ProteomeAccession ScentificName ProteinAccession ProteinName Category ConfidenceScore #NoLS Positions SegmentSeqs PSORT NLS UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1I9 SMP-LTD domain-containing protein Low 6.2 1 841-866 TERRPVPPPPLPKRRQPQPEQDGEDN extr(13),cyto_nucl(4),nucl(3.5),cyto(3.5),pero(2),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q232 Glycosyltransferase family 32 protein Low 8 1 407-426 LFSGSWRGDKKEKKKRRSQD extr(9),mito(6),cyto(4.5),cyto_nucl(3),E.R.(2),golg(2),vacu(2) GDKKEKKKRRS (414-424, prob:0.927) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q690 Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial Low 5 1 10-30 AYVCRSCTQTLQRRLRRAYSS mito(26) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q795 Uncharacterized protein Low 5 1 94-115 LLKGWRQFIQHKRKNHLRSLNS mito(24.5),cyto_mito(14) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7H3 Tryptophanyl-tRNA synthetase Low 9.9 1 450-485 GKLTKNQLKKLEKQKQIEAKKAQKAKEKAEKAEKAG cyto(14),cyto_nucl(11.5),nucl(7),pero(4) KKLEKQKQIEAKKAQKAKEKAEKAEK (458-483, prob:0.928) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8N9 Sphingolipid delta(4)-desaturase Low 5 1 354-373 DQVGLRCRVKRKQGGRVVGG mito(9),plas(8),cyto(6),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9I3 Vps54 domain-containing protein Low 6.5 1 168-187 APAPRRSSSRPRRGQTHGPP mito(19),nucl(4),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QA78 Histone acetyltransferase Low 8.8 1 401-426 APDSRSSKAVKRKTKRRLSGPVVPRA mito(19),cyto(4),nucl(2) RSSKAVKRKTKRRLSGPVVPRAPK (405-428, prob:0.944) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCE6 RRM_2 domain-containing protein Low 9.6 1 590-614 PNAGQHFREEQRRRRSQYDRGTRLA nucl(17),cyto_nucl(13),cyto(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEX2 Uncharacterized protein Low 7.2 1 45-68 SPASPSKESQPPPKRLKRAYSESS mito(15.5),mito_nucl(13.333),nucl(10),cyto_nucl(6.333) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QF92 Mitochondrial genome maintenance protein MGM101 Low 5 1 296-316 WVEHVVSKKRRQIWTRKDGEP mito(21),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGS8 Glycoside hydrolase family 2 protein Low 5 1 722-742 GKSAGRQKRGRGQYRFRWDDV extr(27) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIE0 Uncharacterized protein Low 6.7 1 1-22 MTREADRKPKRRFWLLTSPRTA mito(11.5),cyto_mito(9.833),cyto_nucl(7.833),nucl(7.5),cyto(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QK67 DUF155 domain-containing protein Low 6.8 1 76-97 TASQASQKRRKLPLKNSLHRVA mito(12),cyto(6.5),cyto_nucl(6.5),nucl(5.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMI0 Thioredox_DsbH domain-containing protein Low 9.1 1 522-543 REKLRAHREKERPRPPRDEKIV mito(12.5),cyto_mito(10),cyto(6.5),nucl(4),extr(2),pero(2) EKLRAHREKERPRPPR (523-538, prob:0.823) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN61 Protein kinase domain-containing protein Low 7.6 1 537-556 SFFSHLRKRARRFSGRHQTP mito(10),nucl(8.5),cyto_nucl(7),cyto(4.5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2PZI5 Uncharacterized protein Low 5.5 1 36-56 DTPTYQRMLHKARRRRNFSEL cyto(13.5),cyto_nucl(8),cysk(6),mito(4),nucl(1.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q025 40S ribosomal protein S4 Low 5 1 1-20 MGRGPKKHQKRLSAPSHWLL mito(18),cyto(5.5),cyto_nucl(4),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0H4 Protein phosphatase Low 8 1 43-63 NPYHRVQPPKARRGKASRPES mito(16),cyto(7),pero(4) RRG (54-56, prob:0.617) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4Q7 Uncharacterized protein Low 5 1 442-467 SSDARHDANRKHRPHRRHFSVDNFSV plas(15),extr(8),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6V1 PPPDE domain-containing protein Low 8 1 1-20 MPTRKHQKKSSRSHRSTLSL mito(25) RRRGGSGKGKGKAPVR (226-241, prob:0.878) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHF7 Mitochondrial Rho GTPase Low 8.8 1 399-426 STTAALKVTKPRKRRRRPGRVERNVVLC cyto(7.5),cyto_nucl(5.5),mito(5),plas(4),nucl(2.5),extr(2),pero(2),E.R.(2) TKPRKRRRRPGR (407-418, prob:0.971) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QK63 VanZ domain-containing protein Low 8 1 110-130 LCSWYHKRMLERKRRRKYAAV extr(15),plas(6),E.R.(2),vacu(2) ERKRRRK (120-126, prob:0.755) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QM52 Uncharacterized protein Low 5 1 511-535 KIAPTDRLSKRKRAERIQPLYNKYA cysk(23),cyto(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMS8 Alcohol oxidase Low 5 1 19-38 AEPQHAKRTPKCRCTPGEAC extr(21),cyto(3.5),cyto_nucl(2.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q014 EGF-like domain-containing protein Low 8.1 1 69-92 RPPGGNTQPPQRPRRPSRVPSILD nucl(9),plas(8),mito(4),cyto(4),cyto_mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0C8 DJ-1_PfpI domain-containing protein Low 8.8 1 195-222 RVRVPSRRLSCTKEKKKKEKREERRKEK cyto(14.5),cyto_nucl(9),mito(4),plas(3),nucl(2.5) KEKKKKEKREERRKEK (207-222, prob:0.994) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q117 Uncharacterized protein Low 8 1 30-50 GAVHKRVKRVRSMSRGRRRAM extr(21),mito(3),cyto(1),plas(1),E.R.(1) KRVKRVRSMSRGRRR (34-48, prob:0.798) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q176 SET domain-containing protein Low 5 1 105-130 PYGPWCCASKKLRKHHVRTREQQVRR cyto_mito(9.332),mito(9),cyto(9),cyto_nucl(8.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1U1 Uncharacterized protein Low 9.4 1 129-148 VWRNKVKKVFRGKRDKARFE mito(16),cyto(5.5),cyto_nucl(5.5),nucl(4.5) KVKKVFRGKRDKARF (133-147, prob:0.824) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q285 Uncharacterized protein Low 5 1 186-205 SEGRRKFPYVRPPPECRKFR extr(9),mito(5),golg(4),plas(3),E.R.(3),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3U4 Uncharacterized protein Low 6.1 1 70-91 ACVDVQHKKRGRPRLRDDGQAR extr(13),mito(8),nucl(3),cyto(1),pero(1),golg(1),cyto_pero(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7T4 CN hydrolase domain-containing protein Low 8 1 123-146 IEEEENKKKKKKKDEKTYYNTSLT mito(15),cyto(10) KKKKKKK (129-135, prob:0.918) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBH9 Uncharacterized protein Low 5 1 15-36 VSLVRLKKGKKRFEIACYKNKV mito(22.5),cyto_mito(13.5),cyto(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKM7 Kinesin motor domain-containing protein Low 9.1 1 912-935 SSAGGGKSRKVRKLPGKRWNAVGD mito(20),cyto(4),nucl(3) GGGKSRKVRKLPGKR (915-929, prob:0.86) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNR6 Uncharacterized protein Low 8.7 1 1317-1338 GPAPEKTEKKGRKKKAAAAAAA extr(13),mito(5),golg(3),nucl(2),cyto(2),cyto_nucl(2) APEKTEKKGRKKKAA (1319-1333, prob:0.959) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2Q8 Peroxidase Low 5 1 272-293 DEKWQWKKWNGPKQYEDKKTKS mito(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAG8 Protein-lysine N-methyltransferase EFM6 Low 7.7 1 186-205 TIFFCFKKRRRADMQFLKAA cyto(12),nucl(7),cysk(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAK6 Uncharacterized protein Low 8.4 1 234-258 HLDNERPRDRKKRDRFEEELRRQTS nucl(12),cyto_nucl(9.5),cyto(5),pero(5),mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QD68 J domain-containing protein Low 6.1 1 57-79 DTVDSLRKQERRKDRKIWLLFAV plas(12),cyto(5.5),cyto_nucl(5),nucl(3.5),E.R.(2),extr(1),pero(1),golg(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFV2 MFS domain-containing protein Low 5 1 470-489 YLLWRDKKRAREKEAAIPQS plas(26) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLP4 CDP-diacylglycerol synthase Low 5 1 503-529 TSGFRRTWRYLREKIDKYRQGRRAEKE mito(23),cyto(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0Z9 Uncharacterized protein Low 7.8 1 405-425 ATPVPKKSRKRALLDQARKQL nucl(9.5),cyto_nucl(7),plas(5),cyto(3.5),mito(3),extr(3),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1W4 Uncharacterized protein Low 8.5 1 14-56 SRSPEEQFRVVRKRNRVPLSCYPCRTRKKCDRSHPCGNCTKRE plas(10),nucl(9),mito(3),cyto(2),golg(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4X1 Beta-lactamase domain-containing protein Low 6.7 1 77-98 LVEHRDDKNKNNNNNNNNNNNN cyto(11.5),cyto_nucl(9),mito(7),nucl(5.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6E5 Lipase, GDSL-like protein Low 5 1 351-370 YDGVTKKTSRTGKRAKPFVH extr(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6M5 RING-CH-type domain-containing protein Low 8.5 1 494-522 ALYTKYRRVQVRAKRRVRNVERRTGSRST mito(10),extr(4),cyto(3.5),plas(3),cyto_nucl(3),pero(3),nucl(1.5) KRR (507-509, prob:0.616) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q702 Uncharacterized protein Low 9.4 1 554-573 SGKILRRLLRDKEREARRAK cyto(14),cyto_nucl(10.5),nucl(5),mito(4),pero(2) PSGKILRRLLRDKEREARRAKGAKL (553-577, prob:0.938) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q719 AB hydrolase-1 domain-containing protein Low 8.4 1 53-79 FNKLTSPAQKRAERRRRSISTTIRNAS cyto(7),extr(7),plas(6),pero(2),E.R.(2),nucl(1),mito(1),vacu(1),mito_nucl(1) RGPK (123-126, prob:0.615) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7V4 Uncharacterized protein Low 5.8 1 16-41 LPSHPTYQGRRQQQQQQQQQQQQQGK cyto(13.5),cyto_nucl(8.5),mito(8),nucl(2.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QE91 Uncharacterized protein Low 7 1 472-492 AARLITGRKHRWHRDKFLAQS extr(8),cyto(7.5),cyto_nucl(7.5),nucl(6.5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QF36 Uncharacterized protein Low 9.4 1 797-819 SVSGDGAGTKKKNRRKKRKGGKS mito(5),plas(5),extr(5),nucl(4),cyto_mito(4),cyto(3),E.R.(3) TKKKNRRKKRKGGKS (805-819, prob:0.998) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGM7 Uncharacterized protein Low 8.7 1 33-52 HAPSNKTRTKPRGPGLFSRT nucl(17.5),cyto_nucl(12.833),mito_nucl(10.666),cyto(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QL23 Uncharacterized protein Low 6.9 1 301-322 VDWARRVERHVRSRRAGKGRFI mito(12),cyto(7.5),cyto_nucl(7.5),nucl(6.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLI9 Uncharacterized protein Low 8.8 1 52-75 GCGRRMRADNRKRHLKTCKGMRYE mito(13),nucl(10),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN70 Glycosyltransferase family 34 protein Low 5 1 3-23 FALPPRKTSRPPPYLPRTSRL plas(11),mito(10),golg(2),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1I1 Dolichyl-phosphate-mannose--protein mannosyltransferase Low 8 1 521-544 IVSLPPDHKRREKPERKVKTLPFL plas(25) KRREKPERKV (529-538, prob:0.75) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4A6 PPR_long domain-containing protein Low 8 1 85-106 APQARPPKRVPAEKKPQPPPAL mito(13),extr(9),cyto(4) QARPPKRVPAEKKP (87-100, prob:0.783) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q721 G domain-containing protein Low 8 1 380-406 ALSMNQARKKDKQARKARNEAKRLGIS mito(20),cyto(6) RKKDKQARKARNEAK (387-401, prob:0.826) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAU5 Uncharacterized protein Low 9.4 1 2-28 GDDELSRHPRNRRTKTRANDRRTLPGS nucl(12),cyto(8),mito(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QC95 Tyrosinase_Cu-bd domain-containing protein Low 5 1 16-37 AWANPMHKRWKPNAPRNPDFPL extr(17),mito(7),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QDM7 Peptidase A1 domain-containing protein Low 8.1 1 7-27 GSQKRSFKINCTRNPTFKRFD mito(12),nucl(8),pero(4),cyto(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QK76 CRAL-TRIO domain-containing protein Low 9.3 1 289-313 REEQWARPAKWEKKKKEAEAAAKNE cyto(12.5),cyto_nucl(9),pero(6),nucl(4.5),mito(2) PAKWEKKKKEA (296-306, prob:0.81) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKJ4 Uncharacterized protein Low 6.5 1 62-82 STPEKKRPPLIPPQDHRRLRQ cyto(8.5),cyto_nucl(7),mito(6),plas(5),nucl(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN77 Uncharacterized protein Low 8 1 268-291 VFVVVLRRRRTKRRQRDRGMGSGE extr(22),plas(3) RRRRTKRRQRD (274-284, prob:0.838) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNB1 Uncharacterized protein Low 9.6 1 642-667 LETSSSREKKKAGKRVRTRDEDDKSL mito(13),cyto(8),nucl(4) EKKKAGKRVR (649-658, prob:0.802) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNX4 Uncharacterized protein Low 5 1 18-41 ELSRSESRERRTRQRSARPRLMTG extr(11),mito(4),cyto(4),E.R.(4),cyto_mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4H9 Uncharacterized protein Low 6.5 1 410-429 QALARWKSLRERRVQAQRAS mito(7),cyto(6.5),cyto_nucl(6),nucl(4.5),plas(4),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5B4 Uncharacterized protein Low 8.4 1 173-195 EAESRFLSKRKRRVSRDTQPVEE extr(12),mito(8),cyto(3),nucl(1),plas(1),pero(1),E.R.(1) RRKVVRAGKGK (129-139, prob:0.71) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6H9 Mediator complex subunit 12 Low 6.8 1 37-64 QQSQPQPQPQPQQQQQQQQQQQQQQQQQ mito(11),nucl(5),plas(4),cyto(2),pero(2),E.R.(2),cyto_pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q943 Uncharacterized protein Low 7 2 69-91, 530-550 EPAAEQRRRSPPKHDPWWNIHLF, LTPPGHPLRRRQKGVRRAAVW plas(27) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QE02 FAD_binding_3 domain-containing protein Low 8.3 1 149-173 LAEFKDKGEVRRRRRQQFHEGIENT nucl(13.5),cyto_nucl(11.333),cyto(8),cyto_pero(5.333),mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFF3 MFS sugar transporter-like protein Low 5 1 480-504 VFDSGRPAWKKYKKSSKLEELAREI plas(21),E.R.(3),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKZ7 Uncharacterized protein Low 9 1 35-59 SLTHPVSPPLKKRRRAQSLEETEPA nucl(14.5),cyto_nucl(11),cyto(6.5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNR2 Uncharacterized protein Low 8 1 1-26 MPRSSQGTPRPRPRKPPMTRRASSNA plas(27) RPRPRKPPM (10-18, prob:0.739) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0M7 Uncharacterized protein Low 5.6 1 220-240 SSSSPKPSHGRGERRQRTNSV mito(20.5),cyto_mito(11.5),nucl(2),extr(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q145 Uncharacterized protein Low 5 1 209-230 KGWTSSKRSKWLKDHKGPYTAF plas(24),mito(1),pero(1),E.R.(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBR3 Uncharacterized protein Low 5 1 7-28 STPAGRALRRLSRPNRRLPVFS mito(12),extr(8),E.R.(3),plas(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBS5 Zn(2)-C6 fungal-type domain-containing protein Low 6.6 1 6-29 SQACNACRVRKVRCSRTQPCTQCA mito(19),nucl(4),cyto(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCA5 Fungal_trans domain-containing protein Low 8.9 2 4-30, 455-479 QCVPAALVPRQRRRRFPERELLERIRQ, MLLEHCFRRRRRQHQQQQQQQQQQL mito(10),cyto(7),nucl(5),extr(2),golg(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJF7 Uncharacterized protein Low 8.6 1 12-34 NYDTHHRTPRSRRRSQFHSQATC nucl(17),mito_nucl(12.833),cyto_nucl(10.333),mito(7.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJG3 HET domain-containing protein Low 7 1 1-23 MRRFFRRHRKTSAKNDDLQQKQR mito(20),nucl(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLS1 Glycosyltransferase family 32 protein Low 9.1 1 405-441 AEEEQRRKAEEEKKKKQKEEEKKKKEAEEAERKKKEE mito(16),cyto_mito(10.833),cyto_nucl(4.666),nucl(4.5),cyto(3.5) KQKEKEEEEKKRKAEEEQRRKAEEEKKKKQKEEEKKKKEAEEAERKKKEEEEASKEKEKEK (392-452, prob:0.999) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPM4 Uncharacterized protein Low 5 1 222-243 GARSWRTAARRHSRSRTAKEGC mito(13),extr(8),cyto(5.5),cyto_nucl(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1P2 Glycosyltransferase family 90 protein Low 8 1 64-91 DERAPLRARRSNLPKKPRRYFLPALVFC plas(21),vacu(3),extr(1),pero(1),E.R.(1) ARRSNLPKKPR (71-81, prob:0.687) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6A5 Uncharacterized protein Low 8 1 70-98 ASKRAGKKLQLGKFKKKDRIAEKGRPPLP mito(24.5),cyto_mito(13.5) PASKRAGKKLQLGKFKKKDRIAEKGRPPLPGERKAYRKR (69-107, prob:0.995) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q922 Yippee domain-containing protein Low 8 1 290-312 GVWDPKVVARRRKSKSGNARRWW mito(8),extr(7),cyto_mito(7),cyto(6) RRRKSKSGNARR (299-310, prob:0.819) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9Z0 Uncharacterized protein Low 6.7 1 43-67 KAVTQACHTCRRNKAKVCRESHCDG plas(14),nucl(5),mito(5),mito_nucl(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBA8 Uncharacterized protein Low 8 1 948-975 DVLARAKSSRKERKLKRARSPVKGSYGT plas(23),extr(2),E.R.(2) LRRRRSFADVLARAKSSRKERKLKRARSP (940-968, prob:0.981) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QH16 Uncharacterized protein Low 7.6 1 571-594 ELQNKPEQAGHRNKKRRVSDPESD cyto(11.5),cyto_nucl(11),nucl(9.5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKH6 Non-specific serine/threonine protein kinase Low 8 1 732-754 AEPVKKKKGHRGRRGGVKHRKGG extr(11),plas(6),mito(4),cyto(2),vacu(2) VKKKKGHRGRRGGVKHRKGGNKDKR (735-759, prob:0.997) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QM05 Uncharacterized protein Low 5 1 41-67 SDGNPLPVTKRRQKKNARERDDDCGNR plas(21),extr(2),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMQ1 Aa_trans domain-containing protein Low 8 1 441-467 AARSRGGRGGRWRRKWRWDLEHLETGL plas(24),mito(1),E.R.(1),golg(1) RSRGGRGGRWRRKW (443-456, prob:0.862) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNW7 Uncharacterized protein Low 6.1 1 4-23 EERVLRLRKQKRMWFEKMMR mito(20),cyto_nucl(4),nucl(3.5),cyto(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0D1 E3 ubiquitin-protein ligase Low 7.2 1 1993-2013 IEECTRRKCPTKGKDLTEPAI cyto(9.5),cyto_nucl(9),nucl(7.5),mito(3),plas(3),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0I4 Uncharacterized protein Low 8 1 231-262 DRFGSRARAAWRRKKAEKQQRLKTQRKQEGAT extr(26) GGSRRIRLDRFGSRARAAWRRKKAEKQQRLKTQRK (223-257, prob:0.982) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2Z8 Six-hairpin glycosidase-like protein Low 9.1 1 111-135 HTDGKDEKIKQKLRRRREENAWVDD extr(13),nucl(3),cyto(3),cyto_nucl(3),pero(3),cyto_pero(3) KLRR (122-125, prob:0.617) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4W1 Protein kinase domain-containing protein Low 9.2 1 74-93 PGLPRTQTFKRQRSEVRSRL nucl(15.5),cyto_nucl(12.5),cyto(8.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7A0 Uncharacterized protein Low 5.5 1 69-94 DDDGQHQHRHHHHRHQQPSDRRPVLP cyto(19),cyto_nucl(11.5),mito(4),nucl(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8L9 Uncharacterized protein (Fragment) Low 5.8 1 39-60 KSRREDERFRRQQHQQHQQREE mito(9),extr(8),plas(3),E.R.(3),nucl(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAA3 Chalcone_isomerase domain-containing protein Low 5 1 22-45 VVVPRRSIFSRRNDRRRSSRAVEN mito(22),cyto(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAR2 Uncharacterized protein Low 9.1 1 594-613 PGYHMKCKMRQANRVMRQYQ nucl(13.5),mito(11),cyto_nucl(8.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QB70 Uncharacterized protein Low 8 1 627-647 VYYWRVRGRGRGRGRVGKREL plas(25) RGRGRGRGRVGKRELGGREEGRRPWWKFWQRR (633-664, prob:0.976) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QD27 Uncharacterized protein Low 5 1 33-57 PYFSRTPTRKCLSRKQRHTSHGHTW mito(8),extr(7),plas(5),cyto(4),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QG51 Uncharacterized protein Low 8 1 115-147 NKTSAKGKATTTKKKKKQPKKPERFTRMKNDAG mito(21.5),cyto_mito(12.5),cyto(2.5) NKTSAKGKATTTKKKKKQPKKPERF (115-139, prob:0.992) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJ44 Polyketide synthase Low 5 1 1936-1957 GLLSPTKTRNPPKTQPNWQTET cyto(12),mito(7),cyto_pero(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJG7 Uncharacterized protein Low 8.8 1 380-400 GVINRLKTRVNKRRICNRFHL nucl(14.5),cyto_nucl(12.5),cyto(7.5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLB6 Uncharacterized protein Low 8 1 332-356 FVVVGMRSWKRRRRREEPDEMALRP plas(25) KRRRRR (341-346, prob:0.728) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2PZX5 Trimethylguanosine synthase Low 9.9 1 167-198 DEENKETRSNKKNKKKKKAKKHRGLDPSLRLD cyto(21),nucl(5) RSNKKNKKKKKAKKHRG (174-190, prob:0.998) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3W6 4HBT domain-containing protein Low 8.3 1 26-58 QEQKRSKQRQSAPIAQRCQKKKKQPAHSGLEDH nucl(12.5),cyto_nucl(12),cyto(10.5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7P7 Uncharacterized protein Low 8.2 1 4-47 YDRRGGGSSYNPKKRRYRDDDDYDRRGPRRRYDAPPHVRVRKQL nucl(11),cyto_nucl(9),cyto(5),plas(4),mito(3),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAC5 Uncharacterized protein Low 5.7 1 1-20 MDFRRGARGRRYPRPEFYRC mito(22),nucl(2),cyto(2),cyto_nucl(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFJ3 MCU domain-containing protein Low 8 1 468-496 RDEEFTEQERKKKRRRVHKRGQAEGRASV mito(20.5),cyto_mito(12.5),cyto(3.5) RKKKRRRVHKRGQ (477-489, prob:0.982) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHD2 CCT-epsilon Low 6.1 1 19-42 RPFIVVRDQGKKKRQHGNEAVKSH cyto(21.5),cyto_nucl(13.5),nucl(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QI79 Glycosyltransferase family 90 protein Low 8 1 83-103 AAAYRKRRGRHPPPGFDQWYQ plas(7),golg(7),extr(5),mito(3),E.R.