(7),extr(4),mito_nucl(4)	SASRKPPRPVTQRPPRRNKR (1243-1262, prob:0.837)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGK9	Uncharacterized protein	Medium	13.8	2	243-271, 291-314	QTEPAKRGPKRASRSGKRARKPEHQTDQD, REQNGTRARKRSRKNIQDKPDGDR	extr(15),nucl(5),mito(4),cyto_nucl(4)	AKRGPKRASRSGKRARKP (247-264, prob:0.975),RARKRSRKNIQDKPDGDRRNKARG (297-320, prob:0.888)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLN6	Uncharacterized protein	Medium	13.2	2	82-105, 275-300	ENNGSPPWKQPRHRSKCPEDFRSF, LAVPWRRQGTSKHRDKPWKTRKNWRE	mito(14),nucl(8),cyto(3)	KHRDKPWKTRKNW (286-298, prob:0.745)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1P8	UDG domain-containing protein (Fragment)	Medium	10.6	1	54-75	VPPPRRASRSPSKRKADPPDED	cyto(15),nucl(8),cyto_pero(8)	RRASRSPSKRK (58-68, prob:0.693)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q693	Protein kinase domain-containing protein	Medium	12.3	1	397-421	SEQTSRPAKPKQRRRLPPQLQPLKA	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(3)	KPKQRRR (405-411, prob:0.675)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAU4	Uncharacterized protein	Medium	11.2	1	156-179	TDSGIQSEKGRHRRERRRGGCVIL	nucl(15),cyto_nucl(11.333),mito_nucl(9.833),cyto(6.5),mito(3.5)	KGRHRRERRR (164-173, prob:0.792)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB23	Uncharacterized protein	Medium	13.5	1	165-207	APTTRRISKRKPSLDKTPPPAEDPVVRKPKSRRKARDSTAEKR	mito(20),nucl(4),cyto(3)	RK (41-42, prob:0.611),VKRSVGKPPKTGPRRRASPPAPAAAPAA (112-139, prob:0.952),PAPAAAPTTRRISKRKPSLDKTPPPAEDPVVRKPKSRRKARDSTAEKRPQQRRT (160-213, prob:0.987),EFRKKGGANGGRRSSLGMRGR (276-296, prob:0.808)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFV6	Vacuolar protein sorting-associated protein	Medium	10.2	2	369-394, 2975-3000	RDDRRRYIELFKKRKQNQQLTPDEAD, TMDKQFQDRRRITRARNRPKHALFGV	cyto(13.5),cyto_nucl(13.5),nucl(12.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGQ7	Serine/threonine-protein kinase RIO1	Medium	13	1	471-525	DEDESRFEKRRPRGRKFEDKEEKREHKWLVKEERREKRKTKMPKAVKKRLVATTA	nucl(20.5),cyto_nucl(14),cyto(6.5)	EKRRPRGRKFEDKEEKREHKWLVKEERREKRKTKMPKAVKKRLVATTARKKK (478-529, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJS4	Glycylpeptide N-tetradecanoyltransferase	Medium	10.2	1	54-82	GGGEGAVKKKKKKGKKKKVKQTLSDALGR	cyto(12),cyto_nucl(11),nucl(8),pero(6)	AVKKKKKKGKKKKVK (59-73, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL59	THO complex subunit 2	Medium	14.8	1	2295-2334	SSRSEHDRSRREHHRSERSSRPSGRSSRDRTPDREREPKD	plas(13),nucl(8.5),cyto_nucl(6),cyto(2.5)	RGGRGGRNSRRGERR (42-56, prob:0.763),SDRGRAEPPSRRHDHAPAADRDSRPDSRPDSRPPPRERGAPHG (1788-1830, prob:0.789),HSPREQPRERPPRADSPRRSDRPPTNPPLPDNGRDDRHGRRRHS (1895-1938, prob:0.837),PRGRGGRSVARPP (2015-2027, prob:0.684),SRREHHRSERSSRPSGRSSRDRTPDREREPKD (2303-2334, prob:0.825),HRSHRGEPGPRGDGGSGGGGRGEGGRGGDDYGRGGSSRSNGPPRDSRSSRPGDERGDPRGGDDRARKRRS (2388-2457, prob:0.89)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP50	Uncharacterized protein	Medium	11.9	2	85-108, 884-914	GWTNPWRSKSGTREKYNQRKPSSA, ESTAKAKQPNFKPRRSQKQQQQARPPKRVSW	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZR3	CCHC-type domain-containing protein (Fragment)	Medium	13.8	1	171-192	VTYYNCGKKGHYKQECRSPKKE	nucl(22),mito(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q109	TAFII55_N domain-containing protein	Medium	10.2	1	301-321	DARNRRFRKRLSKLEIKNKEA	cyto_nucl(10.833),cyto(10),nucl(9.5),mito_nucl(8.166),mito(5.5)	NRRFRKRLS (304-312, prob:0.724)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2J6	Uncharacterized protein	Medium	12.8	1	209-228	EKEGKPSKGQARPRERRERG	cyto_nucl(14),cyto(12.5),nucl(10.5)	GTRRRQSARGRGRAGRGRGGRARGGRASGDEK (146-177, prob:0.994),EGKPSKGQARPRERRERGPP (211-230, prob:0.905)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3F1	Exocyst complex component SEC5	Medium	14.8	1	33-58	SEDEAAKKKANRRKSRYQALERAVGN	nucl(17),cyto(8)	KKKANRRKS (39-47, prob:0.762)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6K8	PlsC domain-containing protein	Medium	11	1	738-760	ERSLSRSVMEQKRRRRLEGRAHL	cyto(13.5),cyto_nucl(9),mito(6),nucl(3.5),plas(2),pero(2)	GKGKAAAPAR (723-732, prob:0.67),QKRRRRLEG (748-756, prob:0.773)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q717	Metallophos domain-containing protein	Medium	14	2	332-356, 429-464	LIYPRVGKGKKNKDKDGRRHARDEP, ISPYSGSPSSSKKKKKKKNKKNKHKDKNGKDHVNDA	extr(14),mito(5),plas(2),E.R.(2),golg(2),vacu(2)	KTRRKANAR (258-266, prob:0.692),GKGKKNKDKDGRRH (338-351, prob:0.865),SKKKKKKKNKKNKHKDKNG (439-457, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q980	Uncharacterized protein	Medium	14.7	2	65-84, 229-255	QSYMRWKDIRKRARIRAEET, VKKKEEEEELRRRRRRMRDAPRGASAV	nucl(18),cyto_nucl(12.5),cyto(5),mito(3)	KKKEEEEELRRRRRRMRDAPRGA (230-252, prob:0.952)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB95	Uncharacterized protein	Medium	14.7	3	418-444, 623-648, 686-707	QDDDSKEKKSPKKSKNHNKRDWKVSDL, QQQQQHQRGHHHRPNQRRHEEQTKTT, LQGFLLKRKKTPRRALEEVDAW	cyto(8.5),cyto_nucl(7.5),nucl(5.5),mito(5),extr(3),plas(2)	KEKKSPKKSKNHNKRDW (423-439, prob:0.912)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDL9	Uncharacterized protein	Medium	14.4	1	328-352	AAVAGKKKPPPPPPKKKDIQIPGFG	nucl(24.5),cyto_nucl(13.5)	AGKKKPPPPPPKKK (331-344, prob:0.943)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEN6	Clustered mitochondria protein homolog	Medium	14.8	2	907-930, 1264-1285	QAQAEPAPKKKNKKKSHDGSPASA, GGSAGGKKRAGRSNPKRRGGAA	cyto(11.5),cyto_nucl(11.5),nucl(10.5),pero(4)	PKKKNKKKS (914-922, prob:0.872),KKKKPTGGAGGSAGGKKRAGRSNPKRRGGAAG (1255-1286, prob:0.995)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL09	Uncharacterized protein	Medium	11	2	80-108, 665-689	QAASRARAGKHADKKRKRRGEQAQGEQAE, DEQLGRYQDKKKYVRYQMNPRENWG	cyto(17.5),cyto_nucl(11),mito(4),nucl(3.5)	AQKQAASRARAGKHADKKRKRRG (77-99, prob:0.988)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZZ2	Phosphatidylinositol 3-kinase VPS34	Medium	14.6	2	136-158, 160-180	DNQLHKGRQKCHVYRHRRADGND, SKTPAILPKKKSRKGAPEDKD	nucl(17.5),cyto_nucl(13),cyto(7.5)	PKKKSRKG (167-174, prob:0.764)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q130	Uncharacterized protein	Medium	11.6	2	67-94, 110-137	STVSWPPPAPPPRRPRPHERTYTSRGQI, PGSAIVLREKRTRKKKRQLADLKPDSDA	mito(16.5),cyto_mito(11),nucl(6),cyto(4.5)	REKRTRKKKR (117-126, prob:0.892)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1N2	PAS domain-containing protein	Medium	12.3	1	301-323	KPISRRQRFFRRFYRKTPRSRAS	nucl(16),cyto_nucl(13),cyto(8)	R (556-556, prob:0.603)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9U4	Phospholipid-transporting ATPase	Medium	10.5	2	69-91, 157-182	YDETRSPRSRQPQSPLQRRTPEL, LSQLGWVGRQKRRKRGLGRIPWAKIQ	plas(23),cyto_nucl(2),nucl(1.5),cyto(1.5)	RQKRRKRGLGR (165-175, prob:0.857)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB57	Uncharacterized protein	Medium	11.2	1	452-477	