(3) RKRRGRH (87-93, prob:0.723) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QID2 Chloroperoxidase Low 8 1 238-261 GSNSTSGSQKHRRRLPRRRAHFGF extr(11),golg(5),plas(4),E.R.(4),vacu(2) KHRRRLPRRRA (247-257, prob:0.824) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNP9 Uncharacterized protein Low 9.1 1 160-179 EFSCPFRKRNPVRFNVRDFQ nucl(16),cyto_nucl(12.5),cyto(7),mito(2),extr(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNT3 Peptide hydrolase Low 8 1 469-490 GLPRVDGKKRRWDAHRARMLKR extr(20),cyto(4),mito(3) KKRRWDAHRARMLK (476-489, prob:0.733) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPS4 PNP_UDP_1 domain-containing protein Low 9 1 167-190 NVNEALKKIKRRNKYTRPPPESDR cyto(16.5),cyto_nucl(10.5),mito(6),nucl(3.5) IKRR (175-178, prob:0.634) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q269 Uncharacterized protein Low 5 1 956-976 GQVKAKRPTRWQSFKEPLRLM plas(24),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3E6 Uncharacterized protein Low 8.1 1 1270-1290 RTWKGGRKVRVDEKVVRPRRF mito(14),nucl(9),cyto(2),pero(2),cyto_pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q494 Uncharacterized protein Low 5 1 537-561 VKFVKAWLKEWKEKEKCRGRKFCWP extr(22),vacu(2),cyto(1),E.R.(1),golg(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5K0 Uncharacterized protein Low 5 1 31-50 VERSKSSSWWCWRQRWQSAP plas(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q863 N-acetyltransferase domain-containing protein Low 7.2 1 158-180 DAYDMRKPMKRDVKRQHVRDDGE cyto(8.5),cyto_nucl(8.5),nucl(7.5),mito(6),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBW3 Peptidase A1 domain-containing protein Low 8 1 34-63 LEMQRRAPRNPLHRDKRRRKRGTLEVGLDN extr(21),plas(3),E.R.(2) RRAPRNPLHRDKRRRKR (38-54, prob:0.953) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCE5 SUN domain-containing protein Low 5 1 137-157 QDPANIRSHRQREHRERDPSM extr(20),pero(3),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCN0 Uncharacterized protein Low 6.5 1 33-53 EVFGQKQDGKRRKRTELAVAI cyto(12.5),cyto_nucl(9.5),mito(8),nucl(5.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QE70 Protein kinase domain-containing protein Low 9.5 1 638-664 RWSNNRDRAKECPRHKGRDRDWNWNFD nucl(16.5),cyto_nucl(12.5),cyto(7.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1Q8 Uncharacterized protein Low 8 1 105-127 AEKEWRSRRARRLAAQRERREIR plas(15),extr(6),cyto(2),mito(1),cyto_nucl(1),pero(1),E.R.(1),vacu(1) WRSRRARRLAAQRERREIR (109-127, prob:0.845) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q448 Uncharacterized protein Low 5.8 1 44-70 TAVAAQQQQQKQKQKQKQRALWDQIVR cyto(7.5),mito(7),extr(7),cyto_nucl(6.5),nucl(2.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q550 Uncharacterized protein Low 5 1 103-131 TIEATPVSKRNHNRERKRPNQTTKLSVKD extr(17),mito(8) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q643 ATPase, P-type cation-transporter Low 8 1 237-260 IAASTNKKRRKAGRSMNWRKYGKT plas(22),E.R.(3) NKKRRKAGRSMNWRKYGK (242-259, prob:0.914) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q755 MFS domain-containing protein Low 7.3 2 37-56, 524-548 GEPLPKKRFWFQKTRPYDPD, LVKAYYVFRNKQRDKKWNAMTPEER plas(22),nucl(1),mito(1),cyto(1),cyto_nucl(1),E.R.(1),vacu(1),cyto_mito(1),mito_nucl(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7Q7 Uncharacterized protein Low 5 1 57-78 LSEEEKKQFRPWKRAADRKYQL mito(26) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8N4 Uncharacterized protein Low 5.4 1 39-62 IKSAYRQLSKKYHPDKNPNDPTAH extr(15),golg(3),cyto(2),plas(2),E.R.(2),nucl(1),mito(1),pero(1),mito_nucl(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCN2 Uncharacterized protein Low 9.7 1 956-978 GDLGILAKPKRRKRNILGRAISN cyto(10.5),cyto_nucl(9.333),mito_nucl(7.833),mito(7.5),nucl(7) KPKRRKR (963-969, prob:0.807) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEN3 Uncharacterized protein Low 8.8 1 30-52 DDTATAILKKKKKPNQLMVTDAV nucl(14.5),cyto_nucl(13),cyto(10.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QET7 Phosphotransferase Low 5 1 73-98 EAGGLKRFSRKLKRQFKERLWSNTEC mito(14),extr(9),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHC4 Uncharacterized protein Low 6.1 1 11-30 TSFKRHFRSRPGTRQNLGRG mito(24),nucl(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJF3 PDCD2_C domain-containing protein Low 6.6 1 17-46 THERRLYVFACKRKSCRRKDGNIRAIRGIR cysk(16),cyto(5),nucl(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLE3 DHO_dh domain-containing protein Low 7 2 12-36, 599-619 RRQIEGLRKLRQRRLHSTNKDSART, VDEAKKTPRKVKPRVMVKVSP mito(22),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QM45 MFS domain-containing protein Low 5 1 16-36 TRIAQADKKPWYKKPNLRFLY plas(23),E.R.(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2PZQ2 Uncharacterized protein (Fragment) Low 9.4 1 628-648 RAVVRDRERRLQNKQDKTVYM nucl(12),pero(7),cyto(5),mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q023 RNA-dependent RNA polymerase Low 7.5 1 36-57 SSIERPRQRHHEQGPLRRRPGP cyto(9.5),cyto_nucl(9.5),nucl(8.5),pero(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1H9 Uncharacterized protein Low 9.4 1 196-219 GPCFDTQSPRKSKKKSSLENLESE mito(14),cyto_nucl(5),nucl(4.5),cyto(4.5),extr(4) KR (238-239, prob:0.611) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4L9 Glycoside hydrolase family 2 protein Low 5 1 41-62 GTNPWPQHPRPQLRRDAWKTLN extr(14),E.R.(4),golg(4),mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4P1 Uncharacterized protein Low 9.2 2 1-23, 29-48 MLTKPNLTHRYRPQPPKSFHDLY, QRFYVLSRVRRGKRRPLATS mito(17),nucl(6),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4Z8 Glycosyltransferase family 20 protein Low 5 1 25-44 GSASEKKQPKPVKLETQPSL mito(12),cyto(7),extr(4),cyto_pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7K0 GP-PDE domain-containing protein Low 9.4 1 355-375 LWYPLNTRGRPKKGRGAGQLG cyto(8.5),plas(8),cyto_nucl(7),nucl(4.5),mito(4) RPKKG (364-368, prob:0.649) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q865 Uncharacterized protein Low 6.7 1 1-20 MTAQRRPRFRKVQSFRTDYA mito(16),nucl(5.5),cyto_nucl(5.5),cyto(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBW4 Uncharacterized protein Low 6 1 284-305 GTYCVWDVRKRQRLRSFPKLAG cyto(13.5),cyto_mito(10.666),cyto_nucl(10.166),cyto_pero(7.666),mito(6.5),nucl(5.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QG21 Uncharacterized protein Low 7 2 1-22, 210-231 MSRVAKRSTKRSVKTKERIALA, LGVFRCWFKKRNMKNIRLWAHR mito(22),cyto(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPE2 tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase Low 5 1 1-22 MPPPNKIGRPPKQKQNALQAAI mito(22.5),cyto_mito(13.833),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5J7 zf-3CxxC domain-containing protein Low 6.6 1 1-21 MVPTAKRYKPKAQRYEETTAM mito(16),nucl(5),cyto(5),cyto_nucl(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5U2 Clathrin heavy chain Low 7.6 1 1519-1540 AANIYRKNKRWEKSINLSKQDK cyto_nucl(13.333),cyto(11.5),nucl(11),cyto_mito(6.832) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q995 40S ribosomal protein S24 Low 9.9 1 99-129 LAAKVEKASRQQRKQRKNRQKTLRGTAKVKG cyto(10.5),mito(9),cyto_nucl(9),nucl(6.5) VEKASRQQRKQRKNRQKTLRGTAKVKGAKSKKEK (103-136, prob:0.99) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9N5 Uncharacterized protein Low 8.8 1 52-74 FEQHASKSRRKSCRSPSPMRTLE nucl(14.5),cyto_nucl(11),cyto(6.5),mito(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBJ7 Uncharacterized protein Low 6.2 1 1324-1346 TNQVTARRLRRVRQRMGAYRHDL mito(10),cyto(7),nucl(3),extr(3),plas(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKN8 Flavodoxin-like domain-containing protein Low 6.9 1 1240-1262 LVQRDYGDRKNRKHARLKYTIDD cyto_nucl(8.333),cyto(8),nucl(7.5),cyto_mito(6.333),extr(5),mito(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QP42 Uncharacterized protein (Fragment) Low 8 1 491-514 RTSSCPSRWNRTRHMVQVKFKQGA nucl(10.5),cyto_nucl(8.5),mito(7),cyto(5.5),plas(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q386 MFS domain-containing protein Low 5 1 20-40 GTQNNPPRAHQQKRNSQSPVA plas(22),mito(2),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3Y0 Uncharacterized protein Low 9.4 1 43-63 TETVRRKIYYRRPGSPRRAAS cyto(19.5),cyto_nucl(13),nucl(5.5) GKEEKEKGKERGR (183-195, prob:0.749) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4U0 Zn(2)-C6 fungal-type domain-containing protein Low 8 1 56-82 CTKHNKPCLYLRPAKRRGPQKGYRTAL extr(12),nucl(8),mito(4),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QB16 Uncharacterized protein Low 5 1 278-301 GCCCTSRRDLRTGRRVIRNGRGVR plas(20),mito(3),E.R.(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QB44 Peptidase_M48 domain-containing protein Low 5 1 40-59 QPSFRPHAPRSQNQQRRFYN plas(20),mito(4),E.R.(2),mito_nucl(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QC62 mRNA-capping enzyme subunit alpha Low 8.1 1 375-401 AKSIKDSWKLRQQQQQQQQQQQQHREH nucl(10.5),cyto_nucl(10),cyto(8.5),mito(3),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QDS8 3-phytase Low 5.8 1 468-489 VDKFTPKNWKEQCRMNRDQPAL mito(11),cyto(8.5),cyto_nucl(6),pero(4),nucl(2.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QL11 Uncharacterized protein Low 5 1 113-134 YGALRALRKLRHQRMQKRLFVL mito(10),cyto(9),extr(4),cysk(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0J4 F-box domain-containing protein Low 7.8 1 150-173 DDRVDQKYRNKHFPKPPPKHVQAA cyto_nucl(10),nucl(9.5),cyto(7.5),mito(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1E5 MAP kinase kinase kinase Low 8.9 1 117-137 TPSNTYQPYTQRRPNQPGTSS nucl(14.5),cyto_nucl(10),cyto(4.5),mito(4),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2H7 Uncharacterized protein Low 6.9 1 38-60 SAEFRRQLRRSQRQQLRAEKSKA mito(8),nucl(5),extr(5),cyto(4),plas(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q806 Uncharacterized protein Low 5 1 597-619 TPAQRRALYRKAQHKSRETIRGA extr(12),cyto(4),mito(3),plas(3),E.R.(3),cyto_pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9G2 Glycogen [starch] synthase Low 7.9 1 493-518 SYMFDFTQKSRRQRINQRNRTERLSD nucl(10),cyto_nucl(10),cyto(8),mito(4),E.R.(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAP9 Uncharacterized protein Low 9 1 236-256 FRARVVRHRARERRKAREQAG cyto(14.5),cyto_nucl(10.5),mito(5),nucl(3.5),pero(2) RVVRHRARERRKAR (239-252, prob:0.886) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPB8 Uncharacterized protein Low 5.4 1 8-29 DLSRARSRSRSPVDSRRLRRLA plas(15),mito(4),cyto(3),pero(2),nucl(1),E.R.(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQG2 Uncharacterized protein Low 9.4 1 585-617 VTVAGRRPRRPRTEARRQREKAARERREREARD cyto(12.5),cyto_nucl(9),mito(5),nucl(4.5),pero(2) GRRPRRPRTEARRQREKAARERRERE (589-614, prob:0.985) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q123 Pyruvate carboxyltransferase-like protein Low 8.4 1 1-28 MPMLKDPSKKYKRFPPLKLPDRQWPDKT nucl(11.5),cyto_nucl(9.5),cyto(6.5),pero(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3P5 Uncharacterized protein Low 6.8 1 11-30 LSKVRSKYGRCDYKRFDNIA mito(8),cyto(7.5),cyto_nucl(7),nucl(5.5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q422 Uncharacterized protein Low 5.3 1 782-806 QEEEARRQQQQQQQQQQQQQQPQQQ extr(16),plas(5),mito_nucl(1),cyto_mito(1),vacu(1),E.R.(1),pero(1),cyto_nucl(1),cyto(1),mito(1),nucl(1),cyto_pero(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7W9 CN hydrolase domain-containing protein Low 6.3 1 652-679 AARPHQGPRQWQRQRQRQPSRLRHVVSR cyto(11),cyto_mito(9.333),cyto_nucl(8.833),mito(6.5),nucl(5.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8X6 ATP-grasp domain-containing protein Low 8.2 1 605-625 LSPCEELKKRRPDLRDRIVVA cyto(14),nucl(8),mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKD4 Uncharacterized protein Low 6.6 1 129-148 YYPSAKPCVKRRHNNSKGGS mito(16),cyto(5),nucl(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLL7 RING-type domain-containing protein Low 9.3 1 110-133 NGQSYPKRSNSLKRKRREDEDEDE nucl(17),cyto_nucl(12.5),cyto(6),mito(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0C7 Glyco_trans_2-like domain-containing protein Low 5 1 346-367 LVYTVSKKVTRRRAKSITADAL cyto(12.5),cyto_nucl(7),cysk(6),mito(4),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q668 Phospholipase Low 7.9 1 321-341 VLRWNHVKRDKYKRNERFEWL cyto_nucl(11),nucl(10.5),cyto(10.5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFK8 C2H2-type domain-containing protein Low 8.4 1 305-330 EKVRYFCDYKKCPRHKAPFFRQDHFR nucl(10),mito(4),plas(3),golg(3),cyto_mito(3),cyto(2),pero(2),cyto_pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGF9 40S ribosomal protein S7 Low 9.8 1 103-130 RILPRPKRSSRSRNTLKQKRPRSRTLTA mito(16.5),mito_nucl(12.999),nucl(8),cyto_nucl(6.833) RRILPRPKRSSRSRNTLKQKRPRS (102-125, prob:0.932) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHN0 PlsC domain-containing protein Low 8 1 738-764 REAMRERGELRRRQREKRRMSLADEDG plas(22),E.R.(3) KIREAMRERGELRRRQREKRR (736-756, prob:0.894) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIB0 Uncharacterized protein Low 5.8 1 66-86 VVPQTPPKKRRIPEKPFRFLD mito(18),cyto(5),nucl(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIF9 Uncharacterized protein Low 9.4 1 3-33 ASPCVSRPGKKNGNSPRVRKRQKPIALTVPG mito(15),cyto(6),nucl(4),cyto_pero(4) GKKNGNSPRVRKRQK (11-25, prob:0.794) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIL5 Fork-head domain-containing protein Low 8.6 1 623-646 GMDRYHHHHHHHHHHPHHHQQQQQ extr(12),nucl(9),mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0M4 MFS domain-containing protein Low 8 1 236-264 AVEENEEKKKKKKKKQSRPAPAQRTNPHF plas(23),mito(2),E.R.(2) KKKKKKKKQSRPA (243-255, prob:0.992) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0S3 Uncharacterized protein Low 8.4 1 51-78 ILAGEGARRRWKRKRDEREQGRKLVRTN mito(8),cyto(4),extr(4),E.R.(4),plas(2),vacu(2),nucl(1),pero(1),golg(1) ARRRWKRKRDEREQGRK (57-73, prob:0.939) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4Q1 Uncharacterized protein Low 6.9 1 322-342 GAQHRCYMKKDLKKAHQADSD plas(9),extr(8),nucl(5),golg(2),mito(1),E.R.(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8G1 Uncharacterized protein Low 8.8 1 16-45 LAVRRQFYPDRHPQRQPPRRQTPGQAQLSS mito(12),nucl(10),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAY3 Ubiquitin carboxyl-terminal hydrolase Low 9.2 1 305-327 RWVDQGRQKMQRRIEERKKSGAG nucl(11),cyto(10),pero(3),cysk(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCS1 Nickel/cobalt efflux system Low 5 1 367-390 GSVLIYRPWRRRMDRRAHRWAAPG plas(20),E.R.(3),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QD76 DUF4484 domain-containing protein Low 7.6 1 602-623 GDRGSSSRRKTGQRRREEEEEE mito(12),cyto(8),nucl(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGR5 Uncharacterized protein Low 5.8 1 105-125 LSLRRRQQLRQRRRDAREYDR extr(11),mito(7),cyto(4),nucl(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHK9 Uncharacterized protein Low 9.6 1 153-176 SLDHPKCIEAKKKNPKCKIVLPHW cyto(13.5),cyto_nucl(10),nucl(5.5),pero(5) KRKRK (459-463, prob:0.696) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QI95 Uncharacterized protein Low 9.6 1 597-620 PPESGPHPSKRPRTPPRAPAQPST cyto(12),cyto_nucl(10),nucl(6),pero(5),mito(4) KGKGKRPAIDPPESGPHPSKRPRTPPR (587-613, prob:0.817) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKC8 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial Low 8 1 73-100 KEQAKALKASGKKKKKNKADNQTVPGWE mito(23),cyto(4) KQLKEQAKALKASGKKKKKNK (70-90, prob:0.975) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKE4 Uncharacterized protein Low 5 1 33-59 WPTPTKWLPHFKSQRPQRDYARRNLKT extr(27) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLS3 Uncharacterized protein Low 8 1 153-182 AAKLQFTKKMPKKVTKERKGRRAMKREAAA mito(22),cyto(3) KKMPKKVTKERKGRRAMKRE (160-179, prob:0.976) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLT6 Uncharacterized protein Low 9.2 1 757-782 GEVRQEKEEKRGRSRKRGGTRDAGLD plas(17),nucl(3.5),cyto_nucl(3),E.R.(2),cyto(1.5),mito(1),pero(1),golg(1) RQEKEEKRGRSRKRGGTR (760-777, prob:0.94) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QP58 Uncharacterized protein Low 6.5 1 349-390 QENVEQPERKEKPKKQQQQQQQQQQQGKKNQKKEPEVPERYK mito(12.5),mito_nucl(9.5),cyto(9),nucl(5.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQB0 PUM-HD domain-containing protein Low 7.1 1 7-26 AANPNRSRGIWNNNNNNNNN nucl(9),cyto_nucl(8.833),mito(7),cyto(6.5),cyto_pero(6.166),pero(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q261 Uncharacterized protein Low 6.4 1 360-379 LCMYDKVQRVKNKWKCILKD cyto(7.5),cyto_nucl(6.5),cysk(6),nucl(4.5),extr(4),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCA0 Uncharacterized protein Low 7 1 9-35 GEDLTRRRRQTNSRYRGPKPQYNRVHA mito(8),cyto(7.5),cyto_nucl(7.5),nucl(6.5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QE32 Uncharacterized protein Low 9.9 1 267-296 EEFRKLLKRTRADRKKAKRSDRNRLKRIEA cyto(12.5),cyto_nucl(10),nucl(6.5),pero(5) RKLLKRTRADRKKAKRSDRNRLKRIEAHKAWGRSIKRV (270-307, prob:0.996) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFJ2 Uncharacterized protein (Fragment) Low 5 1 391-415 IVGQLLWHRDRKKRKYVTQGSDEAE plas(26) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFU4 Uncharacterized protein Low 8 1 59-84 KPENSVSKAARRREKHKNRISFTETS plas(25) ARRREKHK (68-75, prob:0.71) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QH12 Uncharacterized protein Low 7 2 1-22, 367-389 MPKSASTKRFRARERIQPSRAC, DGTVGVRRATRKRRGQEQDDDEY mito(19.5),cyto_mito(12.5),cyto(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHL1 Uncharacterized protein Low 5.9 1 51-74 VLLTSRGPRHRQLRQSHRPRAAAF extr(8),mito(3),plas(3),cyto_nucl(3),E.R.(3),nucl(2.5),cyto(2.5),pero(2),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHP2 MFS domain-containing protein Low 5 1 559-579 AACGLSWKKIQKRRPAPAAAP plas(27) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJE4 MFS domain-containing protein Low 7 2 1-25, 72-95 MYLAYKYAKKRYKERQAREAEQQTP, EDTADDRAEKKRRRTYRLKIILGL plas(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QK14 Uncharacterized protein Low 8.1 1 65-84 AAPFSKPKRRPSTRPCPGRG nucl(11),cyto_nucl(11),cyto(9),mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPG7 SAP domain-containing protein Low 8 1 321-346 MAGAEKRREGKRRGGRRRRQEGVEET mito(19.5),cyto_mito(12.5),cyto(4.5) EKRREGKRRGGRRRR (325-339, prob:0.986) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q162 General substrate transporter Low 8 1 305-333 PETFWDRKPIPRKVKKTRSRPNIFRRISS plas(25) RKPIPRKVKKTRSRPN (311-326, prob:0.888) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7G9 Uncharacterized protein Low 7.7 1 617-646 EEDAYFRKPVNPHRHQNRQRRIRPSDYREL cyto(10.5),nucl(9),cyto_mito(8.5),mito(5.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8K4 Uncharacterized protein Low 7.5 1 326-353 NQHHHGDKRSSNKQHQQQHSQQQQQQQQ mito(12),nucl(8.5),cyto_nucl(8.5),cyto(5.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKZ2 Translocation protein SEC62 Low 8.8 1 327-357 KPVWAWHEPASKKKKKKKSKKSERSASGSAA plas(21),nucl(2),E.R.(2) ASKKKKKKKSKKSER (336-350, prob:0.996) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMH4 TLC domain-containing protein Low 5 1 11-33 GNVVLVRRVKRKNESPMKQLTRW plas(15),mito(6),E.R.(3),vacu(3),cyto_mito(3),mito_nucl(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNA2 Uncharacterized protein Low 5 1 44-73 PLAHHRHHHHHHYHHYHHHHNNNNNNRRPT mito(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1C1 Uncharacterized protein Low 9.1 1 98-125 AYRTYRSTAQWRKTRRARRSRSGGRMDV cyto(15),cyto_nucl(10.333),cyto_mito(9.333),nucl(4.5),cysk(3) RKTRRARRSR (109-118, prob:0.751) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2G6 Chloride channel protein Low 8 1 621-645 DSAGPASPRMRRRRRAEDELPQEER plas(20),E.R.(4),extr(2) RRRR (631-634, prob:0.636) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7V1 Transketolase Low 5 1 44-63 FNRFMRFNPKNPKWLNRDRF cyto(23),cyto_nucl(13.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q918 Uncharacterized protein Low 5 1 509-532 TGPLGPKAKWLDRRKVCQTEKCII extr(18),plas(2),E.R.(2),cyto_mito(1),vacu(1),golg(1),pero(1),cyto(1),mito(1),cyto_pero(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QB63 Uncharacterized protein Low 7.6 1 20-41 LMPPPPPAKRIQRPKRVLDEET mito(10),nucl(9.5),cyto_nucl(9),cyto(7.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QDG6 Uncharacterized protein Low 9.7 1 336-358 RGACWSRRPGNRPRRSRLADQSE nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(2),extr(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QDX1 Uncharacterized protein Low 5 1 478-502 KGYTDRDSRNCRKYQRNQCTNVCAD extr(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEW8 Uncharacterized protein Low 9.2 1 303-324 ESEPGKPKKGKGKEKEVKEVKV extr(8),cyto(7.5),cyto_nucl(6),mito(5),nucl(3.5) GKPKKGKGKEKE (307-318, prob:0.912) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMA5 Uncharacterized protein Low 8.9 1 66-86 YPSNWEKRHGKTPQKSRPPAT nucl(15),cyto_nucl(11.5),mito(6),cyto(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQ53 2-(3-amino-3-carboxypropyl)histidine synthase subunit 1 Low 5 1 21-40 AHENATKQPKKRFVGRRAAV cysk(24),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1U9 Cytochrome c domain-containing protein Low 5 1 294-313 SVWVKRYKWAWLKSRKIVYD mito(19),extr(2),pero(2),cyto(1),plas(1),E.R.(1),golg(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2A5 Uncharacterized protein Low 9.9 1 1591-1620 SISGKLKPLIKRTKPEKKQKIEEELRKIKV mito(11),cyto(6),nucl(5),plas(2),extr(2) KPLIKRTKPEKKQK (1597-1610, prob:0.821) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3M6 Tyrosinase Low 5 1 27-47 YDYGFDVKKRVKRQLGQRSAM extr(22),mito(2),plas(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9S0 Uncharacterized protein Low 8.8 1 44-71 HASGGGGMRKRPKKKRQHKTFRTYDLSQ mito(20.5),mito_nucl(12.333),cyto_nucl(3.333),nucl(3) GGGMRKRPKKKRQHK (48-62, prob:0.975) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QDW8 Uncharacterized protein Low 7.1 1 83-106 NELEREQSRYKNNKSKNNNDNNIQ cyto_nucl(8),nucl(7),cyto(7),mito(6),extr(3),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIX3 Uncharacterized protein Low 9 1 414-433 QMKLWHARRKAERTQWWEAA nucl(13.5),cyto_nucl(9),mito(5),cyto(3.5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2PZJ7 Cytochrome P450 monooxygenase-like protein Low 8 1 171-194 LFMARDKQKHARRRKGYDPRITKA cyto(6),plas(6),extr(6),mito(3),cyto_nucl(3),E.R.(2),golg(2) KQKHARRRK (177-185, prob:0.758) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1W1 F-box domain-containing protein Low 8.8 1 1040-1059 FDDRKRTSSKSKRGESQGRS nucl(12.5),cyto_nucl(8.5),mito(5),cyto(3.5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1Y1 Ubiquitin carboxyl-terminal hydrolase Low 7.8 1 606-635 LSTHSAPAARTKQRKQQSRWWRISDDKIKE mito(8),nucl(7),extr(7),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4X9 Protease Low 5 1 48-71 PPLEHRWHASRPRRGQNNRTVERD extr(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5N5 Uncharacterized protein Low 5 1 16-37 LSPTQICRRLRLKPCARRSASA mito(24.5),mito_nucl(13) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7D1 Uncharacterized protein Low 5 1 556-577 AIPKNPSGKILRKQLRERAQKE mito(12),plas(8),pero(3),E.R.(2),cyto_pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7M4 Uncharacterized protein Low 5 1 262-281 LSPREKWREERVQREKENKV mito(18),cyto(5.5),cyto_nucl(3.5),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8J0 Uncharacterized protein Low 9.3 1 224-248 LRAVHRQMRRICRNSRKCKDKMEYT nucl(16),cyto_nucl(11),mito(6),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9Q2 Matrin-type domain-containing protein Low 8.1 1 22-41 ADRMRDEPKHIRDRLNRDHE nucl(12),cyto_nucl(11.5),cyto(9),pero(2),mito(1),extr(1),golg(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9X7 Uncharacterized protein Low 8.4 1 414-433 QTKLWHARRKAERTQWWEAA nucl(11.5),cyto_nucl(8.5),mito(5),cyto(4.5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAH1 Uncharacterized protein Low 5 1 44-63 STASDKTRPARRLRPPTEPS mito(21),cyto(3),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAI6 Zn(2)-C6 fungal-type domain-containing protein Low 5.4 1 64-84 VECFFTRSKRPVRRGANNAAV cyto(18),mito(5),nucl(1),extr(1),E.R.(1),cysk(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBA9 Aa_trans domain-containing protein Low 8 1 320-346 EESALLTPSRRKRRRKHRGGSGQNSPM plas(24),E.R.(2) SRRKRRRKHRG (328-338, prob:0.967) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QDZ8 Uncharacterized protein (Fragment) Low 6 1 6-27 ALPGRMRNPYRQSRKNASVRRS mito(21),nucl(3),cyto(3),cyto_nucl(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QI26 Delta 8-(E)-sphingolipid desaturase Low 9 2 131-154, 545-564 LVIQQQQQQQRQRQQKRQELTPRD, HLFPRIPRHNLRRTQKLVQE cyto(8.5),cyto_nucl(8),nucl(6.5),mito(5),pero(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJX7 Uncharacterized protein Low 8 1 166-193 ARSERRRTYSRHASRSRHRSHSGHRHGG plas(21),mito(2),E.R.(2) RRRTYSRHASRSRHRSHSGHRHGGSRRS (170-197, prob:0.841) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3X5 Uncharacterized protein Low 5 1 64-83 EETHAEKKKRRDRGVELGNY plas(24),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6S8 Serine/threonine-protein phosphatase Low 6.9 1 500-524 DSNALKSHIKKGRNKRAQMLNSPPA cyto_nucl(7),nucl(6.5),cyto(6.5),mito(4),golg(3),plas(3),extr(1),pero(1),cysk(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QA47 Uncharacterized protein Low 5 1 1-21 MDSPTRRRRPAVHRFSLRYLL plas(19),mito(3),E.R.(2),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCU0 Histidine triad-like protein Low 5 1 68-89 AEPSAKEGRPRQPQKKSFFDPF mito(18),cyto(5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJ96 Mannose-1-phosphate guanylyltransferase Low 6.1 1 345-372 RMVRALLLRRQRQQCRRLKKAWATKAIA cyto(13.5),cyto_nucl(9),mito(5),nucl(3.5),plas(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN69 RING-CH-type domain-containing protein Low 5 1 41-68 TPPSSGPTPTQRQRHRHYKPRTCRICLE plas(23),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2PZT3 Uncharacterized protein Low 9.4 1 1-20 MADRIPRNRRDLKRERHAIA nucl(11),mito(10),plas(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4D5 Uncharacterized protein Low 5 1 197-219 SEFRVRSRGLKRKMWWKNVKLMG mito(11),extr(9),cyto(2),plas(2),pero(2),cyto_pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4Q0 SRR1 domain-containing protein Low 6.1 1 1-23 METEWNQVKRRRGRLRNIPASIH cyto(10.5),cyto_mito(9.5),mito(7.5),pero(5),nucl(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7C7 Uncharacterized protein Low 8 1 274-296 LHTLRRFWRKPASRKAPERRSGQ mito(7),plas(5),extr(5),golg(4),cyto_mito(4) RFWRKPASRKAPERRSGQPADGTKQRSKERSK (279-310, prob:0.922) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEL1 MFS domain-containing protein Low 5 1 457-479 AGLMWRENRKRDRGERDHRLALP plas(27) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0L1 Uncharacterized protein Low 8 1 141-160 RERRYPVSGARQKRKTERGL mito(19),nucl(8) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4Y3 Uncharacterized protein Low 8.5 2 113-139, 514-537 DPVTSIPYPHPRRQRPPPPPPPPPQDS, QLLRRLDSSRPSRRVKRELCCDVQ mito(19),nucl(4),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6I3 IPPc domain-containing protein Low 5 1 465-486 EVENREQPKKQQQQQQQQQQTG extr(11),cyto(7),mito(6),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6J9 Phosphomevalonate kinase Low 5 1 185-206 TTTATAKPPRTRPRPRFRHFGT cyto(18.5),cyto_nucl(10.5),mito(4),extr(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8K1 Uncharacterized protein Low 5.8 1 558-578 EEEWRRRVEARREEREREERI mito(10.5),cyto_mito(10),cyto(8.5),nucl(3),plas(2),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QDH4 Uncharacterized protein Low 5 1 351-370 QKVIFKPWQRFERENRNTRL mito(8),cyto(7),extr(4),cyto_nucl(4),E.R.(4),cyto_pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QG82 DNA-directed RNA polymerase subunit beta Low 8.3 1 1225-1248 LTKQSFECRPCKNKTKIAQVHMPY nucl(11.5),cyto_nucl(10.5),cyto(8.5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHC8 CHY-type domain-containing protein Low 9.7 1 660-687 GKGTRDPRLMRRGDKRKYKRLGAQKKET mito(14.5),cyto_mito(10.333),nucl(7.5),cyto_nucl(6.833),cyto(5) GKGTRDPRLMRRGDKRKYKRLGAQKKE (660-686, prob:0.963) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN41 Uncharacterized protein Low 6.2 1 20-41 IPPPPVRRPQGRLKLRPNFYNT mito(12),cyto(5.5),cyto_nucl(5),pero(4),nucl(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3Q1 Uncharacterized protein Low 8 1 1-21 MTARRRPALHKQTPPNSKDRG plas(24),mito(2) KRKPPQRRAAAK (405-416, prob:0.812) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7Z8 DNA polymerase Low 6.5 1 565-588 GTAFQRDLRRYCRREKQLKFDSSG cyto(10.5),cyto_mito(9),mito(6.5),nucl(5),extr(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q872 Palmitoyltransferase Low 5 1 106-132 NGELRFCKKCQARKPDRAHHCSTCRRC extr(19),mito(3),plas(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAM5 Uncharacterized protein Low 8 1 559-581 AEELEKRRREWKAPEPRVKRGTL mito(24.5),cyto_mito(13.5) KRRREWKAPEPRVKRG (564-579, prob:0.817) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBD3 Methionyl-tRNA synthetase Low 9.7 1 614-644 AEKAAARKAAREKEKEKKKLKKAAQAAQAAA cyto(13),cyto_mito(9.5),nucl(6),mito(4),pero(3) IEAEKAAARKAAREKEKEKKKLKKA (612-636, prob:0.992) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QC93 Dihydroxy-acid and 6-phosphogluconate dehydratase-like protein (Fragment) Low 9.5 1 581-606 AAEFDRRRKEWKPPKMKPMRGVLAKY cyto(13.5),cyto_nucl(10),nucl(5.5),mito(4),pero(4) RRRKEWKPPKMKPMR (586-600, prob:0.849) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QDU1 FAD-binding PCMH-type domain-containing protein Low 5 1 35-55 SPPARCFSNSRRQQFQKTSPA mito(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QF95 Uncharacterized protein Low 5 1 378-400 GYYYPPQQPQQQQQQQQQQQQQQ plas(19),E.R.(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJ15 Calcium-transporting ATPase Low 7 2 163-185, 1127-1146 QFADRKRVFRDNRLPEKKPKSLL, PTPNVWPFNRKKKKEAALAE plas(24),E.R.(1),golg(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJC2 AA_permease domain-containing protein Low 5 1 652-671 QEEEERRSWPRWKRFYRLIC plas(27) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QK62 FAD-binding FR-type domain-containing protein Low 5 1 344-363 YSDGRRGRYASQNNRKRPDL plas(14),extr(5),E.R.(4),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2PZL5 Non-ribosomal peptide synthetase Low 6.8 1 2013-2032 EEVGGEPRRRRERRDCLVIC plas(11),nucl(5.5),cyto_nucl(5),cyto(3.5),E.R.(3),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2PZN6 PAS domain-containing protein Low 8.7 1 384-403 VPMDRDQRSGDKKKKLKMAE nucl(14),cyto_nucl(11),mito(7),cyto(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q052 MFS domain-containing protein Low 5 1 516-539 IDILFRRKVPARKWKKTVVDAEDD plas(27) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9C3 Nucleosome assembly protein-like protein Low 8.3 1 264-289 LTVRIEQKKQRNKTTKQTRIVKKTVP cyto_nucl(14),nucl(13.5),cyto(13.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QED5 Uncharacterized protein Low 5.9 1 418-448 SLPLRPRREQEQQQQQQRRRQQQQEKQQGAP cyto(11),mito(8),cyto_nucl(8),nucl(3),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEZ4 ENTH domain-containing protein Low 9.2 1 455-474 QPQIQQQQPKQQQQQPQREL nucl(15.5),cyto_nucl(11),cyto(5.5),mito(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFB3 Cytochrome b561 domain-containing protein (Fragment) Low 5 1 152-181 WGEWRIWKMTPRPCRRRKLRSPTSWTHQLG plas(24),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGY4 Non-specific serine/threonine protein kinase (Fragment) Low 6 1 9-33 AEGYKLTPTRRRRPLAQPNKPIQGS cyto(16.5),cyto_nucl(10.5),nucl(3.5),mito(3),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJ77 ANK_REP_REGION domain-containing protein Low 8.9 2 876-900, 930-951 KENFKETSLRVRKQRKPAPSGPVKE, IDSALWRTKKRREPPATIDDPV cyto(13.5),cyto_nucl(12),nucl(7.5),pero(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJ90 Zn(2)-C6 fungal-type domain-containing protein Low 6.8 1 6-35 LGYTKSRTGCLRCKQRRVKCDETRPACKAC mito(12),nucl(5),plas(3),cyto(2),pero(2),E.R.(2),cyto_pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJB7 Amidohydro-rel domain-containing protein Low 8.9 1 10-39 HRESPAPTSGRPRWRRQKPRRSSALRFLAL plas(11),cyto(4.5),mito(4),cyto_nucl(4),nucl(2.5),extr(2) GRPRWRRQKPRR (19-30, prob:0.859) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJF0 Uncharacterized protein Low 7.1 1 149-171 EQIARRCQYERKYRKPHTTATEE cyto_nucl(9.333),cyto(9),nucl(8.5),cyto_mito(7.333),mito(4.5),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJI8 MYND-type zinc finger protein samB Low 5.8 1 1195-1214 YCSAQCQKRDWAKHRMECEE cyto(14),cyto_mito(11.333),cyto_nucl(9.333),mito(7.5),nucl(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJW1 MFS domain-containing protein Low 5 1 82-104 EDGDYNKHKHRNNNTNNHKNDDD plas(24),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLU3 Uncharacterized protein Low 6.9 1 147-171 GTSTCPQARKLKTRAKKWMRLHAVD cyto(7),nucl(6),mito(6),plas(6),mito_nucl(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2PZX7 Uncharacterized protein Low 7.4 1 314-333 MHEVRPKMRREKYTNVKQAP extr(7),nucl(6),cyto(6),cyto_nucl(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9C8 Uncharacterized protein Low 6.6 1 21-40 TTTTAKRKAHPTPNPDPRAR cyto(12.5),cyto_nucl(9.5),pero(6),nucl(5.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QA70 Fructose-bisphosphate aldolase Low 5 1 318-343 VGNPEGPNKPNKKKYDPRVWIREGEK cyto(27) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBY9 Uncharacterized protein Low 8.4 1 538-561 LTKVSRCKASRAVRMERARRAKRN extr(21),cyto(3),nucl(1),mito(1),vacu(1),mito_nucl(1) RMERARRAKRN (551-561, prob:0.808) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCY0 Uncharacterized protein Low 5 1 73-93 ERDLKVVRAKRQQPPPGQKAV extr(11),mito(7.5),cyto_mito(7.166),cyto(5.5),cyto_nucl(5.333) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKS2 Alpha-1,4 glucan phosphorylase Low 9.7 2 52-78, 360-379 EASIPEPQRKTWRKHQSRGFKDKDGFE, YDIVRRFKRTKRPWNEFPDQ cyto(12.5),cyto_nucl(12),nucl(10.5),mito(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLT3 Galactose-1-phosphate uridylyltransferase Low 7.3 1 23-43 LVSPHRTKRPWQGQQEAPSKN cyto(10),cyto_nucl(10),nucl(8),mito(5),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPH1 Ima1_N domain-containing protein (Fragment) Low 8.7 1 13-32 FYCGRKTSTRYDGKTRRFDC nucl(10),plas(6),mito(4),cyto(3),golg(2),cyto_pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQ02 Uncharacterized protein Low 5.8 1 113-137 WADRFVRKCLARRRPWRPVVIRGRG cyto(7.5),mito(7),plas(6),cyto_nucl(5.5),nucl(2.5),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q056 Uncharacterized protein Low 8 1 303-337 ESEFVRLSRKEKKARKREKKEARKAEKEARKADRE plas(23),E.R.(2) SRKEKKARKREKKEARKAEKEARKADREARRQAGREKRS (310-348, prob:0.999) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q479 SGNH_hydro domain-containing protein Low 8.1 1 214-240 AMEKANSPQRPQKRRRMFKDDDKEFEE nucl(10),cyto(8.5),cyto_pero(6),mito(5),pero(2.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4F9 Peptidase A1 domain-containing protein Low 5 1 27-56 QWDIRRTQRQEELQRLNRRLRKRANPVLEV extr(17),cyto(5),mito(2),plas(1),pero(1),E.R.(1),mito_nucl(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6F8 Uncharacterized protein Low 5 1 1-20 MASRLIRSLRRRREDDVKPD plas(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q700 Uncharacterized protein Low 7.4 1 1-23 MEKQNTHKNNNNNNNNNKNKKTG mito(10),nucl(8),cyto_nucl(7.5),cyto(5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8C7 Uncharacterized protein Low 5 1 533-556 TAWGYFIWRERRKRRGYQGLAGEE extr(8),plas(6),mito(3),golg(3),pero(2),E.R.(2),vacu(2),cyto_mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QA33 alpha-1,2-Mannosidase Low 5 1 57-78 ALNTKWTKLKTKYPVKDLRPLP mito(7),extr(6),golg(5),plas(4),mito_nucl(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBT2 Zn(2)-C6 fungal-type domain-containing protein Low 7.5 1 26-64 EAASTAPRPKPKRVQVSRACQRCKRLQKGCSESRPCQRC nucl(8.5),cyto_nucl(8.5),cyto(7.5),mito(7),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QDL0 Glycosyltransferase family 90 protein Low 7.6 1 223-242 STPTKPTTKKQQEQQQQQQQ mito(17),nucl(9),cyto_mito(9) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEP1 Uncharacterized protein Low 8.4 1 384-409 LGIPHYNNLKDKKPKEKRKGGNGKKY plas(24),nucl(1),E.R.(1),golg(1) KDKKPKEKRKGGNGKKY (393-409, prob:0.977) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QI04 Uncharacterized protein Low 8 1 27-56 DEPEKVKSVVHHHRPKTRKRRNTAIFLLGS plas(17),mito(3),E.R.(3),pero(2),mito_nucl(2) RPKTRKR (40-46, prob:0.709) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QM89 Uncharacterized protein Low 8.5 1 27-52 NLYKVNVNRQKTKKWANFKPQNYDGD nucl(13),cyto_nucl(11.5),mito(7),cyto(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNZ2 Uncharacterized protein Low 6.6 1 25-57 HEEPQSGRRQQQQQQQQRQQQRQQQRPGPSPQS mito(18),nucl(4),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QP86 Uncharacterized protein (Fragment) Low 6.6 1 1-24 RGQKYRPLHPLKRVSRHPRVSYLF mito(21),nucl(4.5),cyto_nucl(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPL2 Uncharacterized protein Low 9.6 1 135-157 TKIVKIACSGKHRKRTPPPGGYS nucl(17),cyto_nucl(13),cyto(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3E4 Uncharacterized protein Low 9.9 1 291-312 ASAVVRGRRRRQYKRHGLDLRQ cyto(10.5),cyto_nucl(9),nucl(6.5),mito(6),plas(2) RRRR (298-301, prob:0.643) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3T5 WD_REPEATS_REGION domain-containing protein Low 8.5 1 309-337 NEAEVKKSLARKKRRKREKLAKEKKADGD cyto(13.5),cyto_nucl(8),mito(7),E.R.(2),nucl(1.5) KKSLARKKRRKREKLAKEKK (314-333, prob:0.998) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4F7 Uncharacterized protein Low 5 1 670-690 ASPSRPRSRRHDSVRLRQERE plas(16),E.R.