VSGKDKPNGGKRKPKRRDDSENFESR	extr(12),nucl(8),mito(5)	KDKPNGGKRKPKRR (455-468, prob:0.933)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGH9	Uncharacterized protein	Medium	12.2	1	95-114	KYAQKVRKDAQRQKTRLETD	mito(13),nucl(7),cyto_nucl(7),cyto(5)	KKKTKKP (4-10, prob:0.694),RPGKKGKNGAANRSRQPS (265-282, prob:0.825)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLA4	Uncharacterized protein	Medium	14	1	277-305	TNFVRLPKESKKERAKRLRQEGGSRRMNF	cyto(9.5),cyto_nucl(8.5),nucl(6.5),mito(6),extr(2)	RKIKTAAERRKE (257-268, prob:0.7),RLPKESKKERAKRLRQEGG (281-299, prob:0.902),KRLKVLEAGRGTRGKGRK (364-381, prob:0.893)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNN2	Uncharacterized protein	Medium	10.2	1	709-729	LREGLRKCQKHERRELPGRLS	nucl(21.5),cyto_nucl(14.833),cyto(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Y7	Uncharacterized protein	Medium	11.8	2	66-87, 506-530	HGHHSHHHQNQHHQHHHRKSAG, ISSGKSNDLPRKRRQKQSICSESSY	nucl(19),cyto_nucl(12.5),mito(4),cyto(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9T4	Uncharacterized protein	Medium	12.4	1	106-129	FAIVLPRRRGRRGRRGMGKGGRGR	nucl(11),mito(8),cyto(4),extr(2)	PRRRGRRGRRGMGKGGRGRGRGHRRRH (111-137, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBN9	Uncharacterized protein	Medium	13.3	1	34-63	TASGRGRGRGRWARPKNTKVTKPAQQKAAS	nucl(20.5),cyto_nucl(12),cyto(2.5),mito(2),pero(2)	GRGRGRGRWARPKNTKVTKPAQQKAASGRGRRHK (37-70, prob:0.969)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFF2	Polynucleotide adenylyltransferase	Medium	14.3	1	2-30	AYNSRYPPRGSNRPPSRDYRNERDSRHRY	nucl(12),plas(8),mito(2),golg(2),cyto(1),pero(1),vacu(1),cyto_pero(1)	RKGRHDGRGP (105-114, prob:0.662),K (125-125, prob:0.601)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJH6	40S ribosomal protein S26	Medium	14.3	2	1-23, 81-111	MVKKRKNNGRNKKGRGHVNPIRC, GKIVRVRSREGRRNRAPPPRVRYNKDGKKIT	mito(11.5),mito_nucl(10.5),nucl(8.5),cyto(7)	KKRKNNGRNKKGRG (3-16, prob:0.869),RVRSREGRRNRAPPPRVRYNKDGKK (85-109, prob:0.899)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q048	Uncharacterized protein (Fragment)	Medium	10	1	31-57	TRISWTPRAPVRPRRLRKPECRELLNP	nucl(17.5),cyto_nucl(11.5),mito(6)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1H5	BHLH domain-containing protein	Medium	14.5	1	603-622	TSKRTSHKIAEQGRRNRINS	nucl(26.5),cyto_nucl(14)	KKARKNAAKARPKAGIKQSPISKPLRRR (291-318, prob:0.971)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N2	F-box domain-containing protein	Medium	10.9	1	221-257	DVSGGGPRPRPRRPRRTRTRFGWRRPRRPREAYQLSA	cyto(13.5),cyto_nucl(12.5),nucl(10.5)	GPRPRPRRPRRTRTRFGWRRPRRPR (226-250, prob:0.995)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6U2	ERCC4 domain-containing protein	Medium	13.7	1	105-125	ESERPAKKAKKAKPYVPAYRS	cyto(13),nucl(10),mito(2),pero(2)	KKRAGR (89-94, prob:0.667),ERPAKKAKKAK (107-117, prob:0.875)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q761	Uncharacterized protein	Medium	10.3	1	76-103	SADSSETERQRKKKKKKHAKALVSFGDD	cyto(11.5),cyto_nucl(10.5),nucl(8.5),mito(7)	RQRKKKKKKHAK (84-95, prob:0.981)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB40	Uncharacterized protein	Medium	14.4	1	61-87	RATTVVRNRPRMRRRSKTRRGSTGSSA	nucl(23.5),cyto_nucl(13)	NRPRMRRRSKTRR (68-80, prob:0.868)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFS4	Uncharacterized protein	Medium	11.9	2	24-45, 441-464	QSTPATRQPSRRRMTRITRAEP, RPVLSPAAKKRRTARRVNGSSTLE	nucl(19),cyto_nucl(13.5),cyto(6)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG06	Translation factor GUF1, mitochondrial	Medium	10	2	11-34, 633-659	SRPGIWSTSARRRTRKTSLAWSHS, ASDITRRKKLLEKQKAGRKRLRAVGNV	mito(20),cyto(5.5),cyto_nucl(3.5)	TRRKKLLEKQKAGRKRLR (637-654, prob:0.925)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH65	Uncharacterized protein	Medium	10.5	1	19-44	GHDAARQRENQRRHRARVKSRIAELE	mito(13),nucl(8.5),cyto_nucl(7.5),cyto(5.5)	RRHRAR (30-35, prob:0.627)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI61	Protein SDS23	Medium	13.4	2	52-71, 486-505	AENQRYPPPSPRNHRHPSLT, PAEQRARRRRSSSSSVRPSL	nucl(16),cyto(9)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP61	Protein kinase domain-containing protein	Medium	13.8	1	133-155	VAIKIIPRFSKKRRLGKVTAMST	nucl(14),cyto_nucl(10),mito(9),cyto(4)	KKRR (143-146, prob:0.659),RRIEREKRGAKS (217-228, prob:0.729)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9R0	20S-pre-rRNA D-site endonuclease NOB1	Medium	12.9	1	412-433	AEDQKEYKKKLEEERRMKTRDL	nucl(21),cyto_nucl(15.5),cyto(6)	GRNVNAKKRR (459-468, prob:0.796)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9U5	Homeobox domain-containing protein	Medium	11.5	1	73-101	GSRRPARKSTLTQQQKNQKRQRATQDQLT	nucl(26.5),cyto_nucl(14)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDX2	Eukaryotic translation initiation factor 3 subunit A	Medium	12.6	1	757-787	EKAVNQRRKEYRERKLREKREREEKERALRE	cyto_nucl(11.5),cyto(10.5),nucl(9.5),mito(5)	FEKRRRDAERELEKAVNQRRKEYRERKLREKREREEKERALREAEERAEREREEERKRQEARKEELARIRKEREEERERAREAQARQ (745-831, prob:0.996),ARRRAEK (840-846, prob:0.669)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHD3	Tr-type G domain-containing protein	Medium	10.1	1	844-863	SGTVVKKKPKIVKPGMVARI	cyto(14),cyto_nucl(12),nucl(8),mito(4)	AAARKKKAEEKKA (224-236, prob:0.864)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPP3	Uncharacterized protein	Medium	11.9	1	184-209	VPRCCEEIKPEKERTRCRREGWLGRL	nucl(18),mito(5),cyto(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ08	RRM domain-containing protein	Medium	14.3	1	10-33	DEILSSQRRNQQGRRRSARRSAGA	nucl(16.5),cyto_nucl(12),mito(5),cyto(4.5)	QGRRRSARRSAGAAKPAATAPAGGIQKNSKPARGANKP (21-58, prob:0.916),TVKKNTTKDGKGGAAGGKGGKKGGRGRASRPKK (175-207, prob:0.996)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q099	Uncharacterized protein	Medium	13.5	1	288-310	SGFSSRDKRKRWSVCGAERRQDL	nucl(23),cyto(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q213	Uncharacterized protein	Medium	12.5	1	88-111	PPEPVVRRRRLGRPPKNRPPDWDT	mito(14),nucl(8.5),cyto_nucl(7),cyto(4.5)	VRRRRLGRPPKNRP (93-106, prob:0.876),PRRRGRGGWRGRGGRK (123-138, prob:0.946)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q656	Uncharacterized protein	Medium	12.1	1	321-350	DDPLARLRARRAEQKRRRMNNKAQDDNTKI	nucl(14),mito(11),cyto_nucl(9)	RARRAEQKRRR (328-338, prob:0.724)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9J9	Uncharacterized protein	Medium	12.7	1	34-63	VAPPTEKKVKKIIRRKKRPARPQIDPALVK	nucl(18.5),cyto_nucl(12),cyto(4.5),pero(4)	KKVKKIIRRKKRPAR (40-54, prob:0.985)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAE0	Uncharacterized protein	Medium	11.5	1	12-33	ASETRRIAKPRSRLRRFQARAP	nucl(11),mito(7.5),cyto_mito(7),cyto(5.5)	IAKPRSRLRRF (18-28, prob:0.739)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBD6	DNA ligase	Medium	12.7	2	33-54, 717-739	LDEHFPNRPRNHSKTPPFSHLF, AMEMENRKRKPAKRQKRELVIAG	cyto(12),cyto_nucl(12),nucl(10),mito(3)	EEKERKAMEMENRKRKPAKRQKR (711-733, prob:0.971)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGG2	Uncharacterized protein (Fragment)	Medium	11.9	2	180-203, 343-364	GSTRLTAKDRKERRKDPAYRSQGT, PIPYLLRTKRSKRCPVCRHIIS	cyto(14.5),cyto_nucl(11),nucl(6.5),extr(3)	RKERR (189-193, prob:0.625)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ30	PUM-HD domain-containing protein	Medium	10.3	1	772-809	QQQQQQQQQQQQQQKQQQQQQQQQQQHQQQQQQRPQQF	nucl(20.5),cyto_nucl(14),cyto(4.