(5),extr(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5E5 Uncharacterized protein Low 7.1 1 232-255 MVMPEERWKANRKKHPLHDRLAAM cyto_nucl(8),nucl(7.5),cyto(7.5),mito(6),pero(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QG56 Uncharacterized protein (Fragment) Low 9 1 13-33 TLPALKQSSPKPKRTRLSLLL mito(15),nucl(10) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QI49 Threonyl-tRNA synthetase Low 9.5 1 13-34 IGGGGDKKPKKEKKAPAAAAAD cyto(18),cyto_nucl(13.333),cyto_mito(9.833),nucl(7.5) GDKKPKKEKKAP (17-28, prob:0.905) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLC9 1-alkyl-2-acetylglycerophosphocholine esterase Low 8.9 1 6-35 DIHEKERQPHPAERRRRRRLTPRVRVIVVF mito(9),plas(8),cyto(4.5),cyto_nucl(4),nucl(2.5) PHPAERRRRRRL (14-25, prob:0.887) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLY5 CCHC-type domain-containing protein Low 7.5 1 55-79 KKGHYKRECRSPKKGWKPTPGKEIA mito(13),nucl(8.5),cyto_nucl(7.5),cyto(5.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QM67 alpha-1,2-Mannosidase Low 8 1 87-108 VEKDPDARARRRERRAIVRDVF extr(9),plas(6),mito(3),E.R.(3),golg(3),vacu(2),cyto_mito(2) RR (97-98, prob:0.612) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPW0 Uncharacterized protein Low 9.9 1 153-173 ILLGLLKKIRKKRPDLRIIIS cysk(14),cyto(7),nucl(5) KIRKKR (160-165, prob:0.682) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPZ9 Uncharacterized protein Low 8.8 1 46-73 YIHYATMKPEQKKKKEKKGEKKGPEQKR E.R.(8),mito(7),plas(4),cyto(3),nucl(2),cyto_pero(2) EQKKKKEKKGEKKGPEQKR (55-73, prob:0.995) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q043 Aspartyl-tRNA synthetase Low 7 2 57-78, 740-759 EDERKFERRSFHQRRQEEEERA, FRDRCDKKIEEWKANRKGSK mito(19),cyto_mito(13),cyto(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q183 Zn(2)-C6 fungal-type domain-containing protein Low 5 1 7-44 SPTTSPVKPHFPRPQHNCLECKRLKRACDKKLPCGKCE mito(13),cyto(5),pero(5),cyto_pero(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q376 CCHC-type domain-containing protein Low 8.9 1 45-73 TCYNCGKKGHYKRECRSPKKEWKPVPGKE nucl(12),cyto(10.5),cyto_mito(6.5),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q415 Uncharacterized protein Low 9.3 1 47-68 SPPTHSSRTSPPRPQSRRSAPS nucl(16.5),cyto_nucl(12),cyto(6.5),mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4T4 Ribose-phosphate diphosphokinase Low 7.9 1 88-111 VLPYFPYSRQSKKKSHRGAITARM cyto(13),nucl(9),cyto_mito(9) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7G7 ATPase GET3 Low 7.3 1 283-302 CDQCTARRRMQKKYLDQIEE cysk(13),cyto(7),nucl(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8J9 Uncharacterized protein Low 9.4 1 99-122 KASGPEWGKRARRRQREMIKKLLA mito(14),cyto(8),cyto_nucl(7.5),nucl(5) GKRARRRQRE (106-115, prob:0.824) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q955 Uncharacterized protein Low 5.5 1 4-23 LNPRFRRLPRPTALRINPKS mito(19.5),cyto_mito(11.5),cyto(2.5),nucl(2),plas(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAX5 RING-type domain-containing protein Low 5 1 203-230 VKTQTRQRLEDRRRRVREQRAEILRRRE plas(13),extr(8),mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QDL7 Chloride channel protein Low 5 1 80-101 DLSSPLTFKRRQKQSHFLSQPG plas(24),mito(1),cyto(1),E.R.(1),cyto_mito(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QI21 Ubiquinone biosynthesis protein Low 7.3 1 13-40 ATYPDCPNPQRRQKFSQPRPRGPPPSLP mito(18),nucl(6),cyto(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIY6 Uncharacterized protein Low 9.1 1 76-101 SVNGDGTKSKKKKSQRFYCTDYPPCN nucl(15.5),cyto_nucl(10.5),mito(7),cyto(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJ52 Uncharacterized protein Low 9.8 1 26-52 TARTVAFCGRRRRRRKDQSNVGARGRR mito(12.5),cyto_mito(9.5),nucl(6),cyto(5.5) RRRRRRKDQSNVGARGRRRAR (35-55, prob:0.954) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QM37 Uncharacterized protein Low 9.9 1 304-325 FWGPLVERSRKRKRAGSGSFEE cyto(10),mito(6),nucl(5),plas(5) RKRKR (313-317, prob:0.704) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNE5 Uncharacterized protein Low 9.3 1 33-54 GRLSGSKRNGAKKPQNNPYPQS nucl(14.5),cyto_nucl(9),mito(8),cyto(2.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNH1 40S ribosomal protein S25 Low 9.8 1 4-30 AAAAGAKKQKKKWSKGKVKDKAQHAVI cyto(10.5),cyto_nucl(9.333),nucl(7),mito_nucl(6.833),mito(5.5) GAKKQKKKWSKGKVKDK (8-24, prob:0.957) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNK9 APH domain-containing protein Low 9.5 1 33-61 DDFERDSVRRLRRRMRKIARAKGKPFPDS cyto(10),cyto_nucl(8.5),nucl(5),pero(4),cysk(4),mito(2) RRLRRRMRKIARAKGKP (41-57, prob:0.96) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q063 Uncharacterized protein Low 7.4 1 439-462 PPVILETKQVKPKKKIRCLVAFLG cyto(8),nucl(6),extr(5),mito(3),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1S9 Nicotinate phosphoribosyltransferase Low 6.9 1 42-62 QYTNRTPEKKLSRKAFRWLED cyto(14),nucl(5),cysk(5),pero(1),golg(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAL6 Uncharacterized protein Low 7.2 1 204-229 RDRGRLEQRDQQQHQQRQRLQRRRLS cyto(10),cyto_nucl(10),nucl(8),mito(4),extr(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEA3 Maintenance of mitochondrial morphology protein 1 Low 7.5 1 384-404 VDRGHESLRYRRRPRPEDMFS plas(12),nucl(7),E.R.(3),extr(2),cyto(1),pero(1),golg(1),cyto_pero(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QF60 Uncharacterized protein Low 5 1 22-45 RAVSASRRSIRRNGKPLRNPPDTL extr(12),mito(4),plas(4),E.R.(3),cyto(1),pero(1),golg(1),vacu(1),cyto_pero(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIC9 Uncharacterized protein Low 9.8 1 404-423 QMKLWHARRKAERTQWWEAA nucl(12),mito(5),pero(5),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIU5 Uncharacterized protein Low 8.6 1 132-151 SKPTVTSKIKETPRRKRTLP mito(12),nucl(9),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKC3 Uncharacterized protein Low 7.4 1 382-414 TNNNNNKPLRERQHRPHHRHHRQHQHHPPHATA nucl(8.5),cyto_nucl(8.5),extr(7),mito(6),cyto(5.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMB1 Uncharacterized protein Low 5 1 130-149 GEKKERYKLPEQWRHRHVRD mito(13.5),cyto_mito(11),cyto(7.5),extr(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNL8 Protein kinase domain-containing protein Low 5.5 1 134-153 GRGTCSTHHHPPRTRTRTRE mito(12.5),cyto_mito(11.5),cyto(9.5),nucl(2),extr(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0A6 Uncharacterized protein Low 6.9 1 1372-1391 QLRDGKSKQVGKTKHRKSSS cyto(11),cyto_nucl(10),nucl(7),mito(3),plas(2),pero(1),E.R.(1),cysk(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0T3 PCI domain-containing protein Low 8.3 1 455-474 TGKALRKVHKGQFRARVRQM nucl(12.5),cyto_nucl(11.5),cyto(9.5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3J8 Eukaryotic translation initiation factor 3 subunit M Low 8.6 1 537-558 ISGGHGGDRRRQQQKPRTDEDD nucl(12.5),cyto_nucl(10.5),cyto(7.5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q452 TOG domain-containing protein Low 9.3 1 210-232 STEAAAGRKRKKRWDVSSTETTG plas(21),nucl(3.5),cyto_nucl(2.5) GRKRKKR (216-222, prob:0.773) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4Z6 WD_REPEATS_REGION domain-containing protein Low 8.1 1 1-26 MATIAPPPSKRQRREELERTQKQQDV nucl(10),mito(7),cyto(6.5),cyto_pero(5.5),pero(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QB32 Uncharacterized protein Low 9.1 1 1-56 MNGTTVKANDKKKRAYKQDQKKTTKDKSNVTCYNYRKKGHYKRECRSPKKGWKLTP nucl(15),cyto_nucl(11.5),cyto(6),mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QB53 Uncharacterized protein Low 9.9 1 457-489 QSPLPTQPRSHRRHPANHSRNRHHHQPHSSKTS nucl(18.5),cyto_nucl(13.5),cyto(5.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFP9 Aldehyde dehydrogenase Low 5 1 24-45 AFRTHKTKTLQWRQTQLRKLYW cyto(13.5),mito(8),cyto_nucl(7.5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJ75 Uncharacterized protein Low 8.7 1 29-57 KAEKLASKAKPKPVPLKLKPTKADRKGVA cyto(12.5),mito(11),cyto_nucl(8),nucl(2.5) LASKAKPKPVPLKLKPTKADRK (33-54, prob:0.872) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMA9 Uncharacterized protein Low 6.2 1 190-216 RIIKACDSCKRKKVRCDPSHRKRNASQ extr(16),nucl(3),cyto(3),cyto_nucl(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMH0 Amine oxidase Low 9.4 1 582-603 EGIASWIRKRRERRRGEEVGGS cyto(11.5),cyto_nucl(8.5),mito(8),nucl(4.5) RKRRERRRGEEVGGSSSNREGRGNEKKGG (589-617, prob:0.908) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2PZI8 Uncharacterized protein Low 9 1 495-515 IVNSRNKPEPRRSAWQTCVFP nucl(14.5),cyto_nucl(10.5),mito(6),cyto(5.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q126 tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase Low 8 1 304-336 WEDAQSRRERKRQEGLRRREQLRKDKKTEVVDE mito(26) RRERKRQEGLRRREQLRKDKK (310-330, prob:0.9) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q336 Uncharacterized protein Low 9.5 1 58-83 TLDKAQRRRAQVRRAQTQHRQRKADY nucl(17.5),cyto_nucl(12),cyto(5.5),mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q340 COX assembly mitochondrial protein Low 9.2 1 58-80 NRNSVQDKRSKIRQKWKEIDENS nucl(14.5),cyto_nucl(10.5),mito(6),cyto(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8B0 ABC1 domain-containing protein Low 8 1 44-68 GTSTRPWLASQPRPKPRRRAAVLLA mito(12),plas(9),cyto(3),pero(2) RPKPRR (56-61, prob:0.663) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QB01 Aspartokinase Low 9.5 1 349-368 SDPALRKKPKRPTAVTVKDK cyto(13.5),cyto_nucl(10),mito(8),nucl(5.5) LRKKPKR (353-359, prob:0.756) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEY8 ERF-3 Low 8.9 1 644-668 LLHKLQKGTNRKSKLPPSHAKKGDS cyto(15),cyto_nucl(10),pero(7),nucl(3) APAKEEPKKEESKKEEAKK (194-212, prob:0.812) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMM5 Uncharacterized protein Low 8.8 1 1063-1100 AVTGESMKFKAKKKKKLTKRELKEREVRRRLRHIEWLN cyto(16),cyto_nucl(10.5),mito(6),nucl(3) KFKAKKKKKLTKRELKEREVRRRLRH (1070-1095, prob:0.996) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPJ3 Uncharacterized protein Low 6.5 1 233-257 VCFAFVWLRRRKQRKESFDRALRSR extr(10),cyto(5.5),cyto_nucl(5.5),nucl(4.5),mito(3),plas(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPK4 acidPPc domain-containing protein Low 5 1 38-61 LKSLHHYRRALPKWRYNLRQRLLP plas(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPM9 Uncharacterized protein Low 7.6 1 444-463 DEVGRERRVREDERKEKQGS cyto_nucl(11.5),cyto(11),nucl(10),mito(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q080 Uncharacterized protein Low 8 1 195-223 DERDKRFPGCDWRRKREIRKDIKEPQIHP nucl(10.5),cyto_nucl(9.5),mito(7),cyto(5.5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1K3 Uncharacterized protein Low 9 1 414-433 QMKLWHARRKAERTQWWEAA nucl(13.5),cyto_nucl(9),mito(5),cyto(3.5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1S8 WD_REPEATS_REGION domain-containing protein Low 5 1 26-45 LPPVSGQKKHTQKHIQVRLA mito(13),extr(7),cyto(4.5),cyto_nucl(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8A0 Uncharacterized protein Low 5.3 1 14-34 AHDPHEKPDRYRNPREQSLIM mito(11),golg(4),plas(3),E.R.(3),extr(2),vacu(1),pero(1),cyto_nucl(1),cyto(1),nucl(1),cyto_pero(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8E5 Autophagy-related protein 2 Low 8 1 1622-1645 AGQHRRSKSLKLNRSKRHKITFEL mito(18.5),cyto_mito(12.333),cyto(5),cyto_nucl(4.833) RRSKSLKLNRSKRH (1626-1639, prob:0.69) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8T5 Uncharacterized protein Low 8.4 1 16-36 RLLFRPPPARRAPRAPRAQPS mito(17),extr(4),pero(2),nucl(1),cyto(1),cyto_nucl(1),E.R.(1),golg(1) PPARRAPRAPRA (22-33, prob:0.739) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBA3 Uncharacterized protein Low 7.8 1 30-49 YCWARCQEAKRVRTRCKYSS mito(12),nucl(9.5),cyto_nucl(7.5),cyto(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJ32 Uncharacterized protein Low 8.3 1 3038-3066 TNPTNKQALKASRRQKKTKAASTPRYGMH nucl(11.5),cyto_nucl(10),cyto(7.5),mito(4),plas(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJJ9 Uncharacterized protein Low 8 1 636-658 EEQEKEGKKKWARMGKGKGKGEA plas(22),mito(2),cyto(1),extr(1),E.R.(1),mito_nucl(1) KEGKKKWARMGKGKGKGEATGGGERGK (640-666, prob:0.977) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMQ7 Non-ribosomal peptide synthetase Low 5.8 1 7770-7791 INGLVKRKFTTKKKGEQPVTVS plas(20),E.R.(3),nucl(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q945 Fungal_trans domain-containing protein Low 8 1 600-625 IEKAEKEHASRRKRKNQDQSLNKSAV extr(14),mito(3),cyto(3),E.R.(3),cyto_mito(3) SRRKR (609-613, prob:0.678) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QB25 Uncharacterized protein Low 8.6 1 26-48 LQDRANPRKHRVQPDGKNKPAAG cyto(10),nucl(9),mito(4),extr(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QED0 Patatin-like phospholipase domain-containing protein Low 8.8 1 165-202 VHERVRRDRKDAPPSTRKKKKKTRRKARTKDETREGYF plas(23),nucl(2) RVRRDRKDAPPSTRKKKKKTRRKARTK (168-194, prob:0.999) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QET3 Uncharacterized protein Low 9.1 2 270-289, 610-634 SPTKGPKKERNKPSNLNLSR, TPSVVTRADRKRMKKLEPRTPTVEM extr(8),mito(7),nucl(6),pero(3),plas(2),cyto_pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QET5 Glucosamine-6-phosphate deaminase Low 5 1 376-398 DPSLLRRSTPNPERQRPRSPGLP mito(18),cyto(8) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QF23 Uncharacterized protein Low 5 1 33-61 AGTNSDKEQHSRRRRHRGCCCCTRRCCTP plas(18),E.R.(4),vacu(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QG29 Non-ribosomal peptide synthetase Low 6.3 1 2514-2534 GAWTAKPPSHQSHKRKPSGSI cyto(10.5),cyto_nucl(8),mito(5),nucl(4.5),plas(3),pero(2),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QK80 Uncharacterized protein Low 5 1 161-182 DDEKEERRKKEQQRQLVEKLKQ plas(17),E.R.(6),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLX1 Uncharacterized protein Low 6.5 1 287-307 GDFYHRPPKPQQDRQSPPQTF mito(14),nucl(4.5),cyto_nucl(4.5),cyto(3.5),extr(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0Y6 Zn(2)-C6 fungal-type domain-containing protein Low 9.4 1 72-95 TTAACGACRKRKSKCDGERPACSI nucl(11),mito(8),cyto(4),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q345 tRNA-dihydrouridine synthase 3 Low 7 1 419-466 LGEFEPKRGPKQKNKQQQKGQQGEQPSGQQQESKKRKRGQDEEEEREG mito(13),cyto(7),nucl(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4X8 Uncharacterized protein Low 9.3 1 17-44 RHDEPATHHHHHHRRRRRASVHYPLPME cyto(10.5),mito(8),cyto_nucl(8),nucl(4.5),pero(3) HHHHRRRRR (26-34, prob:0.759) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6Z5 Uncharacterized protein Low 7 1 1612-1631 ASKLRLKNRKEKLKQWHTES mito(10),plas(6),nucl(5),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q728 Uncharacterized protein Low 8 1 13-40 LSRQLGRQCARPRSLRPRNRNPVLPGAA mito(19),cyto(4),E.R.(2) PAKAREKHLARKKM (98-111, prob:0.777) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q869 Uncharacterized protein Low 6.2 1 21-44 LQQARMNKDRRPGRRQPRFTSCCE extr(11),mito(10),nucl(3),cyto(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8C0 UBC core domain-containing protein Low 9.6 1 4-23 CQNRLQEERKQWRKDHPFGF nucl(15.5),cyto_nucl(10),mito(5),cyto(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QB86 Protein-serine/threonine kinase Low 6 1 259-278 AERHQRRKDKDHPDPSRPPP mito(21),nucl(3),cyto(3),cyto_nucl(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QDZ4 Zn(2)-C6 fungal-type domain-containing protein Low 7.9 1 11-41 RYHTKVRSGCLTCKKRKVKCDEAKPHYRCCT mito(13),nucl(9.5),cyto_nucl(7),cyto(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QF20 HECT domain-containing protein Low 7.4 1 62-90 RAAQRIQRTWRGYRSRRNLRASRRQAVDL mito(11),nucl(6),plas(4),cyto_nucl(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLJ8 Adaptin_N domain-containing protein Low 6.9 1 179-204 MTVYARKCFPRRTRTVKNKERPAELQ mito(15),cyto(7),nucl(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN63 Stc1 domain-containing protein Low 9.4 1 54-74 EEKCRGPCGRWREKRLFSKST nucl(12),mito(5),cyto(5),cyto_mito(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3C0 Uncharacterized protein Low 6.7 1 317-338 LPSCTWRKSKTRSAPKDGIPTV cyto(11),cyto_nucl(9.5),mito(8),nucl(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6J8 Uncharacterized protein Low 5 1 38-58 LNSQNRPSFARRRNATRVGRL mito(24),cyto(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9V7 Uncharacterized protein Low 8.5 1 95-117 GKDHWKRKAKAAKKQRTSCNCLA plas(13),pero(5),cyto(4.5),cyto_nucl(3.5),nucl(1.5) WKRKAKAAKK (99-108, prob:0.842) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEH1 Fungal_trans domain-containing protein Low 5 1 578-602 QQLAQGRRQQQQQQQHQQQQQQQSS plas(8),mito(6),extr(6),cyto(4),E.R.(2),cyto_pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QI43 NmrA domain-containing protein Low 5.8 1 272-292 VDREIYKKRRHINVPKWLLKP mito(19),cyto(4.5),cyto_nucl(4),nucl(2.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIM1 Uncharacterized protein Low 8 1 70-94 PSPPSAPVKKAPRRKPSKWILFQLW plas(25) PVKKAPRRKPS (76-86, prob:0.823) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3K0 Uncharacterized protein Low 5 1 302-323 IFYRYWSKRKLRKSMDMRDKAR plas(23),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3M5 Uncharacterized protein Low 5 1 66-88 LLSLVYKRWRERPQRPVKIWFFD plas(19),mito(3),E.R.(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3Y6 Uncharacterized protein Low 8.4 1 794-814 IELNNRNWRWHKKMQMWLTKD nucl(12),cyto_nucl(11),cyto(8),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5P1 Uncharacterized protein Low 6.2 1 1-20 MPPRPQRLVRRQPLGQRLRA mito(18),nucl(3),cyto(2),plas(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6I9 Uncharacterized protein Low 9.2 1 1026-1058 GTKKKAKLTSSELRKKKKERMARRKRGEEVFSD cyto(20.5),cyto_nucl(13),nucl(4.5) TKKKAKLTSSELRKKKKERMARRKRG (1027-1052, prob:0.995) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q783 Uncharacterized protein Low 7 1 32-67 ASEMVVHKTRRPHRKSRYGCTRCKVRRIKLEQILPP plas(9),cyto(7),nucl(6),mito(4),cyto_pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q866 Uncharacterized protein Low 5 1 46-68 LGLRVYCKLSRRRRLWWDDNFLI plas(24),mito(1),E.R.(1),golg(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8S3 Uncharacterized protein Low 9.8 1 98-118 QLEAEKRKKEEERRRQAQAQY nucl(17.5),cyto_nucl(12.5),cyto(6.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAD9 CENP-V/GFA domain-containing protein Low 5 1 430-454 MEEWRIERKYPKSWRRVAQEQQEGM mito(19),cyto(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEM4 Calpain catalytic domain-containing protein Low 7.8 1 35-58 AGKASYPADRKRFRRKCAELIALG cyto(11.5),cyto_nucl(11.5),nucl(10.5),mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFD4 Peroxin/Ferlin domain-containing protein Low 5.7 1 510-531 GQDGWGRWTRRRKWYRDAELVE plas(20),nucl(2),mito(2),E.R.(2),mito_nucl(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJ51 Zn(2)-C6 fungal-type domain-containing protein Low 6.9 1 3-30 GVPGRSKACITCRKRRKGCDLERPACSQ mito(17),nucl(5),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2H1 Uncharacterized protein Low 8 1 295-325 RADFERNRRGRAKKGRRRKRGGTWWTKGKGR plas(19),extr(3),E.R.(2),vacu(2) RNRRGRAKKGRRRKRGGTWWTKGKG (300-324, prob:0.998) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2V2 Uncharacterized protein Low 9.4 1 425-445 SPEDRRVYNRRLRRSVQQSME nucl(11),cyto(7),mito(5),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNX1 Uncharacterized protein Low 7.4 1 124-145 QSDSRHYQRSRSKSPRGRDSYR cyto_nucl(12.333),nucl(10.5),cyto(9),cyto_mito(6.165),extr(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1L3 Uncharacterized protein Low 5 1 310-339 ATVETLRRRLQQRKLQQQQQQQQQQRNVRI extr(7),plas(5),cyto(4.5),mito(4),cyto_nucl(3),pero(3),E.R.