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q139	Uncharacterized protein	Medium	12.6	1	33-64	YNPKSATQLQPPSRRPRTRRCPQPLRSPSGGA	nucl(21),cyto(3.5),cyto_mito(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2T6	60S ribosomal protein L6	Medium	10.3	1	30-52	AEDEPKPRKVRKAVRPWTPRSSL	mito(10.5),mito_nucl(10),nucl(8.5),cyto(8)	KPRKVRKA (35-42, prob:0.708)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q362	DH domain-containing protein	Medium	10.2	1	36-58	HDQSHHSPRSTRKQQQLQYSDRL	nucl(20.5),cyto_nucl(13.5),cyto(5.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q512	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.7	1	72-100	VTPNACTECRKKRAKCDGNKPCSRCKAQK	nucl(20),mito(2),cyto(2),pero(2),cyto_mito(2),cyto_pero(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5W1	Uncharacterized protein	Medium	11.4	2	1-22, 74-118	MVPHSRTSKAKKGKNGRSLYAC, ARTSHSKRSKSHRSSRHSHHHHRSKSRSRSRSRPRHRSSRSAVGA	mito(13),nucl(4),cyto(4),extr(4),cyto_nucl(4)	SKRSKSHRSSRHSHHHHRSKSRSRSRSRPRHRSSR (79-113, prob:0.991)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7V0	Uncharacterized protein	Medium	10.7	1	38-59	DERGQKRTISPEERKRQQRVLD	plas(13),nucl(8.5),cyto_nucl(6.5),cyto(3.5)	RPK (23-25, prob:0.613)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE15	Uncharacterized protein	Medium	12.9	1	835-858	SEDMKRSRNSLRKRDRSGSRQRAF	cyto_nucl(11),nucl(10.5),cyto(10.5),pero(4)	KGKARVKK (453-460, prob:0.71),KRSRNSLRKRDR (839-850, prob:0.707)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGZ7	Uncharacterized protein	Medium	13.6	1	207-232	DSCRSIPRKRLGTKRKPKRPLQLFED	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	PRKRLGTKRKPKR (213-225, prob:0.924)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHM9	Uncharacterized protein	Medium	10	1	48-76	ELPSHPRTKAHTRQQQQQQQQQQRRLPEH	cyto(8.5),cyto_nucl(8),nucl(6.5),cysk(6),pero(4)	SKGRRKARGKKK (762-773, prob:0.989)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMI8	Uncharacterized protein	Medium	11.2	1	135-154	RETIRRSIRRWRYMHVHKSI	nucl(12),cyto_nucl(11.5),cyto(9),mito(5)	LRRAKAR (63-69, prob:0.658)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNH7	Uncharacterized protein	Medium	10	2	916-943, 986-1006	KRKASEDKGKETKKSKKGKESSSTSTKS, EANQEQKQKQEEKKEEKNVGH	mito(14.5),cyto_mito(12.833),cyto(9),mito_nucl(8.666)	FEKRKASEDKGKETKKSKKGKE (914-935, prob:0.966)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPB7	Uncharacterized protein	Medium	10	1	569-598	KHEHEDAKAARREKKRRKREAQRLAQMTEK	mito_nucl(10.333),mito(10),nucl(9.5),cyto_mito(9.333),cyto(7.5)	KAREKKRLAELEQWKKEKAEREAQRANGEDPGSLKRKKNEAWSGKHEHEDAKAARREKKRRKREAQ (525-590, prob:0.997)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPZ0	Uncharacterized protein	Medium	12.3	2	36-55, 157-181	SIKRSNSSLARQKKRPLEDS, RQPNGEPRPKKRKSAPKEVDRSPPT	cyto(13.5),cyto_nucl(11.5),nucl(8.5),mito(3)	PRPKKRKSAPK (163-173, prob:0.887)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B4	S4 RNA-binding domain-containing protein	Medium	14.8	3	1-28, 261-287, 322-346	MRQRRLLRFHGLKRPRVRQTWNKYNLFN, IMLVKDRYHRAKKKKALRKYLKDLKAT, EHAAEAKKQRQQQRQQQQQQREQET	mito(15),nucl(6),cyto(6),cyto_nucl(6)	RAKKIMLVKDRYHRAKKKKALRKYLKDLKA (257-286, prob:0.983)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6H1	Uncharacterized protein	Medium	12.7	1	582-601	DEGKAKPRRRLRASSFNPND	nucl(18.5),cyto_nucl(14),cyto(6.5)	KPRR (587-590, prob:0.622)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCN8	Uncharacterized protein	Medium	11.9	1	21-61	VPETLLKKRKSQEKARAERAAELEKRKKANKEKRGVIFKRA	nucl(14.5),cyto_nucl(10.5),mito(7),cyto(5.5)	KKRKSQEKARAERAAELEKRKKANKEKRGVIFKRAEKYVK (27-66, prob:0.995)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFI5	Uncharacterized protein	Medium	13.3	1	8-27	KEPPKLSKGKGKGARRVSNL	nucl(20.5),cyto_nucl(14),cyto(4.5)	KEPPKLSKGKGKGARRVSNLSEEQRNKKR (8-36, prob:0.921)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGB4	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.6	1	65-86	VSCELCKQRKVKCDRGQPSCGW	nucl(19),mito(4),pero(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ8	Eukaryotic translation initiation factor 2A	Medium	13	3	516-542, 568-592, 640-659	DEGNASKTGSKKKKRNKKAKEGDAANA, EGRSPDRRGHHSRSRSRQNNGNRNS, ANPNAKKIRALQKKIRAIED	cyto(16),mito(7),pero(2)	KTGSKKKKRNKKAK (522-535, prob:0.984)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKL0	Patatin-like phospholipase domain-containing protein	Medium	10.1	2	22-46, 713-732	ATPPLLDPTKLRRKRKNADHGLFGT, SDVRLPRLRRNAKSHGHFRS	nucl(11.5),cyto_nucl(10.5),cyto(8.5),mito(3),plas(1),pero(1),E.R.(1),golg(1)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL53	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.6	2	21-47, 728-752	PLRSSIACQRCRKSKIKCNNTGGDQPC, QHNSHHPHPHPHQHQHQHQHQHQHQ	nucl(12),mito(6),plas(5),cyto(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN90	WD_REPEATS_REGION domain-containing protein	Medium	12	2	17-36, 820-840	PFLSRPSRSPIRPRGPYDPC, NSAPGRRSPPRPSHRRSSRFH	mito(27)	RRSPPRPSHRR (825-835, prob:0.684),SRGRTSGGGAGAGHHRGHRDRKGDR (1005-1029, prob:0.804)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNJ3	Uncharacterized protein	Medium	13.4	1	427-449	LVRQRAEREEREKREKREREMRE	nucl(20.5),cyto_nucl(13),cyto(4.5)	RQRAEREEREKREKREREMREL (429-450, prob:0.901)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H4	Uncharacterized protein	Medium	11.5	1	1-20	MGKSRRNRARGNRSDPIAKP	nucl(12),mito(10),cyto_nucl(8),cyto(2),pero(2)	RRNRARGN (5-12, prob:0.65)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q703	Glutamate decarboxylase	Medium	12.3	1	542-563	PAQHVGPRPRVKKREGERLKDV	cyto(11),cyto_nucl(10.5),nucl(8),mito(3),pero(3)	GAGPGPRGRRRRVK (407-420, prob:0.898),PRPRVKKREGERLKDVGREAGKKR (548-571, prob:0.932)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L7	Uncharacterized protein	Medium	12.9	1	101-129	AGSSDSTKRRRDSRRSNETRSRRDNRRQS	nucl(17.5),cyto_nucl(10.5),mito(5),cyto(2.5)	KRRRDSRRSNETRSRRDNRR (108-127, prob:0.775)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7R5	Uncharacterized protein	Medium	13.6	2	96-127, 176-196	EARNKEKKAIEKIKASKKFQKRKRDAESDDED, ELDKKDEAARKKKPKRATGGA	mito(17),cyto_nucl(5.5),nucl(5),cyto(4)	ARGRRARARAAAGPNYEEARNKEKKAIEKIKASKKFQKRKR (79-119, prob:0.985),DEAARKKKPKRAT (181-193, prob:0.943)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q974	40S ribosomal protein S1	Medium	13.1	1	1-29	MAVGKNKRLSKGKKGLKKKTQDPFSRKDW	