(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q294 Uncharacterized protein Low 8 1 460-494 KAVEKDKAKKEKEKAKKKEKKKKKSRGKEDDEDDD plas(23),cyto(1),E.R.(1),golg(1),vacu(1) KDKAKKEKEKAKKKEKKKKKSRGK (464-487, prob:1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q301 Carn_acyltransf domain-containing protein Low 9.2 1 117-139 VSYFYSHRDDRRRRDPAKRAAAL nucl(11),pero(8),mito(4),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q368 MBOAT_2 domain-containing protein Low 5 1 386-410 RQHGRVHHHHHHHHHHHRHHNQSHT plas(10),mito(7),cyto(3),extr(2),cyto_nucl(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q930 Uncharacterized protein Low 6.9 1 21-40 QLQKQKEAYKTKKRALHEDV cyto(10.5),cyto_mito(8),nucl(6),mito(4.5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9D6 p-aminobenzoic acid synthase Low 7.5 1 593-613 NPLPSSPRKLQQKQRFQSQHN cyto(12.5),cyto_mito(8.5),nucl(8),mito(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBX1 Autophagy-related protein 101 Low 7.3 1 215-249 QSSSHQQRSQQQQQQQQQHQQQLQHRQQQQKKGAA cyto_nucl(8),nucl(7.5),cyto(7.5),mito(7),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBZ7 Zn(2)-C6 fungal-type domain-containing protein Low 6.6 1 9-38 GAAPSPACHNCRRRRLRCDRSLPSCRKCLG mito(13),plas(5),nucl(4),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QC24 Uncharacterized protein Low 9.7 1 30-53 VASPDRCDRCRKARPNRPSMQCTA nucl(17),cyto_nucl(11),mito(5),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIK4 Uncharacterized protein Low 9.5 1 707-732 DTALAKARARARKKGREPPRREDVYY mito(20),nucl(4),cyto(3) KARARARKKGREPPRR (712-727, prob:0.967) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0R7 Cation_ATPase_N domain-containing protein Low 5 1 1047-1067 WVDEARKWWRYRNGRRGFVGG plas(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q281 Glycosyltransferase family 62 protein Low 5 1 55-77 PPTSPFRKPTGDKQKQKPPPVAH extr(7),mito(6.5),golg(6),cyto_mito(4),E.R.(3),plas(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q601 Non-specific serine/threonine protein kinase Low 6.2 1 2411-2434 TLDLQNSKKRPQKGPPLNPTRVVE plas(16),cyto_nucl(4),nucl(3.5),cyto(3.5),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q771 Biotin carboxylase Low 8.3 1 2147-2167 WRNARRFFYWRVRRRLNEEYI nucl(12.5),cyto_nucl(10.5),cyto(7.5),pero(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7N4 Zn(2)-C6 fungal-type domain-containing protein Low 8.2 1 2-41 ESARRVPRPRLYHTKSRTGCTRCRSRRVKCNEARPVCNNC mito(11),nucl(10.5),cyto_nucl(7.5),cyto(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QC50 Smr domain-containing protein Low 9.2 2 203-224, 226-247 GVGHDRHHRQQKQQQHQQHYGE, TTGYHHQRPTQQHQQRPPQPEQ mito(12),cyto_nucl(11),nucl(8.5),cyto(6.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCD7 Uncharacterized protein Low 8.9 1 86-112 VPHHKEPPRYIRTRSSNKRTREFNRVF nucl(14.5),cyto_nucl(11),cyto(6.5),mito(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEQ1 Pyr_redox_2 domain-containing protein Low 8.8 1 61-88 TSDAAPVPPPKKRRFRKLRWAWRFTYLS mito(18.5),cyto_mito(11.5),cyto(3.5),nucl(3) PPKKRRFRKLR (69-79, prob:0.879) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFL5 Uncharacterized protein Low 8.8 1 292-318 RQDVLPLRLRRHRRRRGARTDKRIVSL plas(20),E.R.(4),nucl(2) RLRRHRRRRGARTDK (299-313, prob:0.939) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIT7 Uncharacterized protein (Fragment) Low 8.4 1 137-158 GAPARQRSPKQLHVRRLWNRAY nucl(12),cyto_nucl(10),cyto(6),mito(4),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMH7 Septin-type G domain-containing protein Low 5 1 1-24 MFTAQKMIRRKKNVKKGIQFCLMV mito(24),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN52 Uncharacterized protein Low 5 1 175-194 ATRAALLKKTGKKKSKCLIA cyto(18.5),cyto_nucl(10.5),mito(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN76 Uncharacterized protein Low 5 1 114-136 ICAVCLFRFRKRKRAAIPYTPRI plas(16),extr(4),E.R.(4),mito(1),pero(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQ65 Uncharacterized protein Low 8 1 63-87 AAVIDAGRKDRRRRELDRKIAEAKS mito(23.5),cyto_mito(13) RKDRRRRELDR (70-80, prob:0.745) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQ74 UNC45-central domain-containing protein Low 7.3 1 155-176 PSLAPLMRRKWKSKKVETACLE cyto_nucl(9.5),cyto(9),nucl(8),mito(8) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0D6 Tim44 domain-containing protein Low 8 1 131-152 EEEAGRKKKEKKDDLPPPPPHG mito(23.5),cyto_mito(13.5) AGRKKKEKK (134-142, prob:0.862) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0V6 Importin N-terminal domain-containing protein Low 6.4 1 82-101 DKYWRQTAKHAIKPENKQAI cyto(9.5),cyto_nucl(7.5),mito(7),nucl(4.5),extr(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1Y9 Autophagy-related protein 11 Low 9.5 1 442-461 QEEEAKRRRKWYKSIGNTYG nucl(18),cyto_nucl(14),cyto(8) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2T2 Uncharacterized protein Low 8.6 1 468-492 AEYDNHGRRHPRNRRLRPATGQRYD nucl(13.5),cyto_nucl(11),cyto(7.5),mito(3),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q377 Uncharacterized protein Low 5 1 2-21 SRVAKRSTKRSVKTEERIAL mito(22),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4N9 Uncharacterized protein Low 5 1 32-55 LLDGKPLPAKYRKNPPPPYTPEHR extr(12),plas(4),E.R.(4),golg(3),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5A4 Uncharacterized protein Low 7 1 824-847 KSGLKEFAKRETQRKRPARLTFYD cyto(14.5),cyto_nucl(11.5),nucl(7.5),pero(2),cysk(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9D5 Uncharacterized protein Low 5 1 1482-1501 ALGKKERRMWHARRGCRLVV cyto(9.5),mito(9),cyto_nucl(5.5),plas(3),pero(2),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEL4 Uncharacterized protein Low 6.4 1 192-212 AVDWVRSRVKWNKESRPPLMR mito(12.5),cyto_mito(10.833),cyto(8),cyto_nucl(7.833),nucl(6.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QH59 Uncharacterized protein Low 8 1 459-479 SSEGRRKRVPKPEQGRNSPAP cyto(14.5),nucl(10),cyto_mito(8.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJE2 Protein kinase domain-containing protein Low 5 1 83-106 LASLDTRLKRNQRREKHKVLQVLR mito(21),cyto_mito(14.5),cyto(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKM0 Uncharacterized protein Low 7.5 1 29-49 GESTRKQPPPEKPSDVRRRSH plas(13),nucl(7.5),cyto_nucl(6),cyto(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLN4 Uncharacterized protein Low 6.9 1 5-33 LSLPKQRDVKYNTHRRRKPFIEKGSRDVA mito(18),nucl(5),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN75 Uncharacterized protein Low 6.6 1 82-109 DGAEQQQQHHHRRRRRQQQQQQQGSRPD mito(19),nucl(4.5),cyto_nucl(3.5),cyto(1.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPB9 Uncharacterized protein Low 6.8 1 7-27 LGTPWRTKRRGPKSRQFLVSH mito(17),nucl(5.5),cyto_nucl(5),cyto(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPW1 Uncharacterized protein Low 9.2 1 81-104 SVLFYLHRRNVRKQRQEDLHDPHK nucl(11),mito(6),cyto(5),plas(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7E7 Protein kinase domain-containing protein Low 8.3 1 57-79 DQHPIFGKKLKRRNDLQDLCRCI nucl(11.5),cyto_nucl(10.5),cyto(8.5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8B9 Asparagine synthase (glutamine-hydrolyzing) Low 6.5 1 77-97 IYNHRLIRKSLKKPYHFKTAS cyto(11.5),cyto_nucl(9),mito(6),nucl(5.5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9P4 Uncharacterized protein Low 7.8 1 251-276 LGPLNCPYHKRNKVRFNVREHWKCTK nucl(10.5),cyto_nucl(9.333),cyto(7),extr(6),cyto_mito(5.333) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGL2 Uncharacterized protein Low 7.3 1 1-24 MESKWDHKNKNTYNHKNKNTYNTG cyto_nucl(8.5),nucl(8),mito(8),cyto(7),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJ58 Polyketide synthase Low 9.1 1 2156-2176 LGDYSRRHHHHHHHRQSPSAG cyto(12),mito(10),cyto_nucl(9),nucl(4) LKLKPFKAHLSRQLARRRPAA (1651-1671, prob:0.754) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLV3 Tubulin-tyrosine ligase-like protein Low 8 1 252-277 PLVVDKSKNKNKSKSKRPRYVFKEGG cyto(15.5),cyto_mito(12.5),mito(8.5) SKNKNKSKSKRPR (258-270, prob:0.872) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q074 Uncharacterized protein Low 7.2 1 372-393 HYLTRGKERPRKPENHRLRCIP mito(10),nucl(6),cyto(4),plas(2),pero(2),E.R.(1),cysk(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q166 RING-type domain-containing protein Low 5 1 164-183 WDAVSRKRPRAQPKTPDDGT extr(15),plas(6),mito(3),E.R.(2),mito_nucl(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3N3 Uncharacterized protein Low 9.8 1 180-199 ICKECSKRFEKKPSCSKRAC nucl(12),cysk(6),mito(4),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5Q7 Uncharacterized protein Low 5 1 65-91 AEQVPGTSRRQQQRRRRQPPWPLFTPE plas(23),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBI0 Carboxypeptidase Low 5 1 81-106 AFKNPSWFSKPKPHRRRDDWDHVVKG extr(23),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QK86 BAH domain-containing protein Low 7 1 2035-2057 ANINTIRKRRLSQRQQAAPEARS cyto(10.5),cyto_nucl(9),pero(7),nucl(6.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN19 RING-type domain-containing protein Low 6.1 1 516-535 QPQPQPQQQQQQQQQQQQQQ extr(13),mito(5),nucl(3),pero(3),E.R.(1),golg(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN60 Uncharacterized protein Low 5 1 4-31 SLPLHPSSSQRNRDSRNHFKNNNQGTSP mito(21),cyto(3),pero(3),cyto_pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q165 Valyl-tRNA synthetase Low 8 1 19-60 AVDPGTVKKNEKKEKAKADKAAKFAAKQEKLKQQQPKKDAAQ cyto(14.5),cyto_mito(10.166),cyto_nucl(8.833),mito(4.5),E.R.(4) KKNEKKEKAKADKAAKFAAKQEKLKQQQPKKDAAQ (26-60, prob:0.961) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2T4 Dolichyl-diphosphooligosaccharide--protein glycotransferase Low 8 1 725-750 AAFDRGHKKKSKGITKKKGPRQLRID plas(20),E.R.(4),mito(2) RGHKKKSKGITKKKGPRQ (729-746, prob:0.971) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3G3 Uncharacterized protein Low 8 1 119-147 TAVPAPETEKPKKKKKKERTFFKHLTPKE plas(24),E.R.(3) KPKKKKKKER (128-137, prob:0.973) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q585 RRN7-type domain-containing protein Low 9.1 1 54-76 KTGSVARKKKEARHADRKHLTGN plas(14),mito(6),cyto_nucl(4),nucl(3.5),cyto(3.5) RKKKEARHA (60-68, prob:0.755) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QC44 Uncharacterized protein Low 8.3 1 120-142 LSIKKLRTKTYANQRRRNRESFA nucl(12),mito(12),mito_nucl(12) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIJ6 HET domain-containing protein Low 5 1 39-62 VEAFARYRRSRREHARHMQKAGFS cyto(14.5),cyto_pero(8.5),mito(8),cysk(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLC7 Uncharacterized protein Low 8 1 295-315 AARKRALAYRMKQKRAREFRA extr(13),cyto(6.5),mito(5),cyto_nucl(5) RKRALAYRMKQKRARE (297-312, prob:0.743) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLX2 GPN-loop GTPase Low 6.8 1 299-324 LDRLRAEKEENKRKQREKELEKMMKG cyto_nucl(9.833),cyto(9.5),nucl(8),cyto_mito(7.666),mito(4.5),extr(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2PZZ8 Uncharacterized protein Low 8.7 1 163-185 PDERQKPMSRAERRRRIRAEIMR extr(17),plas(3),nucl(2),pero(2),mito(1),cyto_nucl(1),golg(1),vacu(1),cyto_pero(1) PMSRAERRRRIR (169-180, prob:0.763) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2L7 Uncharacterized protein Low 6.8 1 449-471 KFTHIKTPCKYRPCTNRNCPFMH nucl(7),cyto(7),cyto_nucl(7),extr(6),cyto_mito(6),mito_nucl(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q343 TRP_N domain-containing protein Low 8 1 611-637 AFIACFKMNPHRKRRKELEKLQQRDTL plas(15),extr(7),E.R.(3) KR (623-624, prob:0.605) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6Z7 Uncharacterized protein Low 9.9 1 569-589 PPPIPPRSKLRPEPLRIWRPN nucl(18),cyto_nucl(13),cyto(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q811 Rab-GAP TBC domain-containing protein Low 9.1 1 84-106 PSLSNMKRRSQKKAELSRAQTED nucl(11),mito(8),cyto_nucl(8) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q931 Flavin_Reduct domain-containing protein Low 9.5 1 1-22 MGLKKRRRTSNAKSKSLPKATK mito(18),cyto(5),nucl(4) KKRRRTSNAKSKSLPKATKEPERKGTKTPSSTRTRAR (4-40, prob:0.959) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBE2 Uncharacterized protein Low 5 1 1-22 MLRSCRPTRLLTRPRQPWNTLS mito(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBV2 Peptidase_M24 domain-containing protein Low 9.9 1 378-411 LEQPLARNTGKNKNKKKKKKKPAKKEAKEEESEE cyto(16.5),cyto_nucl(12.833),nucl(8),mito_nucl(5.333) GKNKNKKKKKKKPAKKEAK (387-405, prob:0.999) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEG2 Phospholipid-transporting ATPase Low 5.4 1 1298-1323 MEQFQKAIRKVRQVQRMRKQRGYAFS plas(23),nucl(1),cyto(1),cyto_nucl(1),E.R.(1),golg(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFC5 Uncharacterized protein Low 5.7 1 236-257 VLKSAVKKARQQQQQQQQQPEQ mito(21),nucl(2),cyto(2),cyto_nucl(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFX6 Tyrosine--tRNA ligase Low 9.8 1 341-370 EIAEKAYPPPPKKEKKVKNKGTRYPGAGKD cyto(16),cyto_nucl(12.5),nucl(7),pero(4) PPPKKEKKVKNKGTR (349-363, prob:0.921) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QG35 Uncharacterized protein (Fragment) Low 9.5 1 11-41 GPMPKVPKLLKGSKKRPKKRHPPPVATDAAP mito(11),cyto(8.5),cyto_nucl(7),nucl(4.5) PKVPKLLKGSKKRPKKRHPP (14-33, prob:0.989) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q187 RING-type domain-containing protein Low 5 1 478-500 KPETRGSQRSQPQPRPDNRPDTD mito(12),extr(6),cyto(3),plas(2),cyto_nucl(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3V8 Uncharacterized protein Low 8 1 1168-1187 RTAAQYRKDRRQRDLEAQRA plas(22),E.R.(3) GGGGGGGGRRHGRTG (1114-1128, prob:0.741) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4E2 Methylsterol monooxygenase Low 8.4 1 284-306 AGEEASKRRREKKLAELRAKKVQ plas(11),cyto(6),mito(5),pero(2),nucl(1),extr(1),E.R.(1) KRRREKKLAELRAKK (290-304, prob:0.901) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q553 Uncharacterized protein Low 9.8 1 5-36 GPTARRRNHAWLQMRNRLRRSEQLARRQQQDD nucl(13),mito(6),cyto(3),golg(2),plas(1),extr(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5P7 Uncharacterized protein Low 8.5 1 773-801 REEARKVKEKLREEKRAARRRLRDEAGKR mito(9),cyto(6.5),cyto_nucl(4.5),extr(4),plas(2),golg(2),nucl(1.5) EAARRRAAAREEKARAREEARKVKEKLREEKRAARRRLRDEAGKRG (757-802, prob:0.997) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6L0 Ribonuclease P protein subunit Low 9.9 1 45-78 PPPSDARAARRRAREKKKQQRKKALKPKPLSATQ cyto(13.5),cyto_nucl(11.333),nucl(8),mito_nucl(6.333),mito(3.5) RAARRRAREKKKQQRKKALKPKPLSATQRR (51-80, prob:0.998) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8K2 WD_REPEATS_REGION domain-containing protein Low 9.4 1 169-191 EGTSERKSKKGSRKGQNDQSEAD cyto(17.5),cyto_mito(11),nucl(5),mito(3.5) KK (177-178, prob:0.615) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QA65 Zn(2)-C6 fungal-type domain-containing protein Low 8.5 1 57-83 IRESNKYQFKFGKRQRWVKTPRRLVFI mito(10),nucl(9),cyto(5),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QD93 Glycoside hydrolase family 1 protein Low 5.6 1 448-472 VDYANDQKRYPKKSAKSLKPLFDSL cyto(20.5),cyto_nucl(12),nucl(2.5),pero(2),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QF17 Usp domain-containing protein Low 6.8 1 650-679 SSVPVMVARKRLRKQSKYKHLPSTNQINNI cyto(12.5),cyto_nucl(10),mito(8),nucl(6.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIF5 Uncharacterized protein (Fragment) Low 5 1 278-299 FATATGKKSHKSHKDNNTWIEL plas(18),E.R.(4),mito(2),pero(1),golg(1),vacu(1),cyto_mito(1),mito_nucl(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJ48 Uncharacterized protein Low 8 1 67-89 GQTTNFRRWRVRRQFGKGKGKGK cyto(19),extr(5),mito(3) RRWRVRRQFGKGKGKGKGKGKGKGKGKGKGKGKGKGKGKGKGAGG (73-117, prob:1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKB5 Uncharacterized protein Low 9 1 245-268 DEDATLRRRHKDVRKRRSSCNTSD plas(10),E.R.(5),nucl(3),vacu(3),mito(2),cyto(2),extr(2),cyto_mito(2) RRHKDVRKR (252-260, prob:0.649) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN33 SPX domain-containing protein Low 8.4 1 136-161 YTGFLKIVKKHDRKRGDRYKIRPMMM plas(18),mito(6),nucl(1),cyto(1),cyto_nucl(1),vacu(1) DRKR (147-150, prob:0.642) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNE0 Uncharacterized protein Low 8 1 122-148 IEGANGEKRKRKDRTRGSPTNGWRERP mito(10),cyto(8),mito_nucl(8) GEKRKRKDRTRGSPTNGWRERPGSPNGGPGRL (127-158, prob:0.956) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNQ2 Uncharacterized protein (Fragment) Low 8.8 1 40-61 TLEKSQPETRRQKQKGRDSSYC nucl(13.5),cyto_nucl(9.5),mito(8),cyto(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4I7 Uncharacterized protein Low 8.7 1 71-90 VLAHGPGRRRWRRRIRGGGG mito(15),extr(8),nucl(2),cyto(2),cyto_nucl(2) VGRVLAHGPGRRRWRRRIRGGGGGGRRLGR (68-97, prob:0.992) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5L1 Nicotinate-nucleotide pyrophosphorylase [carboxylating] Low 5 1 237-256 KATSRSLKEKWKGKKQFLLE cyto(18),cyto_nucl(11.5),mito(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6Q6 MICOS complex subunit MIC60 Low 6 1 111-133 MPPPPVPPRKKGFFRRLRNFVLT mito(19),cyto_nucl(4.5),cyto(4),nucl(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7F5 Protein FYV4, mitochondrial Low 8 1 217-236 RAEIRFKRRVAERKALREAQ mito(22.5),cyto_mito(13),cyto(2.5) RGHKVDGGERRRAEIRFKRRVAERKA (206-231, prob:0.909) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAA7 Elongator complex protein 3 Low 7.1 1 53-75 NLNTLRSKFAKKHKINNVPPLTA cyto(12.5),cyto_nucl(10.5),nucl(7.5),mito(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QB46 Uncharacterized protein Low 5 1 147-168 FPNSAAPRAGRRRKERECSQAD extr(12),mito(11),plas(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QC51 Uncharacterized protein (Fragment) Low 6.2 1 38-60 LPSRQPAPPGRHKHRQQEEDDRE mito(13),extr(9),nucl(3.5),cyto_nucl(2.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCB4 Uncharacterized protein Low 9.3 1 419-440 FGPGKHHKKTGRRRMRSGREAD cyto(8.5),cyto_nucl(7),nucl(4.5),mito(4),plas(4),extr(2),pero(1),E.R.(1),golg(1),vacu(1) GKHHKKTGRRRMRS (422-435, prob:0.879) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCR5 Uncharacterized protein Low 7.7 1 427-448 LALRHKVRKTRCNSGLRCRDVS cyto_nucl(12.5),cyto(11),nucl(10),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QDD1 Zn(2)-C6 fungal-type domain-containing protein Low 9.2 1 23-49 PGAACEECRKRKLRCDRQRPQCGTCAD nucl(11),mito(6),cyto(5),plas(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHC2 AMP-binding domain-containing protein Low 9.1 1 73-97 AIGSRKLIKIHKEKKKVPKIVDGQT cyto(12.5),cyto_nucl(8.5),mito(8),nucl(3.5) RKLIKIHKEKKKV (77-89, prob:0.806) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QK24 Uncharacterized protein Low 9.3 1 33-55 GFPAHKKRVSAFKQQRQKKPAGA nucl(16),cyto_nucl(13),cyto(8) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QK52 acidPPc domain-containing protein Low 5 1 32-55 QLNPIPHKYRSARKLRLHLRVSRG plas(19),mito(2),E.R.(2),golg(2),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQ76 Acetyl-coenzyme A synthetase Low 5.5 1 17-38 VDTYHPPKKMLEKHPSKPHLSG cyto(19),cyto_nucl(11.5),nucl(2),mito(2),plas(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1J7 Palmitoyltransferase Low 8 1 83-111 PLGPKATEKSTKTKRRRRREQDLETAQRY plas(15),E.R.(5),mito(2),vacu(2),cyto(1),extr(1),pero(1),mito_nucl(1),cyto_pero(1) KSTKTKRRRRR (91-101, prob:0.858) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1N0 Uncharacterized protein Low 9.5 1 65-88 RTRGTWSSSKRPRTRSSRGPPSFS nucl(16.5),cyto_nucl(12.5),cyto(7.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4I0 Uncharacterized protein Low 9.4 2 2-21, 72-93 VNIPKTRKTFCKGSQCNKHT, LECSQCKTKKQLPLKRCKHFEL mito(11),nucl(8.5),cyto_nucl(8.5),cyto(7.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5Z2 Uncharacterized protein Low 8 1 13-38 DDSEPSQSSSKRRREQQSLRPKQVEG cyto_nucl(11.5),nucl(11),cyto(10),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8F1 Glycosyltransferase family 8 protein Low 9.9 1 345-372 VHYILTPKPWEKKQKKKEEETKVKAKAV extr(14),nucl(5),cyto(4),mito(2),pero(2) WEKKQKKKEEETKVKA (354-369, prob:0.831) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAX1 Cytochrome-b5 reductase Low 7.7 1 42-64 LEEPRQPEPRRRRASTRLIAQSP cyto(10.5),cyto_nucl(10.5),nucl(9.5),pero(3),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QD00 MFS domain-containing protein Low 5 1 466-485 AITWENKKRSKQVHDLNLTE plas(27) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QH92 Uncharacterized protein Low 8 1 177-203 NNEAAKRSIERPKKRWRRDYEGRYAFG mito(22),cyto(4) KRSIERPKKRWRR (182-194, prob:0.843) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2PZS2 Trehalase Low 5 1 670-693 AWTKMFGRSKLRRREAEDVRKRWS extr(18),mito(6),cyto(1),pero(1),vacu(1),cyto_pero(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3N4 Ppx-GppA domain-containing protein Low 5.8 1 574-594 HETFRGLKKHRRSGREVSVTV cyto(10.5),cyto_nucl(7),mito(5),plas(4),extr(3),nucl(2.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3Q8 Uncharacterized protein Low 9 1 147-175 ALLPQHHRLRRPRRPRRRHLVRRRSGTPA extr(16),mito(5),nucl(3),cyto(3),cyto_nucl(3) HRLRRPRRPRRRHLVRRRS (153-171, prob:0.989) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7E6 Glycoside hydrolase family 28 protein Low 5 1 349-370 LPQTCNCNNNNNNNNNNRKRGN extr(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCD1 Oxidored_q6 domain-containing protein Low 7.4 1 102-121 IFQLQRKMRRTKITRMWYRK nucl(9.5),cyto_nucl(8.833),cyto(7),mito(6),cyto_pero(5.333),pero(2.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEV5 Calcium-transporting ATPase Low 7 2 273-293, 364-383 NEPFSSRKRVFRDNRLPVKKG, QKERQFARLNKKKQDRLVKA plas(23),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QG60 Uncharacterized protein Low 5 1 63-86 WERSLDRLRAKRCRRLNIRATSGV cyto(12),pero(6),cysk(5),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPY6 MFS domain-containing protein Low 8 1 103-122 GSLKKRHHGGRSSKRVRYSE plas(19),mito(4),E.R.(3) KRHHGGRS (107-114, prob:0.642) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQF7 Uncharacterized protein Low 9.5 1 241-266 IGLFFFLRWRRKKRLKKAPSDIPPPV mito(13),nucl(4),plas(4),extr(3),cyto_nucl(3) WRRKKRLKKAPSDIPPP (249-265, prob:0.957) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1P1 Palmitoyltransferase PFA4 Low 5 1 109-130 LRPTRFCKKCDAPKPLRAHHCR extr(16),mito(8),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1V3 Nuclear pore complex protein Low 7.6 1 79-105 DSYYTYTRRRADRLRERQPRERSVRGG nucl(8.5),cyto_nucl(8),pero(8),cyto(6.5),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4F2 Uncharacterized protein Low 5 1 29-52 PIPIRRTPVRRTRRTCPCPGPRPE mito(12),plas(6),cyto(5),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q658 Uncharacterized protein Low 8.3 1 672-691 FATHQHRKKKWSQAAACMIA mito(10),nucl(9),cyto(5),plas(1),extr(1),pero(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6W2 Uncharacterized protein Low 8.4 1 61-87 VRAVPPPYYYRRRPRRRPSPGDEPEEA mito(15),plas(3),extr(3),cyto(2),nucl(1),pero(1),E.R.(1),vacu(1) RRPRRR (72-77, prob:0.662) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9Q3 Structure-specific endonuclease subunit SLX1 Low 8 1 295-319 GQKEVEKLLKHRSRRRRAAATATKQ mito(24.5),cyto_mito(14) KLLKHRSRRRRAA (301-313, prob:0.865) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEZ6 Cytoplasmic tRNA 2-thiolation protein 1 Low 7 1 5-32 LCANCKTERALIKRPKNHAKLCKACFIR mito(16),nucl(6.5),cyto_nucl(6),cyto(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJT3 Protein kinase domain-containing protein Low 9.6 1 257-277 KAQMRRRSRGRAERPQVQRRL mito(10),cyto(6),nucl(4),pero(3),extr(2) KAQMRRRSRGRAER (257-270, prob:0.813) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLW2 CYCLIN domain-containing protein Low 8.4 1 418-443 WPGHHHRSNRHGHPSDRHRSRRGHGY nucl(13),cyto_nucl(11),cyto(7),mito(3),plas(1),pero(1),golg(1),cysk(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN47 Protein GET1 Low 5 1 182-207 LIAASRQSQRHKQKPMQKDRQPVPAA plas(20),extr(2),E.R.(2),cyto(1),golg(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNV3 Uncharacterized protein Low 5.8 1 598-620 ADPSARRQQQQQQQQQQQQQQST mito(20),cyto_mito(12.5),nucl(3),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0V4 Uncharacterized protein Low 9.9 1 846-871 NTYEGKRSRPWSQRITREKRDKGEVP nucl(15),mito(4.5),cyto_mito(4.5),cyto(3.5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q124 FAD-binding FR-type domain-containing protein Low 5 1 62-81 LLYAPLWRKRHNREIRLSSA plas(24),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q757 Zn(2)-C6 fungal-type domain-containing protein Low 6.4 1 13-37 GGACVRCRKGKTKCVYENGRSPCKN mito(15),nucl(4),cyto(2),extr(2),pero(2),E.R.(2),cyto_pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9C4 Cation-transporting ATPase Low 5 1 1317-1343 IGKLKVSVFKRTKVRKQYKVIQEQMLF plas(24),E.R.(1),golg(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAN4 Protein kinase domain-containing protein Low 9 1 291-310 ARGRYDQKRRRWRALRVLGQ nucl(14.5),cyto_nucl(10.5),mito(6),cyto(5.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAZ2 Uncharacterized protein Low 9 1 293-324 RRAGCVTRDPRRVERKKHGRVKARKRPTWVKR mito(21),nucl(3),cyto(3),cyto_nucl(3) DPRRVERKKHGRVKARKRPTWVKR (301-324, prob:0.993) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBB2 3'-5' exonuclease domain-containing protein Low 8 1 121-142 TDTVEKPKPKPKPKHSSTPDAV mito(16.5),cyto_mito(12.333),cyto(7),cyto_nucl(4.833) PKPKPKPK (127-134, prob:0.724) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHG3 SP-RING-type domain-containing protein Low 9.4 1 389-413 VGKSVNVKKEKDRSRRRMEEIDADD nucl(16),cyto_nucl(10.5),mito(7),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJU6 Methionine aminopeptidase Low 5.8 1 40-59 QECFKKNWATHKNIHKQENK cyto(19.5),cyto_nucl(14.833),cyto_mito(11.498),nucl(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMY4 Uncharacterized protein Low 9 1 162-185 EEEVVGRCRRPRRRRTGTATTSGG mito(15),nucl(10) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1W8 VPS37 C-terminal domain-containing protein Low 9 1 219-242 VKRYREAKKLYYLRQERKERWDEG nucl(15),cyto_nucl(11.5),cyto(6),mito(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5E2 Uncharacterized protein Low 7.7 1 106-127 VSREITRRARGRKDVRLPTPNP cyto(12.5),cyto_nucl(11.5),nucl(9.5),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QB87 Septin-type G domain-containing protein Low 8.3 1 52-76 FSTTIKNYADHKRRHQKQIDKTVEI nucl(12.5),cyto_nucl(11.5),cyto(9.5),mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCZ8 Autophagy-related protein 1 Low 6.5 1 936-957 AASKSQQQQQQQQQQQQQQQQQ mito(13.5),mito_nucl(10.666),cyto_nucl(7.333),nucl(6.5),cyto(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QD17 MFS domain-containing protein Low 8 1 327-350 ATDRLWRHLKEKKKKARGDGDAVP plas(20),E.R.(3),mito(2) RHLKEKKKKAR (333-343, prob:0.862) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QDP3 Zn(2)-C6 fungal-type domain-containing protein Low 8.8 1 11-38 ELAPQACQSCRSRKRRCDKALPKCSSCA nucl(10),plas(10),mito(4),cyto(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QET4 BHLH domain-containing protein Low 8.1 1 88-109 QQQQQQQQQQQQQRQQQQHPGF nucl(10.5),cyto_nucl(9.5),cyto(7.5),mito(3),plas(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QL10 DAGKc domain-containing protein Low 7.8 1 375-400 AYDARVEVRRRRRRQQQQQQQRDAVH cyto_nucl(12),nucl(10.5),cyto(10.5),mito(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q926 Methyltranfer_dom domain-containing protein Low 5 1 214-235 GLAEREKRVRNKKLYHRVRETV cyto_mito(9.166),mito(9),cyto(9),cyto_nucl(8) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QK72 Uncharacterized protein Low 8.9 2 1-21, 35-54 MTNLPRFHRRKKDVAPPTLIT, LPPSSPKRSFQKLSRFRVFH mito(19),nucl(5),cyto(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKU2 RING-type domain-containing protein Low 9 1 473-499 MTEMRAAIVRRRRRRRGLRFNCMNPEC plas(12),mito(5.5),cyto_mito(5.5),cyto(4.5),nucl(3) RRRRRRRG (482-489, prob:0.869) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMW5 TauD domain-containing protein Low 6.4 1 28-47 DKYLARAKRRQETEKLAKTL cyto(12),cyto_nucl(9.5),nucl(5),mito(5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN80 Ribosomal_L16 domain-containing protein Low 8 1 64-83 EPSLSRKKKMMKGRPRVPTG mito(26) RKKKMMKGRPR (69-79, prob:0.788) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0F1 MYND-type zinc finger protein samB Low 6.9 1 520-540 TFEAARPQQQQHQQRRREFQY cyto(9.5),cyto_nucl(8.5),nucl(6.5),pero(6),mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1C4 Uncharacterized protein Low 5 1 1-20 MANRIRKKSKSKPATSTLYT mito(23),cyto(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1D4 Rhomboid domain-containing protein Low 8 1 39-61 RCFSHCPVSSQKHQRPPPRGGHD plas(15),mito(6),E.R.(3),cyto_mito(3),mito_nucl(3) KKKEAKRR (546-553, prob:0.668) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5N6 MFS domain-containing protein Low 5 1 540-559 MEWRSIKKDRWLKWLNRAAP plas(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QDY5 STAS domain-containing protein Low 8 1 122-148 GVLSASSKKKNWRRRWAAKIRSQKMST plas(22),E.R.(3) KKKNWRRRWAAKI (129-141, prob:0.812) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGV0 Uncharacterized protein Low 5 1 101-122 SYNNWKQRRDAREQRHRHRPEI extr(13),mito(7),plas(3),cyto(1.5),cyto_nucl(1.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHE0 Arf-GAP domain-containing protein Low 7.5 1 26-49 LEPNKVCADCKRNKHPRWASWNLG mito(9),nucl(8.5),cyto_nucl(7.5),extr(6),cyto(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIB3 Uncharacterized protein Low 5 1 562-583 AAKLSTPQKKLARPNTPAKRSA extr(14),mito(9),cyto(1),plas(1),E.R.(1),golg(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1M6 UBC core domain-containing protein Low 7.8 1 154-178 REEREGKSKEFRRQCRKCVRESLGE mito(18),nucl(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q260 WD_REPEATS_REGION domain-containing protein Low 5.8 1 117-137 SPSSKDKKPVAVKKQTSKSRI mito(19),cyto(3),nucl(2),cyto_pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q464 Uncharacterized protein Low 8 1 26-49 FSTTKTAGSKPKTKVKPNHSILSF mito(12),nucl(10.5),cyto_nucl(8),cyto(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q712 Uncharacterized protein Low 9.1 1 68-104 SGAESRRGRIRHKDPNRSRSRRRKRFQKLLWVKQSYP plas(21),nucl(3),E.R.(3) SRRGRIRHKDPNRSRSRRRKRF (72-93, prob:0.986) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBU0 Carboxylic ester hydrolase Low 5 1 626-648 QQQQQQQGRKRDRWEPSTKRGGL extr(20),pero(2),mito(1),cyto(1),plas(1),E.R.(1),vacu(1),cyto_mito(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGY8 Cysteinyl-tRNA synthetase Low 9.4 1 773-797 GTELPKSQAKKLRKEWERQAKLHEE cyto(16.5),cyto_mito(9.5),nucl(5),pero(4) EKARQKEEARKAREKAEEEKWAKA (721-744, prob:0.875) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QH75 EngB-type G domain-containing protein Low 5 1 33-54 PSKYYPPSSKTNPQKKRATLAE mito(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHP4 Uncharacterized protein Low 8.8 1 653-677 LGLALWWRRRKRAQQQQREQYPSQY nucl(11),plas(6),mito(4),cyto(4),cyto_mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIJ2 MYND-type zinc finger protein samB (Fragment) Low 6.5 1 12-32 PYCSRDCQKADWKAHKKVCGK mito(20),nucl(4),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMG1 Uncharacterized protein Low 5 1 301-324 SGFKLTTISRRNQKRNFKHPLSLP plas(23),E.R.(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNA0 TRAM domain-containing protein Low 8 1 18-54 QASGQKQHGKRPFQGPQRKGAKHRRKQKTVQEGSHEE cyto(16.5),cyto_nucl(10.5),mito(7) HGKRPFQGPQRKGAKHRRKQK (25-45, prob:0.946) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPY8 Uncharacterized protein Low 6.4 1 11-45 DGQQQQKQQQQQQQEPQKRDRNLREQRHTNRNLDE plas(18),nucl(4),mito(2),cyto(2),cyto_mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0Q9 Zn(2)-C6 fungal-type domain-containing protein Low 6.5 1 1-43 MTVTKRRTHHKSRLGCKNCKTRKIKCDEKKPSCSNCIRRKVDC mito(18),cyto(5),nucl(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1G8 WD_REPEATS_REGION domain-containing protein Low 7.9 1 689-710 VFTEERQSRKSRYRMRGKAAAH nucl(11.5),cyto_nucl(9.333),cyto(6),cyto_mito(5.833),mito(4.5),extr(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q337 Uncharacterized protein Low 7.9 1 98-121 NLKEIFSPTPKKRRRVDDDDEDED mito(11),nucl(9.5),cyto_nucl(7.5),cyto(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6M8 Acetolactate synthase Low 5 1 672-694 ITWDSEKDKERRARMRERTGGLH mito(26.5),cyto_mito(14) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q762 Uncharacterized protein Low 5 1 92-112 WSAWDSKPSRRLRRRLELELF mito(12),plas(9),cyto(2),extr(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAA2 F-box domain-containing protein Low 8.8 1 22-44 HAEPKIATGRRPKRDSRTSSSSS nucl(15.5),cyto_nucl(14),cyto(11.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFP7 UDP-N-acetylglucosamine transferase subunit ALG13 Low 6.2 1 266-287 ADFANQRRQQQQQQQQQQQQDS cyto(19.5),cyto_nucl(13.5),nucl(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHV0 Squalene synthase Low 6.2 1 347-367 GVFRRYVRRIHQKNDPRDPNY cyto(8),golg(5),nucl(4),mito(4),E.R.(4),mito_nucl(4),cyto_pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN59 Elongator complex protein 1 Low 8 1 1183-1213 GSNVSRATSKNRRREEKKRARGRKGTVYEEE mito(25) SKNRRREEKKRARGRK (1191-1206, prob:0.978) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPH4 Uncharacterized protein Low 6.2 1 151-170 QPQSPPAKLKRRPSYTQKEL mito(14),cyto(4),extr(4),nucl(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0A5 ELMO domain-containing protein Low 8.8 1 311-332 GDASRKGSRKHNPEKWRRLGFE cyto(11.5),cyto_nucl(7.5),mito(5),plas(3),nucl(2.5),pero(2) SRKH (318-321, prob:0.623) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1Z7 Uncharacterized protein Low 5.4 1 345-364 TPEHPTTKSEHPKPPKPTSE extr(14),cyto(6),mito(4),nucl(1),pero(1),E.R.(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2N6 Alpha-1,3-glucosyltransferase Low 8 1 1-26 MAKPSPSSHKPRRKAKHAVDSPSSFR plas(23),E.R.(4) HKPRRKAK (9-16, prob:0.744) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5M9 Metallophos domain-containing protein Low 8.4 1 49-75 LRGRPFHPPSSRWRRRRPIRVVCLSDT mito(21),cyto(3),nucl(1),extr(1),pero(1) SRWRRRR (59-65, prob:0.706) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8K8 Uncharacterized protein Low 8 1 125-148 TSQRSAVRAPRRRSQRRLNSSGGQ extr(15),mito(10) RAPRLGRAGTRRRPLSTSQRSAVRAPRRRSQRR (109-141, prob:0.856) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8U8 Mechanosensitive ion channel protein Low 5.3 1 806-830 MDSASSTQRRSWRPRSRSTNRGSMS plas(24),nucl(1),mito(1),cyto(1),cyto_nucl(1),cyto_mito(1),mito_nucl(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCB9 Carboxylic ester hydrolase Low 5 1 52-71 TSGANRFKPPRRHVPLPGTE extr(23),mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHP8 GFO_IDH_MocA domain-containing protein Low 8.5 1 73-93 CDNRRTCQEWRRRYGIRRAYT mito(24),cyto_nucl(2),nucl(1.5),cyto(1.5) ARAHHRLARASGRGRAR (744-760, prob:0.723) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJE8 Uncharacterized protein Low 8 1 120-144 NHSSRRSGSRHHSRRRSSNPRPVVI extr(14),mito(6),cyto(4),plas(2),cyto_nucl(2) SRHHSRRR (128-135, prob:0.65) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLM6 Uncharacterized protein Low 9.9 1 250-274 KKGHYKQECRSPKKGWKPTPGKEIT nucl(18.5),cyto_nucl(13),cyto(6.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLZ2 Uncharacterized protein Low 6.5 1 138-160 LSLPPWRWKWRWRLPTLRRPAAA cyto(8),cyto_nucl(7.5),mito(6),nucl(5),plas(4),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMG0 Uncharacterized protein (Fragment) Low 8.2 1 49-69 AGRVRDRRRSRPSSPPPPPSC cyto(12),nucl(8),mito(3),extr(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN16 Methyltransf_11 domain-containing protein Low 5 1 235-262 LVPWVLKSQQKKQPKPQKSPRGDKAQAV mito(14),cyto(8),cyto_nucl(5.5),extr(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNK2 Uncharacterized protein Low 9.7 2 1-25, 243-262 MTSKRLRRCPYKKASKTPPKGDVDG, LNVFHMKKRSNTRRWMMEHK mito(11),nucl(9.5),cyto_nucl(8.5),cyto(6.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q069 CCHC-type domain-containing protein Low 9.1 1 8-39 VTCYNCGKKGHYKQECRSPKKEWKPTPGKEIT nucl(14.5),cyto_nucl(10.5),cyto(5.5),mito(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0A0 Serine/threonine-protein phosphatase 2A activator Low 9.3 1 32-54 IPNLRDRIPKLEPRRRKAEPANP cyto(12.5),cyto_nucl(9),nucl(4.5),cysk(4),mito(2),pero(2) RIPKLEPRRRKA (38-49, prob:0.786) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0Q4 Palmitoyltransferase Low 7.4 2 614-634, 638-658 GDQRLGSHRRAHRPARREIDL, VEMHNVKPQPRQQQQQPQTGF plas(24),nucl(1),cyto(1),cyto_nucl(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2N1 Ribosome biogenesis protein ERB1 Low 9.4 1 1-22 MGSKAADKKRKSRESDSESDDG nucl(15.5),cyto_nucl(10.5),mito(5),cyto(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q673 Uncharacterized protein Low 9.7 1 471-499 EEEQRMGRGERNKKKKRFRSLSPAAWRSG mito(18),nucl(5),cyto(2),pero(2),cyto_pero(2) GRGERNKKKKRFRSLS (477-492, prob:0.955) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8H6 Uncharacterized protein Low 5.7 1 508-534 GGRSRSNSNSPPRSPPRRRDTGNTTSP plas(15),E.R.(4),extr(3),nucl(2),cyto(1),pero(1),golg(1),mito_nucl(1),cyto_pero(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9C7 Uncharacterized protein Low 5 1 190-213 FPFLRPRRQHMRANRRQEDRPRRG plas(23),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAG0 Uncharacterized protein Low 8.4 1 477-498 MLANIRRKIRKHQRAKLRQAVT plas(11),extr(6),E.R.(5),nucl(1),mito(1),pero(1),golg(1),vacu(1),mito_nucl(1) IRRKIRKHQRAKLRQAVTVEPGRRRFKIP (481-509, prob:0.93) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBC4 Uncharacterized protein Low 8 1 27-47 AETQPARKTRPRQEQSPPPEL mito(9),nucl(8),pero(6),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QE24 Uncharacterized protein Low 9.4 1 900-924 DETPQESTPRRKKGSRQAQAQDTPA nucl(15.5),cyto_nucl(11.5),cyto(6.5),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN49 Peptidase A1 domain-containing protein Low 5 1 91-112 PSLFPVPRSNEKRKNNYSVSKP extr(26) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0C1 Protein-tyrosine-phosphatase Low 6.4 1 45-65 RSPSKRSQRALETQSRRKQPF mito(14),cyto(6),nucl(4),cyto_pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q367 Zn(2)-C6 fungal-type domain-containing protein Low 8.7 1 121-150 ITSCLECRRRKLKCAKTHPCLNCKKFQREC plas(12),nucl(10),mito(2),cyto(1),E.R.(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7X4 Uncharacterized protein Low 9.9 1 380-408 RGRGRGRGNGNGKKKHGRKKSDRGSGGYG extr(19),nucl(5),mito(1),plas(1),pero(1) SGRGRGRGRGNGNGKKKHGRKKSDR (378-402, prob:0.996) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q880 MYND-type zinc finger protein samB Low 6.9 1 580-610 WEEFTRQFAKCRRCRRTKYCSKECQKSAWAF cyto(10),cyto_nucl(9.833),cyto_mito(9.333),nucl(8.5),mito(7.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q916 N-acetyltransferase domain-containing protein Low 9.3 1 237-263 LLVFEVSRRRSRRRAFRRGVSPCQEFR mito(18),nucl(4),cyto(4),cyto_nucl(4) RRRSRRRAFR (244-253, prob:0.759) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QB80 Uncharacterized protein Low 5 1 223-242 SIPLRHSKKRTYEWRTSNNH extr(13),plas(9),E.R.