nucl(18.5),cyto_nucl(12.5),cyto(5.5)	KNKRLSKGKKGLKKK (5-19, prob:0.956)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKF0	Uncharacterized protein	Medium	10	1	383-415	VPRVLRWQQQQQQRRKQRRKQLGRRQEGTRRRS	plas(25)	RRKQRRKQLGRRQEGTRRR (396-414, prob:0.883),GKRGGRDRSRSGSRGRGRGWNRGGG (526-550, prob:0.931)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4T8	Uncharacterized protein	Medium	11.9	1	15-41	TVESKSSSSSTKKRKRKQPAASGLLIT	nucl(15.5),cyto_nucl(13.5),cyto(10.5)	KKRKRK (26-31, prob:0.782)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q588	Rab-GAP TBC domain-containing protein	Medium	11.8	1	353-374	LRWQEKKKAAGKWVWRNRRPAG	mito(8),cyto(6.5),cyto_nucl(6.5),nucl(5.5),plas(2),pero(2)	RGRG (326-329, prob:0.628),KKKAAGKWVWR (358-368, prob:0.719)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5W5	Uncharacterized protein	Medium	13.3	2	1-22, 57-81	MNPTTNKFRQHQQQQQQQQGMP, AVSDSSQSGRKRKRKRGEASLFAYV	nucl(10.5),mito(7),cyto_nucl(7),plas(3),cyto(2.5),extr(2)	GRKRKRKRG (65-73, prob:0.921)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6K3	60S ribosomal export protein NMD3	Medium	12.7	2	406-437, 465-490	PDVVLVKKHYPNRRKNRRRNWKLKRMAKDEGD, LRQALALYKNTKKKKKQDADAMSIAE	nucl(9.5),cyto_nucl(9.5),cyto(8.5),pero(8)	KHYPNRRKNRRRNWKLKRMA (413-432, prob:0.963)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q786	U3 small nucleolar RNA-associated protein 25	Medium	12.2	1	572-592	TERAHHFRRYRIKGVKRVVMY	nucl(18),cyto(7)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8A3	Uncharacterized protein	Medium	10	1	480-500	GSSPGRRTKIKVVQRERPDAE	nucl(19.5),cyto_nucl(14),cyto(5.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8M5	Uncharacterized protein	Medium	11	1	68-89	ESRPRTGRPRVLTRKAKRNTAR	nucl(13.5),cyto_nucl(11.833),cyto(7),cyto_mito(6.999),mito(5.5)	GRPRVLTRKAKR (74-85, prob:0.738)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCX8	Protein kinase domain-containing protein	Medium	11.3	1	849-870	QTSNRQPRRGSRAQQTGRGNRD	nucl(17),cyto(3),plas(3),mito(2),pero(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDK0	Uncharacterized protein	Medium	13.3	2	11-30, 495-515	RSYTLDSVSPRKRRRTLSTD, LEEQREVGGKRKRGKQKLRLN	nucl(10),mito(10),mito_nucl(10)	GGKRKRGKQKLR (502-513, prob:0.912)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG69	Uncharacterized protein	Medium	10.3	1	788-819	PRVTLPHQRKAHSKRRWRRRARDNTPAIKTPM	mito(11),nucl(6),extr(4),cyto(3),pero(2)	QRKAHSKRRWRRRAR (795-809, prob:0.953)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIA1	Protein kinase domain-containing protein	Medium	10.1	1	148-172	TAPSHESQPQRRRKPKYVAIKKIYV	nucl(19.5),cyto_nucl(13),cyto(5.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM71	Uncharacterized protein	Medium	11.5	1	249-281	VRLTRFHERPALKRKRLKRERWQERFRQGFRAT	mito(12),nucl(9),extr(3),cyto(2)	LTRFHERPALKRKRLKRERW (251-270, prob:0.958)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNQ0	Uncharacterized protein (Fragment)	Medium	10.1	1	5-35	TYYNYGKKGHYKRECRSPKKEWKIVPRKEIT	nucl(18),cyto_nucl(11.5),mito(6)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPX9	Uncharacterized protein	Medium	12.6	1	525-546	ARSPEGPRKRARKPRSDSLSKL	nucl(17.5),cyto_nucl(13),cyto(7.5)	RASPGARSPEGPRKRARKPR (520-539, prob:0.957)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q274	Uncharacterized protein	Medium	13.8	2	22-49, 84-104	YKEVPAPRTRKAKPRTPRSPVKERYSDS, APMLSKRRPVAPPRRAPVRRY	mito(8),nucl(5.5),cyto_nucl(5.5),plas(5),cyto(4.5),pero(2)	PRTRKAKPRTPRS (28-40, prob:0.809),RRPVAPPRR (90-98, prob:0.649)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B6	Lysophospholipase	Medium	10.2	1	794-832	RIRATVRAVYERKRRRREERERKEKTAEWRRQVRKGVAG	mito(17),nucl(6),cyto(4)	ERKRRRREERERKEKTAEWRRQVRK (804-828, prob:0.988)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4G7	ANK_REP_REGION domain-containing protein	Medium	11.5	1	507-526	PIYRWGPDFVKKQRRERREE	nucl(17),cyto(5),mito(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8F7	Ribosomal_L7Ae domain-containing protein	Medium	14.5	1	7-61	VEVVDDKKLKKEKKSKDKSEKKEKKRSESDGIRKEKKDKKKDKARQDKLARALDA	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	KKLKKEKKSKDKSEKKEKKRSESDGIRKEKKDKKKDKARQD (13-53, prob:0.998),KKIYKLIKKGAKLKSIHR (106-123, prob:0.803)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q972	Signal recognition particle subunit SRP72	Medium	12.5	1	582-643	GAGKGKQQAQPAKKRRKRKLPKSYDPDKKPDPERWLPLRDRSSYRPKGKKGKKRAAEATQGG	cyto(12),cyto_nucl(11.5),nucl(9),mito(3)	RGKKRSREDGAEEEGAGKGKQQAQPAKKRRKRKLPKSYDPDKKPDPERWLPLRDRSSYRPKGKKGKKRA (568-636, prob:0.999),KAPAPGGGGGKKKKKGKK (664-681, prob:0.997)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBY5	WHIM1 domain-containing protein	Medium	14.7	2	46-66, 295-319	ALEPKEKTPARPKREPSPPHE, EATEEKRRRREYRQMRKEQFRRPEP	nucl(18),cyto_nucl(13.5),cyto(7)	EKRRRREYRQMRKEQFR (299-315, prob:0.834)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC53	Urb2 domain-containing protein (Fragment)	Medium	12.7	2	127-152, 695-719	DAPSPGSPANPRKRKRPDTVGFHAAS, SIGRCLSKVHKRSNRRSRDKLPVDD	plas(11),nucl(8.5),cyto_nucl(6),mito(3),cyto(2.5)	RKRK (138-141, prob:0.659)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFS2	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	Medium	12.9	2	624-653, 786-808	TLASWKPSRRGNFHRKRRRYARIRHIVDST, AEGKVAAKGKFKRRKVDSETATP	extr(9),cyto(6.5),cyto_nucl(5),mito(3),plas(3),nucl(2.5)	PSRRGNFHRKRRRYAR (630-645, prob:0.893),KPAEGKVAAKGKFKRRK (784-800, prob:0.885)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q442	RING-type domain-containing protein	Medium	12.2	1	1-24	MENMPRPYRRRREKKLMPIDEVNE	nucl(16),cyto_nucl(11),mito(7),cyto(4)	RRR (10-12, prob:0.619)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7I0	Uncharacterized protein	Medium	13.1	1	109-130	LPDPQSDKARKRRSSRTAAFST	nucl(21),cyto(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBV6	Diadenosine tetraphosphate synthetase	Medium	10.9	1	128-155	GQKVEEKEEDPKKKKKKSKGHEAVKLDD	cyto(13.5),cyto_nucl(12.5),nucl(10.5)	KEARGQKVEEKEEDPKKKKKKSKG (124-147, prob:0.986)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD66	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.8	2	2-47, 52-75	VYCGKPSKGCSNCRERKIRCDQKEPGCGQCEKRRQRCPGYRNLVDL, ESSHVIKKAKARARKRANLATSPP	nucl(7),mito(7),mito_nucl(7),plas(6),cyto_nucl(6),cyto_mito(6)	KKAKARARKR (58-67, prob:0.845)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDF8	Zn(2)-C6 fungal-type domain-containing protein	Medium	11	2	7-60, 62-84	DTEPTRRRLRRGTSSCHECRRRKVRCDFDPGSAGSCTPCRRRRLECVPQLKQAF, YDVSTTSRYRKVRQRLVRLEALV	nucl(13.5),cyto_nucl(8.5),plas(5),mito(4),cyto(2.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF65	Casein kinase II subunit beta	Medium	13.6	1	297-324	ESMTHSRRPPTARRRRPGGNPALRQRQG	nucl(15),cysk(7),cyto(5)	RPPTARRRRPGG (304-315, prob:0.801)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFQ9	Uncharacterized protein	Medium	13.8	1	535-554	LKNLAEKVRLRNDRPKSKTQ	nucl(23),cyto(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHH0	tRNA (guanine-N(7)-)-methyltransferase	Medium	14.1	2	1-24, 26-46	MGGDKIKKDRRQKREAYRAAMREE, ISELPRKKFYRQRAHANPFSD	nucl(14.5),cyto_nucl(10),cyto(4.5),mito(3),plas(3)	KKDRRQKRE (7-15, prob:0.731)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPQ6	PAPA-1 domain-containing protein	Medium	11.2	1	470-490	ETINKLLKKQAPKTNRKTAAL	nucl(11.5),mito(11),cyto_nucl(9.5),cyto(4.5)	KRARGG (148-153, prob:0.638)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZN9	Uncharacterized protein	Medium	11.6	1	340-359	KYDREMIRKRERRDNKEASR	nucl(12.5),mito(10),cyto_nucl(8.5),cyto(3.5)	AARRKFEEREREKEEKYDREMIRKRERRDNKEASRIEKGEAPSRPSMHRRK (325-375, prob:0.962)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q047	Uncharacterized protein	Medium	12.7	1	67-93	AVEPRTDRQRRGPKRQRTSPTRPAGNT	nucl(18.5),cyto_nucl(13),cyto(4.5),mito(3)	RQRRGPKRQRT (74-84, prob:0.777)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0E4	Uncharacterized protein	Medium	10.9	1	545-569	MDGTLGGGKRRKRKLKSSIRVLGDG	mito(12),nucl(10),cyto_nucl(8),cyto(4)	GKRRKRKLKS (552-561, prob:0.924)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0L5	Uncharacterized protein	Medium	11.6	1	3-65	LTPIKVKGKAGPRKTWKPPTDRTRKAKRRRDEEDEKEGGEDGSDRPPRRRFKARKPAEPIEEL	nucl(13.5),cyto_nucl(10.5),mito(7),cyto(6.5)	KVKGKAGPRKTWKPPTDRTRKAKRRRDEEDEKEGGEDGSDRPPRRRFKARKP (7-58, prob:0.992)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6E7	PHD-type domain-containing protein	Medium	13.7	1	454-477	SDPDFPYMCPKKKCKPHNGWSAIL	nucl(21.5),cyto_nucl(13),cyto(3.5)	KKKKGTAAAVKGPSKRGRPGGAKKTKGGGTKKAK (95-128, prob:0.996)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7E8	Ribos_L4_asso_C domain-containing protein	Medium	11.1	2	188-213, 304-324	SKKLRAGKGKLRGRRHRQRRGPLVVY, KGEARTKRSAVQKKNPLVNKQ	cyto(11),mito(9),pero(4),nucl(3)	KVKASKKLRAGKGKLRGRRHRQRRG (184-208, prob:0.995)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA22	BAR domain-containing protein	Medium	12.5	1	418-442	TGVKKAPPPPPPSRAKKPSLPVPAR	nucl(18),cyto_nucl(14),cyto(8)	KKAPPPPPPSRAKKP (421-435, prob:0.795)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAI5	Uncharacterized protein	Medium	12	2	1632-1651, 1863-1925	KSAATKTKKKEKTVTPSNIR, IEDLPKKSSKAKQEPKQQQHEQAPPRKEARQEPKQESKKETKEEPKQEPKKENKKGPEEESKQ	cyto(12),cysk(7),cyto_mito(7),cyto_pero(7)	PSKSPTKPPNKSAATKTKKKE (1622-1642, prob:0.82),KSSKAKQEPKQQQHEQAPPRKEARQEPKQESKKETKEEPKQEPKKENKKGPEEESKQAEKSRR (1869-1931, prob:0.979)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBH8	Uncharacterized protein	Medium	13.5	1	504-528	GLRPSGRRKSEEERKRVQKKSSSHW	nucl(13),cyto_nucl(10.5),cyto(6),mito(4),pero(4)	REREKAEREKAERAEQKRIKKMLEEEEKERRRREA (338-372, prob:0.947),PSGRRKSEEERKRVQKK (507-523, prob:0.826)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC82	54S ribosomal protein L31, mitochondrial	Medium	10	2	17-42, 77-103	WKIPWRLSPTQKARQRKRLRAVDQVV, KYTMFDRKAKRYRKGIHKLPKWTRVSQ	mito(24.5),cyto_mito(13)	RKAKRYRKGIHKLPK (83-97, prob:0.807)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QER0	Uncharacterized protein	Medium	13.3	2	1-25, 31-51	MPSHKTFRVKQKLAKAQKQNRPIPQ, TGNTIRYNAKRRHWRKTRLGL	nucl(16),mito_nucl(11.333),cyto_nucl(10.833),mito(5.5),cyto(4.5)	KRRHWRK (40-46, prob:0.696)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLG9	Uncharacterized protein	Medium	10	1	276-297	LLVRQQRKKAARRKGSRSTREG	extr(15),mito(4),cyto(4),cyto_mito(4)	RKKAARRKGSR (282-292, prob:0.886),RRQRGPARPAGPAGSAKHARKPS (308-330, prob:0.846)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM15	Uncharacterized protein	Medium	12.4	1	324-353	SESQLLGPKRRRHHARKRKRSAEPESRTLR	nucl(16.5),cyto_nucl(11.5),cyto(5.5),pero(4)	PKRRRHHARKRKRSA (331-345, prob:0.986)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPT7	HECT domain-containing protein	Medium	13.6	2	68-89, 673-701	DEDLHPRRHQAPSRPRHTRSVS, LGSRQTQRSKKQQDKKKKKVVYRVDWRIK	nucl(9),plas(6),cyto_nucl(6),mito(4)	SKKQQDKKKKK (681-691, prob:0.81)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZH9	Heat shock-like protein	Medium	11.2	1	43-63	APAPRRPSARRSRPQPSTFNP	nucl(16),mito(6),cyto(4)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q558	FHA domain-containing protein	Medium	14	1	49-72	DGWSNPPGRKRPSTKGQWSNGKAD	nucl(15),mito(7),cyto(3)	RDEEDKKREAERRARSASRGMRRR (621-644, prob:0.927)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6G8	Uncharacterized protein	Medium	13	1	833-859	STVSQQPQKKQQPLKRGQRGKAKKIAT	cyto(16),cyto_nucl(11.166),cyto_mito(10.666),mito_nucl(5.166),nucl(5),mito(4)	QPLKRGQRGKAKKI (844-857, prob:0.854),RAKREAEAAAAAERRRQAQERAKKR (892-916, prob:0.823),KKGKAIKE (988-995, prob:0.686),GGKGGGKGGGGGGGQKGQKGKGGKKK (1060-1085, prob:0.993)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Y9	Uncharacterized protein	Medium	13.7	1	258-286	QMRDREERERNWKRFRKDIEKRTNSRLPF	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	KRFRK (270-274, prob:0.636)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8D0	Fungal transcriptional regulatory-like protein	Medium	11.8	1	17-48	SNEPRESMNCKSCRKRKIKCNRLRPACEACQV	nucl(19),mito(3),cyto(3),cyto_mito(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8M6	Uncharacterized protein	Medium	13.4	1	12-78	DDEPAPPSRDDRRERRDRKDRKDRKRDRSRSRDRSTSPRRHKSRRHDGDESPRRRSRSPRGDRDGGS	nucl(21.5),cyto_nucl(13.5),cyto(4.5)	DRRERRDRKDRKDRKRDRSRSRDRSTSPRRHKSRRHDGDESPRRRSRSPRGDRDGG (22-77, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9S6	Uncharacterized protein	Medium	10.9	2	200-219, 263-292	KNSNKNHKTRVDRKGKGKTV, QHQQQQRPEQHHRQQQHRPQPRPQQQPYLL	nucl(15),cyto_nucl(11),mito(7),cyto(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFU6	Uncharacterized protein	Medium	14.1	2	81-101, 394-421	GEVTLRPRKNARRSRLDRIIS, LIEPPSRRARGRSRSRRRERDDAGPTRS	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(3),pero(3)	SRRARGRSRSRRRERDDAGPTRSPIRGRS (399-427, prob:0.97)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH94	HECT domain-containing protein	Medium	14.3	2	40-88, 1571-1591	IPPTPTPAPSGRKRKNHTSPPQVAIESPSSTRRSKRQRVTQALPHPQPS, SKEFCKKKLKLWRDNDPNGHD	nucl(15),mito(11),cyto_nucl(9)	RRRKGK (99-104, prob:0.677)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL20	Uncharacterized protein	Medium	13.8	1	83-107	HSRVPTASTLRHQRRRRKKRKRANI	nucl(20.5),cyto_nucl(12),mito(3)	RHQRRRRKKRKRAN (93-106, prob:0.994)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM19	Uncharacterized protein	Medium	13.1	2	1-22, 30-54	MDLTEKWKRHLRQSSRVPKDTN, RREGSRSRSVSPPKRSKARLAANPS	nucl(9.5),cyto_nucl(7),plas(6),mito(5),cyto(3.5)	GSRSRSVSPPKRSKA (33-47, prob:0.739)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP15	Uncharacterized protein	Medium	13.8	2	78-100, 866-887	FDGPNKPAFKRNKRSSGRGDSVS, NERVLQGKAPRRRAWRQSEVSV	cyto(12.5),nucl(12),cyto_mito(7.5)	RARPFKRVK (674-682, prob:0.66)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPF1	