(2),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCZ6 Mannosyltransferase Low 5 1 19-41 VGEPPRPKSKREEKHETTRRYEV plas(26) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEX0 UPF0029 domain-containing protein Low 7.3 1 448-471 AANTTGKSTKKPKTQRELEAEKEE cyto(10),nucl(7),mito(7),mito_nucl(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QH67 Tyrosinase-like protein Low 9.5 1 49-68 SSCGKPKVRVEWKKLKESEK nucl(15.5),cyto_nucl(10.5),cyto(4.5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QK38 Uncharacterized protein Low 6.9 1 76-101 QGLIKLYQRQRGKKLKQYQHAALKLA mito(7.5),mito_nucl(7.5),cyto(7),nucl(6.5),cyto_pero(6.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2L3 Uncharacterized protein (Fragment) Low 5 1 3-24 QARPLGSQKARRQKLRHAIKIM plas(16),mito(4),extr(3),E.R.(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3P8 TLC domain-containing protein Low 8 1 298-317 AVRKRFEPPKPGKKEPLPAE plas(21),E.R.(4) RKRFEPPKPGKKE (300-312, prob:0.766) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBK2 Cyclic pyranopterin monophosphate synthase Low 5 1 72-93 QSPVHPARSRRDRIRDAKPFSE mito(23.5),cyto_mito(13) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QC23 Glycosyltransferase family 55 protein Low 5 1 483-506 GNNNSRSHPHPHPRKPLSRPVRVL extr(14),mito(9),cyto(1),plas(1),pero(1),E.R.(1),cyto_pero(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCP0 Eukaryotic translation initiation factor 3 subunit C Low 9.3 1 149-171 NETLAKQKVTPKNKKLNATNARG nucl(16.5),cyto_nucl(13),cyto(8.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLN0 Uncharacterized protein Low 8 1 219-239 ELPKSSKFNRADKRQKRQEGE nucl(10.5),mito(10),cyto_nucl(8.5),cyto(5.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNH5 GlcNAc-PI synthesis protein Low 5 1 466-486 KIDICPDWPRKERKADGKDAG cyto(10),plas(7),cyto_mito(7),mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2PZP4 GPI-anchored wall transfer protein Low 5 1 114-133 DSPSARRKKPQLPPNAQSKT plas(24),E.R.(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q328 Protein kinase domain-containing protein Low 8.8 1 27-46 QLKTSKDKEHPPPPPNNVVE nucl(13.5),cyto_nucl(10),cyto(5.5),mito(4),plas(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5P3 Uncharacterized protein Low 9 1 1-23 MLTDPKRIKRRSDQPFKSQRSEE mito(11),nucl(10),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9U9 tRNA dimethylallyltransferase Low 5 1 439-458 ITSRKHQKAVRGARKRQLIP mito(26.5),cyto_mito(14) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QA54 Uncharacterized protein Low 5.4 1 913-939 GSQPCSAQVRQRSWKRRFLSLRYPVLF mito(13),cyto(11),nucl(1),extr(1),E.R.(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QD61 BRCT domain-containing protein Low 9.1 1 183-202 VAKYYKKKGDAQPKIHRPSH mito(17.5),cyto_mito(11.333),cyto_nucl(4.833),nucl(4.5),cyto(4) RRERERERKR (108-117, prob:0.721) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGQ5 Uncharacterized protein Low 8 1 48-73 VWLAPGKVKSRTRRRKEATTVSAKPN mito(11),plas(7),cyto_mito(7) KVKSRTRRRK (54-63, prob:0.732) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QH47 Phytase-like domain-containing protein Low 9.1 1 303-328 LLKYALRRTDKKKTKNKKKGGDVEVT extr(13),mito(6),nucl(3),cyto(2),pero(1),golg(1),vacu(1) KRRNTRLLKYALRRTDKKKTKNKKKG (297-322, prob:0.97) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJ31 G_PROTEIN_RECEP_F2_4 domain-containing protein Low 8 1 471-493 GEGVSRTRSRRMRSGRRVSAVKI plas(22),E.R.(3) RSRRMRSGRRVSAVK (478-492, prob:0.725) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLF4 Uncharacterized protein Low 5 1 16-40 SSSSSSSKGNTKRKPVKPPNDALLA plas(21),mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q093 Uncharacterized protein Low 5.4 1 558-577 ETRYRMSTFYQQQKRKLKEE cyto(9),extr(6),plas(4),E.R.(3),mito(2),nucl(1),pero(1),golg(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0H9 PALP domain-containing protein Low 8 1 33-55 YPELEARYQRRRKGSRRGSIFFG cyto(10),extr(7),cyto_mito(7),mito(4) RK (44-45, prob:0.606) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1U8 ENDO3c domain-containing protein Low 9.4 1 110-139 RYQRPTSRSAREKRETRTRRSRDSRQGSTS cyto(9.5),mito(8),cyto_nucl(7.5),nucl(4.5),cysk(3) AKKSR (283-287, prob:0.647) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q379 Carboxylic ester hydrolase Low 9.1 1 394-418 SPSPSSFPSKRTKKKKSRTEAEAAG mito(10),cyto(8.5),cyto_nucl(6.5),pero(4),nucl(3.5) KRTKKKKSR (403-411, prob:0.836) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8J6 Mevalonate kinase Low 6.4 1 54-77 TINLKINPRRSMKRKQSSPMMPAF cyto(9.5),cyto_nucl(7.5),plas(6),nucl(4.5),mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAH5 Uncharacterized protein Low 8 1 4-31 SPTPSAGHWPPRRPSKRSKLRNGSVIIP plas(21),E.R.(3),mito(2) RRPSKRSK (15-22, prob:0.707) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAI4 Uncharacterized protein Low 7.9 1 419-446 STYPPPNTTSQRKRHTPTQPMLRKRVVP cyto_nucl(11.5),nucl(10.5),cyto(9.5),pero(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QF81 Uncharacterized protein Low 9.1 1 89-108 VSRSRKPSFSGPPRPTRERR nucl(14.5),cyto_nucl(11.5),cyto(7.5),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFP3 Amidohydro_3 domain-containing protein Low 9.4 1 62-84 LVTSLWPKPSKERRKKFVASAMR cysk(13),cyto(7),nucl(4),cyto_pero(4) KERRK (72-76, prob:0.643) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGR4 Uncharacterized protein Low 5 1 566-589 KTTANPKRRFYRWRKLRRIHWGSE plas(20),mito(3),E.R.(2),cyto_mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIN6 Uncharacterized protein Low 8 1 46-75 GGGRTCTRARWRRCGRRRWRWRWRGAGWRW mito(17),cyto(7),extr(2) ARWRRCGRRRWRWRWRGAGWRWWARRRRVRVR (54-85, prob:0.973) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIZ9 Uncharacterized protein Low 7.4 1 12-35 ELFRLEQRYTRRRHRRSTFVSNAI mito(16),nucl(7.5),cyto_nucl(5.5),cyto(2.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJL7 Long-chain-alcohol oxidase Low 5 1 620-639 NKPEGRDKDKDKHKDKDEDE cyto(15),mito(6),pero(4),mito_nucl(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QK58 Letm1 RBD domain-containing protein Low 5.7 1 40-65 VATPRQCQRRRNHTSTSPEQHRRQHD mito(18),pero(3),nucl(2),cyto(2),cyto_nucl(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNX9 Uncharacterized protein Low 5 1 103-125 SEKFEVKARRKWRPNVHQKRLWS mito(26) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q113 Uncharacterized protein Low 8.7 1 88-111 RVGNPSYPPRRRRSQQQHQMPASF nucl(12.5),cyto_nucl(9),cyto(4.5),mito(3),pero(3),plas(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2Y4 Adenylyl cyclase-associated protein Low 8 1 362-385 APPGTKPKPESMRVKKPPKKELEG cyto(15.5),cyto_mito(14),mito(11.5) RGKSPAPPGTKPKPESMRVKKPPKK (357-381, prob:0.934) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q557 Uncharacterized protein Low 9.5 1 14-33 STTSSRRRSRTPVPAKPGIE nucl(14.5),mito(9),cyto_nucl(9) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6N5 RAD5-like protein Low 9.2 2 96-115, 760-786 VKAMQLKQTRKENEQRRKAM, LVNKAFQEKQGKQKKTKETRMADILKL cyto(10.5),cyto_nucl(9.5),nucl(7.5),mito(5),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9N8 Proton-translocating NAD(P)(+) transhydrogenase Low 5 1 53-77 AVVWCQRARHATRRKEQPKNAGLAL plas(12),E.R.(8),mito(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9P9 Uncharacterized protein Low 8.7 1 386-405 QMKLWHARRKAERTQWWEAA nucl(12.5),cyto_nucl(9),mito(6),cyto(4.5),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9W0 Uncharacterized protein Low 8.9 1 205-226 VKKIPDRPQKKAEKKTEQKPEP cyto_mito(9.666),cyto(9.5),mito(8.5),cyto_nucl(7.833),nucl(4),pero(3) RKVSVKKIPDRPQKKAEKK (201-219, prob:0.84) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAI7 DNA polymerase II subunit 2 Low 9.6 1 1-35 MIPIQSPRKSPRNNQQQSPGKGDKRAKPPPPSFFG mito(18),nucl(4),cyto(3) KRAK (24-27, prob:0.62) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QE31 Uncharacterized protein Low 5 1 29-48 NPSNHSKAKRSARKANHSLF extr(15),mito(9),cyto(1),pero(1),golg(1),cyto_pero(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEN4 Uncharacterized protein Low 6.1 1 549-574 SQFQQYQQQHHHRRHHHHHQQQQYLG mito(12),extr(5),nucl(3),cyto(2),plas(2),pero(2),cyto_pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QG97 A_deaminase domain-containing protein Low 8.8 1 4-33 LFQLIGWKLTSRRRRRRRRLDQRVEAALKK mito(20.5),cyto_mito(12),nucl(3) SRRRRRRRRL (14-23, prob:0.934) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIK7 Uncharacterized protein Low 8.7 1 84-103 IPHHRDQHWRRSRPNRTVQA nucl(14),cyto_nucl(14),cyto(10) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJZ9 Uncharacterized protein Low 8.7 1 271-295 LEERVRWREERKRAYRNKGAKPGRY mito(19),cyto(4),nucl(2),pero(2) REERKRAYRNKGAKP (278-292, prob:0.799) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLF0 FHA domain-containing protein Low 9.5 1 497-524 VTDGLRKPSLRNCRKQHKQYYWKRPKTP nucl(18.5),cyto_nucl(12.333),cyto(5),cyto_mito(4.833) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q593 Uncharacterized protein Low 9 1 1107-1129 NRLDPRSNKERGQRVRKLQLSDV nucl(13.5),cyto_nucl(10),cyto(5.5),mito(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QA94 Uncharacterized protein Low 7.5 1 1-24 MSRSTPRKARHRHHASNSGPRQVV mito(13),nucl(8),cyto_nucl(7),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAR7 Pex24p domain-containing protein Low 8.8 1 522-550 GEEGMGRRGQWRRRRWVRMVKRKKVAGSG plas(18),E.R.(3),nucl(2),pero(2) RRGQWRRRRWVRMVKRKKVAG (528-548, prob:0.947) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBZ5 Uncharacterized protein Low 8.9 1 297-334 RLMWERMHRTIKRNDRKQQREKRQKAKKELEEQRVRDE extr(8),cyto(5),golg(4),cyto_mito(4),nucl(3),mito(3),mito_nucl(3),cyto_pero(3) RMHRTIKRNDRKQQREKRQKAKK (302-324, prob:0.943) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QD32 Uncharacterized protein Low 8.9 1 708-727 EEQRSRSRIIPRPGSRRART nucl(15),cyto_nucl(12),cyto(7),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJD3 Uncharacterized protein Low 6.4 1 19-49 SSPPPAPWKNPLKNNQATKRRHPLRGFLKAI cyto(7.5),mito(7),cyto_nucl(6.5),nucl(4.5),extr(3),plas(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNM2 Uncharacterized protein Low 8.3 1 33-59 PTPSPSPRSPTPPPREKRKFAPQLVES nucl(11),mito(11),mito_nucl(11) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQ86 MFS domain-containing protein Low 5 1 75-96 GTVGRAKSKEWKKPLPNFGAGK plas(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q004 Ubiquinone biosynthesis protein COQ4, mitochondrial Low 8.5 1 262-290 VEPPPDLREIRKREREERKRQKEQAAAAA mito(15.5),cyto_mito(11),cyto(5.5),nucl(2),extr(2),pero(2) IRKREREERKRQK (271-283, prob:0.843) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q136 ABC1 domain-containing protein Low 7 2 31-54, 98-117 TPMLTPTPRPRPRLRLRLRPQLSP, QPRAARTFRRTRRWARRLAL mito(26) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4Q3 FAD-binding FR-type domain-containing protein Low 5 1 74-95 WAETRSDERKWRRLMRQPPGGD plas(19),extr(2),E.R.(2),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFV5 Uncharacterized protein Low 8 1 331-355 EEEDERKRIKEQRKQEEEKKKEEEE mito(19.5),cyto_mito(11.333),cyto(2),extr(2),cyto_nucl(1.833) ERKRIKEQRKQEEEKKKEEEEEKVRKEEEEKKKQAEKDGAADSRKK (335-380, prob:0.959) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJ01 Uncharacterized protein Low 7 2 25-49, 130-149 FVVRVTAKRRFYRRHDLPQPPHDPI, PPITTRRRSRTPRSFRPERF extr(9),mito(6),plas(6),cyto(2),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJ59 Carrier domain-containing protein (Fragment) Low 9.5 1 814-837 AADPARGRRQGRRRQRPVRLVFAS cyto(16.5),cyto_nucl(11.5),nucl(5.5),mito(3) ARGRRQGRRRQRP (818-830, prob:0.836) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLI0 Uncharacterized protein Low 8.8 1 148-168 GNRMSSRSKYGTKKPKKASVG mito(24),nucl(2) KKPKK (160-164, prob:0.679) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QND9 Uncharacterized protein Low 8.2 1 1468-1501 PVEEQKHQQKHQQQQQQKQKKKVQASKGCRRTGW nucl(11.5),cyto_nucl(11),cyto(7.5),mito(4),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNN4 RNA-dependent RNA polymerase Low 9.8 2 68-91, 1119-1144 PTRSQAFQLRKPKHPPTQARLELM, CLCIGCEKRSRDTRPRLRSSARNLES cyto(11),nucl(7),pero(4),cysk(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4W0 Lon protease homolog, mitochondrial Low 9.3 1 1070-1089 REKANRCKACENKKEDGEKS mito(21.5),cyto_mito(11.5),nucl(5) RGRK (149-152, prob:0.625) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q589 MMS1_N domain-containing protein Low 7 1 845-870 PSSVRKFCRGRTRPVWEQRLRKPRYG cyto(10.5),cyto_nucl(9),nucl(6.5),pero(4),mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5I2 Uncharacterized protein Low 8 1 58-85 GSLRRPPSAAPPKVKKGEKKREEEKFIE plas(21),E.R.(4) RRPPSAAPPKVKKGEKKR (61-78, prob:0.931) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6Y7 Uncharacterized protein Low 8.6 1 2-26 ADYQRDRMPPPRQPPQQQRVQPYGS nucl(13.5),cyto_nucl(12),cyto(9.5),mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QC11 Uncharacterized protein Low 9 1 404-423 QMKLWHARRKAERTQWWEAA nucl(13.5),cyto_nucl(9),mito(6),cyto(3.5),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QDC4 Uncharacterized protein Low 5 1 18-43 QVCHSVLSRREEKRRRNLEAARRGCS extr(11),plas(5),mito(3),cyto(3),cyto_mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGI8 Uncharacterized protein Low 5 1 246-267 SVIVFFYQRKRRRQAPVRAETP extr(18),plas(8) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKN9 Uncharacterized protein Low 5 1 1-20 MPSASRRSWRWLPRPKSFLG plas(12),mito(9),E.R.(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPX4 60S ribosomal protein L27 Low 8.3 1 50-71 SKITRRMSKSRQEKRSKVKPFI mito(24),nucl(1),cyto(1),cyto_nucl(1),pero(1),cyto_pero(1) RMSKSRQEKRSK (55-66, prob:0.704) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4K5 Uncharacterized protein Low 9.6 1 267-301 RGARWRKMLRGEREERRERERKKEMEQFARRRVEE plas(12),cyto(5),nucl(4),extr(2),E.R.(2) GARWRKMLRGEREERRERERKKEMEQFARRRVEEATKQLGAHAQKGKEGPPRPGVRVKP (268-326, prob:0.973) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q504 MFS domain-containing protein Low 5 1 457-480 NSLLLRRENARRRRGDRDHWVQGL plas(24),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q684 Telomere_reg-2 domain-containing protein Low 9 1 814-837 AANPKIKYKSQPAKAKPRVRAIPN cyto(12.5),mito(9),cyto_nucl(8.5),nucl(3.5) PRKPATRR (540-547, prob:0.678) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q775 AA_permease domain-containing protein Low 5 1 508-531 INILWWKFVKKTKRVRPEEVDLVT plas(27) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7Q8 CP-type G domain-containing protein Low 9 1 621-647 QMASGKKHFKGGRKGRGKRRGNVVDGD mito(13.5),cyto_mito(12),cyto(9.5),nucl(4) GKKHFKGGRKGRGKRRG (625-641, prob:0.983) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGD8 Uncharacterized protein (Fragment) Low 8.3 1 314-338 NDYVHVRKRARQQPQPQPQHQQEQP nucl(12),cyto_nucl(10.5),cyto(7),pero(4),mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGQ3 MFS domain-containing protein Low 5 1 82-108 SVRSRLSRVLSRKRTPQQRIPPTPIPV plas(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIM5 Protein kinase domain-containing protein Low 6.2 1 333-352 TGKKRRPFSRWYPVDPQFKD mito(12),cyto(5),nucl(3),plas(3),extr(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMK2 Uncharacterized protein (Fragment) Low 7.6 1 19-38 QVYKMIKKSRRYKAYVRRGR mito(17),nucl(7),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNI6 Uncharacterized protein Low 9.6 1 92-115 RQSFPYYSRNTNNRRRDQRSLSES mito(11.5),cyto_mito(10.665),cyto_nucl(10.333),cyto(8),nucl(7.5) AAKKALKIWKE (154-164, prob:0.683) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4Q6 Uncharacterized protein Low 8.6 1 186-207 HHRHHHLQQQQQRQRQRQQQEE mito(13),nucl(11.5),cyto_nucl(7.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8C6 Fe-S cluster assembly protein DRE2 Low 7.2 1 249-271 EQPPECRPQPGKKRRACKDCTCG cyto(14),cyto_nucl(12),nucl(8),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCF9 PUA domain-containing protein Low 8 1 379-411 EAVRLCVVERRRKKKKKNKGQRKDGKGKAKGGR cyto(14.5),mito(10),cyto_nucl(9) RRRKKKKKNKGQRKDGKGKAKGGR (388-411, prob:0.999) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCS8 Uncharacterized protein Low 6.3 1 198-218 RITTAKREETRRKKIDQFITL mito(18),cyto_mito(12),nucl(5),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QE08 Fungal_trans domain-containing protein Low 6.2 1 38-59 RQGFLRNPKKTPSRNNMKGLPE plas(18),nucl(3),E.R.(2),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGL0 Uncharacterized protein Low 8.2 1 1-24 MPTLSKFLPLRRLRRHKVTTSDAA mito(11),nucl(8),cyto(3),plas(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNB8 Uncharacterized protein Low 8 1 397-418 EAATSKLRVRRVRRGSAKVRLA extr(23),cyto(3) RRVRRGSAK (406-414, prob:0.672) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQ96 U6 snRNA-associated Sm-like protein LSm1 Low 9.5 1 122-149 VQNLAKQRKQQDKAKEKKKVKMLAREGF cyto_nucl(11),mito(10),cyto(9.5),nucl(5.5) KQQDKAKEKKKVK (130-142, prob:0.811) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2PZX8 Uncharacterized protein Low 8.5 1 150-169 GETMRRRSSRSNGQRPRARQ mito(9),plas(7),vacu(4),cyto(3.5),cyto_nucl(3),nucl(1.5) RPRA (164-167, prob:0.626) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q354 Uncharacterized protein Low 5 1 56-77 VGAFKVPKWKRLHKLAHDSLSS plas(20),E.R.(3),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q425 Tr-type G domain-containing protein Low 9.4 1 362-381 YFNPRKRNFTRKPIEKEAKR nucl(17.5),cyto_nucl(13.5),cyto(8.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q441 Uncharacterized protein Low 9.2 1 3-26 SIGPQLPPHLQKRKRTPEDEEAES nucl(17),cyto_nucl(14),cyto(9) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6B3 Uncharacterized protein Low 9.4 1 13-34 LYRQCIRECRKKPEANRKHFQA nucl(12),mito(11),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8V4 FAD-binding FR-type domain-containing protein Low 6.9 1 74-98 TSSPSAASPRRRRRHTPDPSHDPNH cyto(14.5),cyto_nucl(11),nucl(6.5),mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QD02 Uncharacterized protein Low 5 1 215-240 ECANKEKGCLRQKRNVKWKVGSNTAK extr(23),mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFQ3 CAP10 domain-containing protein Low 5.4 1 2-29 GEKTRFQMMMRPRPRHNRRQLRQITLVI mito(13),plas(9),E.R.(2),nucl(1),extr(1),pero(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHB2 Nicotinamide-nucleotide adenylyltransferase Low 7.9 1 26-50 QQSYTFPTEKLKRRQTQPGKTPLVL cyto(13.5),cyto_nucl(12.5),nucl(10.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QI80 Mitochondrial transcription factor 1 Low 7 1 53-72 TTPKTTTTPRSGTKRRLTKS cyto(7.5),cyto_nucl(7.5),nucl(6.5),mito(4),plas(4),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLX6 Histone transcription regulator 3 homolog Low 7.8 1 438-460 EETADVKRSKRTRRRDTAAEEAM nucl(13),cyto_nucl(11.333),cyto_mito(7.666),cyto(7.5),mito(6.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0G8 Uncharacterized protein Low 9.6 2 126-151, 645-669 PQFLYQEKWCQRRRVRIKPSEGEKAQ, AENTDRVKWCKDRKINLRNMKQALN nucl(12),cyto_nucl(10.333),mito_nucl(9.833),cyto(7.5),mito(6.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q823 IFRD domain-containing protein Low 8.7 1 325-345 RDSSKTVSKKGRRNLRANFSS mito(13),nucl(10),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QD48 Uncharacterized protein Low 8.7 1 414-433 QTKLWHARRKAERTQWWEAA nucl(12.5),cyto_nucl(9),cyto(4.5),mito(4),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFT1 Uncharacterized protein Low 9.1 1 291-318 DESQNKENNNNKKKNKEKKRIRVVYYEV mito(15.5),cyto_mito(11.5),cyto(6.5),nucl(4) KKKNKEKKRI (302-311, prob:0.861) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIC1 DNA damage-binding protein CMR1 Low 9.7 1 38-59 LPKPAPPKPKRSSTARVKRESV cyto(10.5),cyto_mito(8.5),nucl(6),mito(5.5),pero(5) PKPAPPKPKRSSTARVKRESVQREPPRPTRQSSRLA (39-74, prob:0.943) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QM31 Uncharacterized protein Low 9.4 1 483-504 ELQGFMIKRKGKPKKAADDVGR mito(6),cyto(5.5),cyto_nucl(5.5),plas(5),nucl(4.5),pero(2),E.R.