Uncharacterized protein	Medium	13.8	1	9-33	PPAPVESKSAKKKAKAERTESPAPA	nucl(14),cyto_nucl(13),cyto(10)	AKKKAK (18-23, prob:0.696),RNRGHREGGGYRGRGGYRGRGGYRGEGRGRGRGGQRGGLPSRPRRGG (397-443, prob:0.988)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8E3	DNA replication licensing factor MCM2	Medium	14.9	2	12-32, 158-179	ANRGIPPSRAGRKRARTNGDD, IDLTAQPRRRRHRYDEDPDEDM	nucl(16.5),cyto_nucl(10.5),mito(7)	AGRKR (21-25, prob:0.638)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8H8	Uncharacterized protein	Medium	10.8	1	269-348	GVVEVEGRRKKKKKTRPGKKRRIVLRKREKIRREKEAEAERLRMSKEEHLREKKKRLNREKKLKRRQKEREKKMAARAAG	mito(11),nucl(9.5),cyto_nucl(8),cyto(5.5)	GRRKKKKKTRPGKKRRIVLRKREKIRREKEAEAERLRMSKEEHLREKKKRLNREKKLKRRQKEREKKMAAR (275-345, prob:1)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAH8	PH domain-containing protein	Medium	10	1	15-40	SPYHVGVLLKRRRKKGQGYARRFFSL	mito(12),cyto_nucl(7),nucl(6.5),cyto(6.5)	KRRRKKG (24-30, prob:0.774)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB72	Uncharacterized protein	Medium	12.3	1	351-372	ELERATKKPPPKKTKISILTSS	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(3)	KPPPK (358-362, prob:0.61)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEH2	Uncharacterized protein	Medium	10.4	1	1-24	MVRESQKRKQRKRGPWAQVTEHES	mito(13),nucl(7.5),cyto_nucl(6.5),cyto(4.5)	RKQRKR (8-13, prob:0.667)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHJ5	Protein kinase domain-containing protein	Medium	12.3	1	522-543	FGFLRGKKGRGNSPKPKERGVL	cyto_nucl(10.833),nucl(9.5),cyto(9),cyto_mito(7.499),mito(4.5)	RRQKPR (322-327, prob:0.634),RGKKGRGNSPKPKERGVLGK (526-545, prob:0.909)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI24	MI domain-containing protein	Medium	12.9	1	27-58	GQKRGARRVSVTSRKERRKAERQQSRAHRTAA	nucl(10),cyto_nucl(10),cyto(8),mito(6)	APKPGQKRGARRVSVTSRKERRKAERQQSRAHRTAAGRNPRPER (23-66, prob:0.987),KRKRKA (221-226, prob:0.729)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q031	Zinc finger C2H2-like protein	Medium	11.4	1	394-415	GDCEKRFSRKDALKRHRLVKGC	nucl(26),cyto_nucl(14.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q747	Uncharacterized protein	Medium	11.1	1	589-612	DTVERKKAAKKAKKEAQKAEREAA	mito(11),nucl(10.5),cyto_nucl(8),cyto(4.5)	RKKAAKKAKKEAQKAEREAAEKAAKQDPNKKSA (593-625, prob:0.987)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHI6	Glycoside hydrolase family 5 protein	Medium	12.8	2	3-64, 129-167	RDPPSATRRSRSRHPDPDPDPDRDGYREQRRHRRHSSSAADGSQHQRRTKRRPTSTPRAGVA, EAERERERELRRERRREREREQERERARRRERSRGYEIV	plas(10),nucl(8.5),cyto_nucl(5.5),mito(5),cyto(1.5)	ARGGGGGRRGERERARGRERQGIAREAEAERERERELRRERRREREREQERERARRRERSR (102-162, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJY3	CRAL-TRIO domain-containing protein	Medium	12	1	53-72	EDGKKEKKGRMSFFSRKSKK	cyto_nucl(10),cyto(9.5),nucl(7.5),pero(6),mito(4)	KKEKKGRMS (56-64, prob:0.721),SRK (67-69, prob:0.618)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK20	Ras-GAP domain-containing protein (Fragment)	Medium	12	1	739-770	RSEAGRPPRNAKRQPGRPRPRVRPVQRAQGVG	mito(15),nucl(10)	RPARARSEAGRPPRNAKRQPGRPRPRVRP (734-762, prob:0.987)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q408	SUZ domain-containing protein	Medium	12.6	1	195-219	RDQDNSRQDRRQQNNQRQNNQQQNN	nucl(16.5),cyto_nucl(11.5),cyto(5.5),pero(2)	GRQGHRGRGRGRGGRGR (179-195, prob:0.898)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q536	Carbohydrate-binding module family 50 protein	Medium	14.2	1	113-133	RDEEKEKKKKEEEERKRREEE	nucl(24),cyto_nucl(14.5)	EKEKKKKEEEERKRREEEERRRKEEEKHHRPQH (116-148, prob:0.993)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X2	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.6	1	1033-1060	TTGPPPPPPPQQQQQQQQHQQHQQPQQG	nucl(15),mito(5),cyto(4),plas(1),pero(1),golg(1)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q678	Uncharacterized protein	Medium	11.3	1	215-262	AEEKAKAKRAREKRKAQQKRRDEEREREKDRIRRERRKFWPRVCYTVR	nucl(13.5),cyto_nucl(11.833),cyto(9),cyto_mito(6.833)	REKARLEKLQAREEKKAAEEKAKAKRAREKRKAQQKRRDEEREREKDRIRRERRK (198-252, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6C7	Uncharacterized protein	Medium	13.4	1	193-223	WEGYGQRKKDKKLEAERRKREKERAEKEAKA	nucl(20.5),cyto_nucl(13),cyto(4.5)	RKKDKKLEAERRKREKERAEKEAKAARKRNTARLSKAPPPR (199-239, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7J8	Endonuclease III homolog	Medium	10	2	74-98, 158-179	ITTTVSHTLKRKRKRTDTVTQSASR, ESETKDRPRGRARKPVRKTTDA	mito(13.5),cyto_mito(13),cyto(11.5)	RPRGRARKPVR (164-174, prob:0.805)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8B4	Uncharacterized protein	Medium	12.8	1	155-182	GDSTEDGTRRRGRRRRRRIDDETRRLLG	nucl(19),cyto_nucl(14),cyto(7)	RRRGRRRRRR (163-172, prob:0.953)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDN3	Uncharacterized protein	Medium	13.9	2	25-46, 72-99	RDVAQGRVTKREKKPPGRIGGG, TDRPSRDAPGKKKKKEEKKRNGKKAGVP	mito(12),cyto(8.5),cyto_nucl(8),nucl(6.5)	REKKPP (35-40, prob:0.668),SRDAPGKKKKKEEKKRNGKKA (76-96, prob:0.997)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGQ1	PseudoU_synth_1 domain-containing protein	Medium	13.6	2	35-57, 60-80	RGNRGGRERGNDKQKRKHSGFGS, GPVPDKRERVQNDRNAKRRKV	nucl(13.5),cyto_nucl(12),cyto(9.5),mito(2)	RGNRGGRERGNDKQKRKHSGFGSAKGPVPDKRERVQNDRNAKRRK (35-79, prob:0.965)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZK1	Uncharacterized protein	Medium	13.7	2	47-72, 1033-1057	SSSPAARVSARKRRNAKSLQNELPSA, GLDKPSKLGPQRQKRKRQESAVDGG	nucl(14.5),cyto_nucl(12),cyto(8.5),mito(2),pero(2)	RQKRK (1044-1048, prob:0.649)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3C5	Exonuclease domain-containing protein	Medium	10.6	1	61-85	WQTIERGRPVKKHKKVPGPGSSRYP	cyto(15),nucl(8),pero(4),mito_nucl(4)	GRPVKKHKKVP (67-77, prob:0.803)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q432	Uncharacterized protein	Medium	12	2	203-228, 269-292	SGPTITLQNKPKKRKKPVHTPTPADD, NTRGRRLGASRRDRAKNRDKESSI	extr(17),plas(5),mito(2),pero(2)	KPKKRKK (212-218, prob:0.826),RGRRLGASRRDRAKNR (271-286, prob:0.791)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q614	Uncharacterized protein	Medium	14.1	2	13-37, 226-247	LHSFLHGFRRHRNSRQHRSDSSEPL, GLAPAPPPRPRPRPRPRTYDGG	nucl(14.5),cyto_nucl(9.5),mito(8),cyto(3.5)	PPRPRPRPRP (232-241, prob:0.781)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Z1	Glycosyltransferase family 41 protein	Medium	10.6	1	1328-1350	LTWDEEQRRRWKMRKDLFPNLPD	nucl(14),cyto(6),mito(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8F9	Uncharacterized protein	Medium	12.3	1	540-606	KDLLRDWKQLKRQQKRARRQLRRERKQQRRQEKRERRQARREQKRAAKEMRREARRRPPPPPPPPPP	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(3)	WKQLKRQQKRARRQLRRERKQQRRQEKRERRQARREQKRAAKEMRREARRRPPPPPPPPPP (546-606, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBQ3	SANT domain-containing protein	Medium	14.5	2	128-149, 227-249	CRMFKGKTRKHIKLKFNREERV, DGEGNKKGGRKGRRKKGPVVMGL	nucl(18),cyto_nucl(14),cyto(8)	NKKGGRKGRRKKG (231-243, prob:0.98)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCA1	Uncharacterized protein	Medium	11	1	76-103	EKQLNRARVLRERKKAKEQQALEEKRRK	mito(16),nucl(8),cyto(3)	GPRLSKAEQRRIEREEQERIRRELEREKQLNRARVLRERKKAKEQQALEEKRRK (50-103, prob:0.967)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDI8	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.7	1	199-221	LACIACRRKKIRCSGEKPACKHC	nucl(8.5),plas(8),cyto_nucl(7),cyto(4.5),mito(4)	GKERK (191-195, prob:0.625)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEA8	Zn(2)-C6 fungal-type domain-containing protein	Medium	11	1	49-79	GKPCSSQTPAPARKRKRPRTTRVAELERRLE	mito(11.5),nucl(10),cyto_mito(8),cyto(3.5)	ARKRKRPR (60-67, prob:0.859)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGZ4	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.2	1	6-34	RRVALACTYCRHRKRRCDAGRPSCRSCIE	nucl(16),plas(7),mito(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH29	Uncharacterized protein	Medium	11.5	1	173-198	SLLRRLSGPPSRKKRNVPKGGWGLRV	nucl(13.5),cyto_nucl(12),cyto(9.5),mito(1),pero(1),golg(1),cysk(1)	RRLSGPPSRKKRNVPKGG (176-193, prob:0.874)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJL3	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.4	1	1-41	MASERRSERVEQRRRRKIPLACEPCRERKSRCDGAKPICST	nucl(14),mito(6),cyto(4),plas(2)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKM5	Uncharacterized protein	Medium	10.3	1	1-24	MSRNVRQKYPPKPVRAPKSRDYDS	nucl(19),cyto_nucl(12),mito(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPC8	Uncharacterized protein	Medium	11.6	2	34-59, 258-294	VQTANLSMKEKKKRMKQDPYGWAQAQ, LEGPKGHKDKNNKRSLRRLCHKRQRLLRYLERKERGS	mito(19.5),cyto_mito(11),nucl(6)	KGHKDKNNKRSLRRLCHKRQR (262-282, prob:0.808)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4E8	YL1_C domain-containing protein	Medium	11.3	1	23-49	HSIHKTFRNPHWRPNQRRNKNVKAILG	nucl(25),cyto_nucl(14.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4V5	Uncharacterized protein	Medium	11.5	1	441-470	ESSPHSSKAAEKKKNKKKKRKADRLAADTA	nucl(16.5),cyto_nucl(12.833),mito_nucl(10.166),cyto(7)	SKAAEKKKNKKKKRKAD (447-463, prob:0.997)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q621	Nascent polypeptide-associated complex subunit beta	Medium	11.9	1	16-37	RIGGKGTPRRKVKRAPARSAGD	nucl(19.5),cyto_nucl(13.833),mito_nucl(11.166),cyto(6)	KKLGASARIGGKGTPRRKVKRAPARSA (9-35, prob:0.977)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAW2	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.8	1	3-56	GPGGGPPRRSHTKSRKGCDTCKRRHIRCDENFPQCRNCTKHKIRCPYNDVPVPE	nucl(23),mito(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF30	Protein kinase domain-containing protein	Medium	13.4	2	198-221, 423-451	GDGGCGRKRRWRRVRGRKEAEKDW, FDDLWFRRQNQIRLRKRRRRAEEEEEADE	mito(13),cyto(7),nucl(4),cyto_pero(4)	RKRRWRRVRGRKE (204-216, prob:0.935),LRKRRRR (436-442, prob:0.782)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJH7	Ubiquitin-like domain-containing protein	Medium	11.1	1	71-109	LRLRGGAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKVD	cyto_nucl(15),nucl(13),cyto(9),mito(5)	LRGGAKKRKKKVYTTPKKIKHKRKKTK (73-99, prob:0.995)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMF9	SWIRM domain-containing protein	Medium	13.3	1	217-240	AVRVQKPRSPKTKPQQPRPIRATP	nucl(20.5),cyto_nucl(14),cyto(4.5)	KPRSPKTKPQ (222-231, prob:0.679)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP45	Uncharacterized protein	Medium	12.6	2	13-35, 63-85	NQANLPKGIRPRKGNRLHPTTPS, DNPEPDPDPKRQRTSPRPTKDAF	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPT8	Uncharacterized protein	Medium	11.9	1	184-205	LGIFLWRKRKQRRDAEEQRRKE	nucl(13.5),cyto_nucl(10),cyto(5.5),plas(4),golg(2)	RK (192-193, prob:0.615)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ41	WD_REPEATS_REGION domain-containing protein	Medium	11.1	1	702-730	IPLTSAPSSKKKSKKQSRASGSRNKPDDE	mito(12),nucl(8),cyto(6)	KKKSKKQSRAS (711-721, prob:0.828)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q062	F-box domain-containing protein	Medium	12.6	1	150-170	EEERKRWRKVVNRRHEPPPNP	nucl(17.5),cyto_nucl(13),cyto(7.5)	WRRIQERAAREEEERKRWRKVVNRRHE (139-165, prob:0.885)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAH4	TPR_REGION domain-containing protein	Medium	11.1	1	98-123	WKEVDDRMARRRQKQREAREKAEREE	mito(13),nucl(9.5),cyto_nucl(6),pero(2)	RRRQKQREAREKA (107-119, prob:0.749)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB93	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit	Medium	10.9	1	7-32	RVLSRGKDSSKSSKKNKDSKDGTASP	nucl(16),mito(6),cyto(5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFX9	DDHD domain-containing protein	Medium	14.7	1	923-942	EEERKAQKLKREEAKVRALN	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	KKSKEEKRPSTPEGSRSTSKERDGKLSGAFKRR (335-367, prob:0.784),KRKPKR (514-519, prob:0.682)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J6	Uncharacterized protein	Medium	10.8	1	551-577	GRKGPAASKRSGRPKKTERGQQKLTFG	cyto(12.5),cyto_nucl(12),nucl(10.5),pero(3)	GRKGPAASKRSGRPKKTER (551-569, prob:0.943)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8R3	Uncharacterized protein	Medium	14.9	2	19-44, 353-372	NGHTAAREAKCKKCKKVFDICQVNYH, KEAAKGKGEEKKEKEKPRKK	nucl(17.5),cyto_nucl(11),mito(4),cyto(3.5)	KGAQGKAEKKGKEAAKGKGEEKKEKEKPRKK (342-372, prob:0.998)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBI1	Phosphodiesterase	Medium	12.6	1	870-895	PADPGARQLKKKPSRFRINGLQNLFR	nucl(12),mito(11),cyto(3)	KKKP (879-882, prob:0.647)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCG2	N-acetyltransferase domain-containing protein	Medium	14.2	2	39-58, 591-613	DSQRKLKPPSQPHSHVRNEL, PDNSPVYKKGPNRQRQYFKVYLN	nucl(14.5),cyto_nucl(9.5),pero(4),cyto(3.5),extr(3)	RRRVRGQKGGG (179-189, prob:0.686)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEW2	Uncharacterized protein	Medium	11.7	1	10-35	LEYYRDLGRHSRKKRGRGIVPQPTVP	mito(11.5),cyto_mito(10),cyto(7.5),nucl(6)	SRKKRGR (20-26, prob:0.736),RRGRKKRE (1038-1045, prob:0.81)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFE0	Uncharacterized protein	Medium	13.8	1	118-143	VSLFSSTRRRRTRPPHHHHRSSRSGP	nucl(21.5),cyto_nucl(12.5),mito(3)	RRRRTRPPHHHHRSSRSGP (125-143, prob:0.816)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGR7	MYND-type zinc finger protein samB	Medium	13	3	54-79, 1154-1183, 1335-1364	GLTRRSKSAVRYRKWLKGRKGDCSSL, LPLDPAPRPRPPHRPPRLRRAPAHARHHAR, AKCLKVKYCGRTCQRADWKRHKKECIAKHS	extr(11),mito(7),plas(5),cyto(2)	PRPRPPHRPPRLRRAPAHARHHARAGTPRLPGGRRGPARRGGGIHHGRCGRAKA (1160-1213, prob:0.995)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI01	AAA domain-containing protein	Medium	12	1	429-448	TSPVGRRRKNHRPRLSSSPS	nucl(13.5),cyto_nucl(10),cyto(5.5),mito(5)	RRRKNHR (434-440, prob:0.708)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL41	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.1	1	118-142	QLGCEYIRERKKRGKASRKDLAQQA	mito(8),cyto(7),mito_nucl(7),nucl(6)	ERKKRGKASRK (126-136, prob:0.857)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPS7	BHLH domain-containing protein	Medium	14.2	1	375-396	GTPSDPTQTKRQRKSGTGKSGA	nucl(23),cyto_nucl(14)	KRQRKSGTGKSGAGRKKSPR (384-403, prob:0.906)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q251	Uncharacterized protein	Medium	10.8	1	110-131	DQTDDEKSKKRKREALEEADPK	cyto(15.5),cyto_nucl(14),nucl(11.5)	KRK (119-121, prob:0.624)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q292	Uncharacterized protein	Medium	10.7	1	41-61	TQFSIFVRKHHCRKCGRVVCN	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q309	Uncharacterized protein	Medium	11.5	1	533-571	FLYFFRKRERRMRLYSRFSQVIRRQRKPGHSNPRKNGGG	mito(9),plas(8),nucl(4),extr(2),cyto_nucl(2),vacu(2)	RR (542-543, prob:0.606),IRRQRKPGHSNPRKNGG (554-570, prob:0.831)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Y9	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.7	1	69-112	HIKHRRTRSGCYTCRSRRVKCDEARPICERCRKGKRECNYPEPP	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	RRK (60-62, prob:0.63)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q631	Uncharacterized protein	Medium	14.3	2	135-155, 978-1003	DDLKCKKCLGHPSKRRKMLTM, QGDEITPRRPSKRRKMAAEDQPLREN	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(1),plas(1),pero(1),golg(1),cysk(1)	RPSKRR (986-991, prob:0.653)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD28	Uncharacterized protein	Medium	13.1	2	37-61, 72-104	QPADEPHKGKEKKKKKEPLVASSPK, AEEREERKKREKEEKKREKERAREERRRETKGK	nucl(11),cyto_nucl(10.5),cyto(8),mito(6)	HKGKEKKKKKEPLVASSPKADRAQERARMAEEREERKKREKEEKKREKERAREERRRETKGKRG (43-106, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFJ5	Uncharacterized protein	Medium	13	1	499-522	SDEEDARPRKRQNRRTRAVAPSDE	nucl(20.5),cyto_nucl(14),cyto(6.5)	ARRLKRS (456-462, prob:0.672)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK18	Uncharacterized protein	Medium	10.8	1	53-75	ALKASECRRKRTGRGLKITREAV	nucl(21.5),cyto_nucl(12.5),mito(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0H0	PNPLA domain-containing protein	Medium	14.5	2	886-909, 1298-1333	GLDRRRARERRAKAHPRRRAKSEE, NAEYREYNRRKLRAREEERNKKKRNGMKQPAAAARA	cyto(9),nucl(7),cysk(6),cyto_pero(6)	RRRARERRAKAHPRRRAKSEELAR (889-912, prob:0.992),RRKLRAREEERNKKKRNGMKQP (1306-1327, prob:0.967)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3W0	Uncharacterized protein	Medium	12.5	2	134-159, 241-265	TGSVYVRRRRSRSRRRYSRRRGSVAG, IEEHSPPRRRRSSRVRSAERRLSGY	extr(13),mito(7),cyto(3.5),cyto_nucl(3),nucl(1.5)	RRRRSRSRRRYSRRR (140-154, prob:0.949),RRRRSSRVR (248-256, prob:0.729)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q475	Uncharacterized protein	Medium	13	1	13-35	PPPPQRSPWPWSGRKRRNSESSL	nucl(19.5),cyto_nucl(14),cyto(5.5)	KRPPEPPSATSGARKGKETDEERKPSMGAAAPRSGAGKKDSKSE (61-104, prob:0.812)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6S1	Uncharacterized protein	Medium	12	1	418-452	ETEDRRGHGKRHRRRLPRRKHRKHRHRHISESPEA	plas(20),E.R.(4),mito(1),cyto(1),golg(1),cyto_mito(1)	R (364-364, prob:0.603),HRRR (367-370, prob:0.627),RRGHGKRHRRRLPRRKHRKHRHR (422-444, prob:0.999)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q749	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.5	1	296-319	KEIKRRTKTGCLTCRKRRIKCDEA	nucl(26.5),cyto_nucl(14)	GRHKKEIKRR (292-301, prob:0.774)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC66	Uncharacterized protein	Medium	10.2	1	84-108	SSAAGQLTKRRRRVTRRGKSPAASR	mito(7),nucl(6),cyto(4),plas(4),extr(3),pero(1),E.R.(1),vacu(1)	KRRRRVTRRGKSPAASR (92-108, prob:0.916)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEK1	Mitochondrial distribution and morphology protein 34	Medium	12.6	1	352-376	GSGRHSKAGRKKKTRVVNLRRKAAT	nucl(17.5),cyto_nucl(13),cyto(7.5)	RHSKAGRKKKTRVVNLRRK (355-373, prob:0.929)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV0	Piwi domain-containing protein	Medium	12.8	1	197-218	ESASKKAKGKPKQASGQQPNAP	cyto_nucl(11),nucl(10.5),cyto(10.5),pero(5)	GGGRGGGRGGRGGQAGEGFRGGGGRGGYPGGGRGGGDGYRGGRGGGGGEFRGGRGGRGDFRGGRGGGGRGGRG (10-82, prob:0.968),KKAKGKPKQASGQQPNAPKDAREAKGKK (201-228, prob:0.885)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIL3	Uncharacterized protein	Medium	12.5	1	280-310	GVSDVNRGDKKRKRQNKQQQQQQQQQQQQQE	nucl(17.5),cyto_nucl(14),cyto(7.5)	GDKKRKR (287-293, prob:0.748)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJM3	Nucleolar protein 58	Medium	11.4	1	449-517	DEKVDHPPAKEKKEKKEKKDKEEKKDKEGKKEKKDKKRKSVGGEDVEMADVNGDGEKKKKKKRKSAAAE	cyto(19.5),cyto_nucl(13),nucl(5.5)	PAKEKKEKKEKKDKEEKKDKEGKKEKKDKKRKS (456-488, prob:0.999),EKKKKKKRKSAA (504-515, prob:0.987)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPS5	Uncharacterized protein	Medium	11.2	1	320-345	TGGGIRKRGSKRREKKRRWVWTIGQD	mito(17),nucl(8)	GIRKRGSKRREKKRR (323-337, prob:0.987)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q203	Uncharacterized protein	Medium	10.5	2	13-38, 140-159	PEIPPARPGRPRFHRRCTEDRIREGS, QRPWYSRLPRVRRPRIKSVS	nucl(12.5),cyto_nucl(10),cyto(6.5),plas(4),mito(3)	
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q555	Uncharacterized protein	Medium	12.7	1	74-96	DRHPIFGKKPKRRKDLQDLCHCI	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	KKPKRRK (81-87, prob:0.764)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5T8	Uncharacterized protein	Medium	10.7	1	62-84	SVASDRREAKQKKKTLQEQRTAL	extr(10),nucl(8),mito(4),cyto(4),cyto_mito(4)	EKGGRG (135-140, prob:0.631)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF25	SET domain-containing protein (Fragment)	Medium	14	1	181-204	NNSNSNSNEKKKKRPNAEFRTAWD	nucl(15),cyto(6),mito(4)	KK (192-193, prob:0.613)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFT0	Uncharacterized protein	Medium	13.1	1	23-47	EDPIESPPDRERRRRITPTRTAGDT	nucl(18.5),cyto_nucl(12.5),cyto(5.5)	GKRRK (473-477, prob:0.687)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHG5	DNA-(apurinic or apyrimidinic site) lyase	Medium	10.2	1	328-350	EDAMPKSKKRKAEKDEIPAKRSR	mito_nucl(9.833),nucl(9.5),mito(9),cyto_mito(8.333),cyto(6.5)	EKPKKVVRAKDAIAEDAMPKSKKRKAEKDEIPAKRSRATPKK (314-355, prob:0.986)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKY5	Uncharacterized protein	Medium	10.5	1	38-60	PLSSCKPEQRRIKDAKRRAKLEL	mito(18),nucl(9),cyto_mito(9)	RIKDAKRRAK (48-57, prob:0.71)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNF5	Uncharacterized protein	Medium	10.8	1	7-33	DNSSIDRATRRRIRRRAAEGRNAGRKL	mito(13),nucl(9.5),cyto_nucl(7.5),cyto(4.5)	TRRRIRRRAAEGRNAGRKLSRPSRK (15-39, prob:0.977)
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPV9	DUF2293 domain-containing protein	Medium	13.2	1	11-34	PGAGDHAKERHKRDRRGNLIDWTA	nucl(11.5),cyto_nucl(9),mito(6),cyto(5.5),pero(4)	KRHAPGPGAGDHAKERHKRDRR (5-26, prob:0.836),PQKIKKPTREDKRAAKW (315-331, prob:0.807)