(1),golg(1),cysk(1),vacu(1) KRKGKPKKA (490-498, prob:0.849) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMV7 Uncharacterized protein Low 5 1 587-610 LWERRRVWARRAKSSRFRYWRYFA plas(27) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNW2 alpha-1,2-Mannosidase Low 5 1 43-65 LLRPSRPHLHHHHHHHHPHPHAD mito(13),plas(5),cyto(2),extr(2),pero(2),cyto_pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPJ8 Uncharacterized protein Low 8.7 1 73-95 LKAVPKKKTSHMKKRHRQMAGKA mito(21),mito_nucl(12.833),cyto_mito(11.833),nucl(3.5) PKKKTSHMKKRHRQ (77-90, prob:0.862) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPU8 Kinetochore protein SPC25 Low 8.2 1 209-230 DYDVRHCRPKLEREKVERVLER cyto(9),nucl(8),mito(5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQG8 General transcription and DNA repair factor IIH helicase subunit XPD Low 9.3 1 676-695 LADRRFQRKRAQLPKWISQA nucl(12),cyto(8),pero(4),cyto_mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q155 Uncharacterized protein Low 5 1 38-65 EEWRRRATTCERRQQTTRKARPQADQAL plas(26) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5J6 Uncharacterized protein Low 5 1 5-25 FMALRFWCKRRYHKVIGLDDY plas(19),E.R.(4),mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBF8 Uncharacterized protein Low 9.9 1 9-38 TCYNYGKKGHYKRECRSPKKEWKLVPRKEI nucl(18.5),cyto_nucl(12),cyto(4.5),mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QD35 Uncharacterized protein Low 8 1 83-105 GLLAYLRHRRRRKGKETEVAMKE mito(11),cyto(5.5),cyto_nucl(4),E.R.(4),extr(3),pero(2) HRRRRKGK (90-97, prob:0.808) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QG13 Uncharacterized protein Low 8 1 1332-1356 DALIESLLRRKKKKKAEEDAPVTLD plas(20),E.R.(5) RRKKKKK (1340-1346, prob:0.883) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QII3 Uncharacterized protein Low 9.2 1 50-72 QNYYPPQQQQQQRQYQRPPGPPP nucl(15.5),cyto_nucl(12),cyto(5.5),mito(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QLJ4 zf-C2HE domain-containing protein Low 8.5 1 211-233 SRDMRSEKLKHRKHYNSFNTPFF nucl(12.5),cyto_nucl(10.5),cyto(7.5),pero(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMR6 Beta-glucosidase Low 5.8 1 8-28 QGLLRDSKRSPQRPKDDAGHD plas(9),mito(6),pero(5),cyto(3),nucl(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN56 AKAP7_NLS domain-containing protein Low 8 1 266-285 GSRGKGGRGRRGGKKWERLV mito(18),cyto(5),extr(3),cyto_nucl(3) GEGGGSRGKGGRGRRGGKKW (262-281, prob:0.973) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPL5 Zn(2)-C6 fungal-type domain-containing protein Low 9.7 1 1-34 MEPERRRRRPAVTCILCRKRKIRCDRQLPCSNCT mito(15),nucl(5),cyto(5),cyto_nucl(5) RRSKELGRIIKKRRA (217-231, prob:0.822) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0T5 N-acetyltransferase domain-containing protein Low 6.4 1 24-43 RTFIRVRTTRPRQPFPPHSV cyto(12),cyto_nucl(9.5),nucl(5),mito(5),extr(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q106 TPT domain-containing protein Low 8 1 75-105 DEETGLTGRDRRRKRRKKRRNQLLDQRVVGD plas(24),E.R.(1),golg(1),vacu(1) RDRRRKRRKKRR (83-94, prob:0.993) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2L9 Mediator of RNA polymerase II transcription subunit 14 Low 6.8 1 1100-1123 QQQPQQPQQPQQQQQQQQQQQQQQ mito(8),cyto_nucl(7.5),cyto(7),nucl(6),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2W2 DUF1746 domain-containing protein Low 9.4 1 38-63 VRSDETSASRRQKRRREGLVKKLELV plas(16),nucl(4),cyto(4),cyto_nucl(4) RQKRRRE (48-54, prob:0.727) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q382 Uncharacterized protein Low 5 1 20-39 QPHNHGHRHLHAKKHNHLQM extr(22),cyto(2),mito(1),cyto_nucl(1),E.R.(1),golg(1),cyto_pero(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4R0 Uncharacterized protein Low 6.9 1 14-35 NTDADKRLQKKQPSRVYVNEEA mito(16),cyto(6),nucl(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6P4 Purple acid phosphatase Low 8 1 597-618 ELTLIKKKPGRRGGGDSKHRYG extr(23),mito(2),pero(2) KKKPGRRGGG (602-611, prob:0.794) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q951 Uncharacterized protein Low 8.8 1 434-477 IEFKHKRVYSLKPPRKARGWEAKRQGPKYRHLWKYTKRIKGIKF mito(21.5),cyto_mito(12.5),nucl(3) KRVYSLKPPRKARGWEAKRQGPKYRHLWKYTKRIKGIK (439-476, prob:0.966) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QC15 Uncharacterized protein Low 8 1 24-45 LRSCCLRRWRHRTKSLAPRRGK plas(9),extr(6),mito(5),pero(2),E.R.(2),golg(2) WRHRTKSLAPRRGKFR (32-47, prob:0.794) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPB4 Uncharacterized protein Low 6.3 1 1-23 MSDQRLPVRRRFKRLKIAIASCN mito(23),nucl(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQD3 TPT domain-containing protein Low 5 1 78-97 SYLGRWHPRRDSRVKWGPRE plas(21),mito(3),cyto(1),E.R.(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1C2 Uncharacterized protein (Fragment) Low 9.6 1 147-167 CPLGPRCDKKHVRRRMCPYYL mito(20),nucl(4.5),cyto_nucl(4) KPKEKEEKAKEDGADEREKEGEREKEKEREREREREREREMQRER (193-237, prob:0.953) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q284 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase Low 5 1 474-496 RVLGIKWKKGTKRPDKSNAIDLL cyto(25.5),cyto_nucl(13.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4L3 Uncharacterized protein Low 8 1 352-379 GLKDLFRGNYVRKRKKKGDPSAGTRSHG plas(21),mito(4) RKRKKKG (363-369, prob:0.819) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6F0 Uncharacterized protein Low 8 1 879-904 ELGVRRVRRFTEKRRVRKSQIRRPFL plas(26) RVRRFTEKRRVRKSQIRR (884-901, prob:0.85) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q946 Zn(2)-C6 fungal-type domain-containing protein Low 9.4 1 74-93 CDMCRKKKIKCDGKLPACTH nucl(17.5),cyto_nucl(13.5),cyto(8.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QA82 DUF2183 domain-containing protein Low 7.5 1 305-327 TEKYKIDRIKKIQRWLPRRKVIC nucl(8.5),mito(8),cyto_nucl(8),cyto(6.5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBR2 Uncharacterized protein Low 5.8 1 35-61 ANQVRLQQQQQGRRRRQQQRDYAVFLR mito(20.5),cyto_mito(12),nucl(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QC87 Uncharacterized protein Low 8 1 539-573 MPDGSERVKYKRVKPKKRKKRKQGQWTRQRRRSVW plas(26) VKYKRVKPKKRKKRKQGQWTRQRRR (546-570, prob:0.999) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJU2 Uncharacterized protein Low 5 1 226-248 NGGTTRCGRNRNNKNRNGNNGNN extr(26) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8P4 Ribosomal_L16 domain-containing protein Low 6.4 1 1-31 MARRPARCYRYCKNKPYPKSRFNRGVPDPKI mito(15),cyto(6),nucl(4),cyto_pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q947 Uncharacterized protein Low 9 1 17-41 GTRHDHDHHHHHHHNHNHNHNHQHL nucl(10),cyto(5),plas(5),mito(3),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEP4 Uncharacterized protein Low 7.7 2 393-413, 569-589 DARSSHRLRRRRKELDDEDKG, LPSSNRWHSPRQKIPLQKARP plas(15),E.R.(3),nucl(2),cyto(2),cyto_nucl(2),pero(2),cyto_pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QK16 Uncharacterized protein Low 8.7 1 553-578 SGDGAVSPRKTRRKRQEGVRVKVKDV plas(18),mito(4),nucl(2),cyto(1),E.R.(1),vacu(1) RKTRRKRQE (561-569, prob:0.785) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKS1 Mitogen-activated protein kinase Low 8.3 1 248-269 RFVKSLPRRERQPLKNKFKNAD nucl(11),cyto(11),cyto_nucl(11) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMZ9 WD_REPEATS_REGION domain-containing protein Low 9.8 1 136-168 LRHLTRRTLRLPKTPRKDPKKDLYKVLRKNPTF mito(18),nucl(5.5),cyto_nucl(4.5),cyto(2.5) PKTPRKDPKK (147-156, prob:0.698) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQA0 Glyco_hydro_63 domain-containing protein Low 8.6 1 11-39 TEEERRLKEDRERKKYWKKWGSYLSERQW nucl(13.5),cyto_nucl(12),cyto(9.5),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1P4 Uncharacterized protein Low 7.2 1 122-146 LPAQNVLKKKPYRRLARREHPVSSF cyto(8.5),cyto_nucl(8.5),nucl(7.5),mito(5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3C3 Uncharacterized protein Low 5 1 206-226 ATEGRQKQTKHRNSPDHPTQQ mito(25.5),cyto_mito(13.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5A6 Uncharacterized protein Low 5 1 236-255 CLRNRAVTRRRRRAPPSLPF extr(19),mito(3),E.R.(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6J5 DOMON domain-containing protein Low 5 1 388-409 IYFCLWKCSKRGREKEGSIEMP plas(19),E.R.(3),mito(2),extr(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7K1 Zn(2)-C6 fungal-type domain-containing protein Low 8.8 1 21-43 AQACDRCRSKKIRCDGIRPTCSQ nucl(12.5),cyto_nucl(9),mito(7),cyto(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q871 Phosphoinositide phospholipase C Low 7.6 1 242-261 MTLTKVSKKKSTKRITLYLD mito(14.5),mito_nucl(12.5),nucl(9.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHQ8 DRMBL domain-containing protein Low 7.9 1 44-63 ILEARVQKYRHLRNLFKPIP nucl(12),cyto_nucl(11.333),cyto(8.5),cyto_mito(6.666),mito(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2PZT1 PX domain-containing protein YPT35 Low 9.6 1 313-333 LPPKSVLKRFHPRFLEKRRAG nucl(19),cyto_nucl(15),cyto(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0Z2 Uncharacterized protein Low 9.1 1 78-97 RDGNPKPPPNKARDKLQRLT nucl(16.5),cyto_nucl(13),cyto(6.5),mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2X8 GPI inositol-deacylase Low 8 1 33-56 RPAARPASKLDRRRSADRRPSLSI plas(25) DRRRS (43-47, prob:0.645) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3D1 Fungal-specific transcription factor-like protein Low 8.2 1 44-80 ITTPHACAECKRRKIRAPKRCFYDKHRQRVIPSRKTL mito(12),nucl(8),cyto(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAC2 Uncharacterized protein Low 9.3 1 325-345 RDEFIERRKRHGKGRTRVVID cyto(12.5),cyto_nucl(9),pero(5),nucl(4.5),mito(4) RKRHGKG (332-338, prob:0.698) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBW6 Uncharacterized protein Low 6.3 1 39-60 ALLVLLRRRRRQKQMMDEKLPQ extr(6),E.R.(6),cyto_nucl(5.5),cyto(5),nucl(4),mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCR2 Palmitoyltransferase Low 5 1 447-474 CMIRTPLRSKHCRRCQRCVAKHDHHCPW plas(27) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJR3 26S proteasome regulatory subunit RPN2 Low 9 1 917-940 LSTTAQAKRRAQKKERAQRRESMD cyto(14.5),cyto_nucl(9.5),cysk(7),nucl(3.5) KRRAQKKERA (924-933, prob:0.705) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN96 Chromatin modification-related protein EAF3 Low 7.8 1 1-23 MPPQKHHHHHHHHQQQQPPFQKD nucl(9.5),cyto_nucl(8.5),cyto(6.5),pero(6),mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0Y5 DUF3395 domain-containing protein Low 8.1 1 641-664 AFAAWECYRRRRWCARKASSTSTT mito(13),nucl(8),cyto(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3A6 Uncharacterized protein Low 8 1 193-224 EAEPMRTMIKKKRRCRRAKRVTSKHRYTVLRI mito(23),cyto(3) KKKRRCRRAKRVT (202-214, prob:0.915) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4R2 Uncharacterized protein Low 6.1 1 383-403 VANGKLVKKNRWSHRGAKSTA mito(17.5),cyto_mito(11),nucl(4),cyto(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5R7 Protein-serine/threonine kinase Low 5.7 1 27-52 STSAHQHSPRRHHGDRERRRHDHDVV mito(23),nucl(2),cyto(2),cyto_nucl(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q626 Inorganic pyrophosphatase-like protein Low 5 1 353-375 DEPWVIRYRKRHMLRKIFDREVR plas(16),mito(6),E.R.(2),cyto(1),pero(1),vacu(1),cyto_pero(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7I5 ABC transporter domain-containing protein Low 5.8 1 254-277 RDDLRERGPRSQHKHKRGPEGWTY cyto(15),cyto_nucl(10),mito(4),pero(4),nucl(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q8P9 SP-RING-type domain-containing protein (Fragment) Low 7.5 1 1-23 MNPGAQPRKKISRPSVPRPPAVQ nucl(8.5),mito(8),cyto_nucl(8),cyto(6.5),plas(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9C9 Serine/threonine-protein phosphatase Low 8.1 2 61-82, 352-371 ELRQGARPPKTRQPPTPPREAD, LDDIRRFDRHKQRQPGQSGL cyto(16),pero(5),nucl(3),golg(1),cysk(1),vacu(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QC43 Uncharacterized protein Low 7.3 1 1060-1086 ADSQQREYSYRHRHRHRHQRSGSSGGA mito(10),nucl(7),cyto_nucl(7),cyto(5),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIL0 Uncharacterized protein Low 5.4 1 304-323 CALFYCWRRRKNLREEQELD extr(13),mito(5),cyto(4),pero(2),nucl(1),E.R.(1),golg(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5I8 N-acetyltransferase domain-containing protein Low 9.4 1 485-508 SSGSRSSSTARKKRERTYPSAAFG nucl(15),cyto_nucl(10),mito(9) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6U0 Glycosyltransferase family 17 protein Low 5 1 51-72 ICRPHGWKPFRTKDPGKPRKVY E.R.(7),golg(7),plas(6),extr(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q708 T5orf172 domain-containing protein (Fragment) Low 7.3 1 241-260 GPRWCRSPGRSPRQGACRGR mito(11),nucl(7.5),cyto_nucl(7.5),cyto(6.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBM3 Uncharacterized protein Low 8.9 1 1-22 MPSSEQHPPRPRQQPQEPADTD nucl(13.5),cyto_nucl(10.5),cyto(6.5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCB8 Protein kinase domain-containing protein Low 7.6 1 1087-1106 EQQRYFKQRKAYHDKNHSLF plas(12),nucl(7),cyto(4),mito_nucl(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QE18 Glycoside hydrolase family 16 protein Low 5 1 319-341 STDPDETKRSRRRQQQDGDGCNA extr(22),mito(2),plas(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QK91 TFIID_20kDa domain-containing protein Low 9.4 1 48-72 GRMLSQKLQQRRQAQQQQNQQQQQQ nucl(16),cyto_nucl(13.5),cyto(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QL71 RNA polymerase II subunit B1 CTD phosphatase RPAP2 homolog Low 8.8 1 2-24 ATSTNDRQSKPKPKGILKQPSTF nucl(13.5),cyto_nucl(9.5),mito(8),cyto(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QM58 Uncharacterized protein Low 8.4 1 604-629 EGPGGGVGRGRRRRRREWWDVYAERD plas(17),extr(5),mito(2),nucl(1),E.R.(1),vacu(1),cyto_mito(1) ERRRGAAMGLEGPGGGVGRGRRRRRR (594-619, prob:0.95) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5Y8 Peptidase_S8 domain-containing protein Low 7.2 1 191-213 ISISWTFKSKKPREQHDDRDLGA cyto(11),cyto_nucl(10.833),nucl(9.5),cyto_pero(7.833),pero(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9F6 Elongation of fatty acids protein Low 8 1 287-307 ATYKKDGKRPSGRKAVRRMSQ plas(19),E.R.(3),vacu(2),mito(1),pero(1),golg(1) GKRPSGRKAV (293-302, prob:0.73) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHH4 Delta(24)-sterol reductase Low 5.5 1 480-501 DPDVARAKKRHWLKRLPPLGGF cyto(12.5),cyto_mito(12),mito(10.5),nucl(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QKW6 Uncharacterized protein Low 8 1 515-541 LRNTRARSRSRSRSRSRSRGRRQPSTN plas(18),E.R.(6),vacu(2) RARSRSRSRSRSRSRGRR (519-536, prob:0.918) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNW1 Uncharacterized protein Low 9.5 1 2361-2382 EEARRREEARTRERLRRMGRCP mito(11),cyto(5.5),cyto_nucl(5.5),nucl(4.5),pero(3) KKKGKRSAPVLR (278-289, prob:0.833) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4I9 MFS domain-containing protein Low 5 1 589-614 HTEHKTGLHHMKKRSRKEEDDDDDRE plas(24),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q591 Uncharacterized protein Low 9.6 1 571-596 DTDNKEEKPKTRKVKKQVRKGELPIV cyto(18.5),cyto_nucl(13.333),nucl(7),mito_nucl(4.833) KPKTRKVKKQVRK (578-590, prob:0.833) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5T3 Uncharacterized protein Low 8 1 302-326 GHQDHDQRRRRHHHHHRHERSPPPG mito(9),cyto(9),cyto_mito(9) RRRHHH (310-315, prob:0.635) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q610 Ribosomal_L14e domain-containing protein Low 9 1 113-139 TDFDRFKVMRLKKQRRFEERKALAKIR mito(19),mito_nucl(12.666),cyto_mito(11.166),nucl(5),cyto_nucl(4.166) RLKKQRRFEERKALAKIRA (122-140, prob:0.797) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6H6 Uncharacterized protein Low 5 1 117-139 LHHHHHHQHHHHHHHHHRHPRLS plas(14),extr(7),mito(2),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6J2 Zn(2)-C6 fungal-type domain-containing protein Low 6.5 1 20-39 SACSRCRSAKVKCDNKLPAC mito(19),nucl(4),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q9X6 Uncharacterized protein (Fragment) Low 7.8 1 56-75 RFRLRHQKTIRITRQTRKAT mito(15),nucl(7),cyto(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QBX2 Uncharacterized protein Low 6.5 1 165-187 ETALAPPKPRKTKRQLWDDLKIS mito(15),nucl(4),cyto(4),cyto_nucl(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QH84 SSD domain-containing protein Low 5 1 950-969 ACCVDRRKPCFWRRDPPWNI plas(20),E.R.(3),extr(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHZ2 Uncharacterized protein Low 6.2 1 174-196 TPPPMSPKPCRGPKRYQRPATVD cyto(16.5),cyto_nucl(12),nucl(4.5),mito(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIT1 Uncharacterized protein Low 5 1 26-45 LSPTPKPRPLRLRSPQADHS plas(10),extr(8),E.R.(5),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QN34 Glutamine amidotransferase type-2 domain-containing protein Low 7 1 1614-1641 DKTRGFMKYHRRSEKYRNPKTRTKDWAE cyto(16),nucl(5),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2PZM0 Importin N-terminal domain-containing protein Low 7.1 1 66-85 AVKHWEKIPKEQKPAVRQHL cyto_nucl(11.5),cyto(11),nucl(8),mito(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0G0 Uncharacterized protein Low 8.3 1 179-201 SAQGKPKKAKEQPDQDRRQRRID nucl(11),mito(11),mito_nucl(11) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1J2 Uncharacterized protein Low 9.7 1 18-38 ATKHCAMYKRKTGAKSRCLPE nucl(18.5),cyto_nucl(14),cyto(6.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3S8 Uncharacterized protein Low 5 1 759-778 TTTTSPQQPQRQQQQQPGGP plas(19),E.R.(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5V2 Sm domain-containing protein Low 6.1 1 44-65 ADTEEFRRTKRKQNKPAAPGSS mito(20),nucl(3),cyto(2),extr(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7Z2 Uncharacterized protein Low 9.6 1 84-105 ALKEPPRDRKKEKNIKHNKSVS cyto(15),cyto_nucl(12.166),cyto_mito(9.666),nucl(8),mito_nucl(6.166) EPPRDRKKEKNIK (87-99, prob:0.81) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q804 Isocitrate lyase Low 7.5 1 25-46 EEVKRWWSEPRWRYTKRPFTAE pero(9),nucl(8.5),cyto_nucl(7.5),cyto(5.5),mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QEP3 3'-5' exonuclease domain-containing protein Low 5.7 1 216-235 YDARLRRKPGWEHKVRDAAR extr(16),cyto(4),nucl(2),mito(2),pero(2),mito_nucl(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJ16 Uncharacterized protein Low 7.9 2 466-490, 566-587 HSAVGPVSRRWRRRQKHCPGASSCG, HDEARAKKPPKQGDNIERKSVS mito(10),plas(4),E.R.(3),golg(3),nucl(2.5),cyto_nucl(2.5),extr(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q079 Uncharacterized protein Low 7.4 1 59-85 GENVMGKWHESKKRKFRPTELRFEVRF nucl(7.5),cyto_nucl(7.5),cyto(6.5),mito(4),plas(3),E.R.(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0B9 WD_REPEATS_REGION domain-containing protein Low 7 1 307-327 GSIKVFRHRPRRGGHVKREDG cyto(13.5),cyto_nucl(11),nucl(7.5),mito(3),extr(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q181 Tyrosine--tRNA ligase Low 8 1 537-559 LKEAEEKEKKEKEKEKEEKEESA cysk(9),mito(7.5),cyto_mito(7.5),cyto(6.5),pero(3) KKEKEK (545-550, prob:0.624) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q3J2 Uncharacterized protein Low 7.9 1 190-210 LLTPRGRRRQQQQQLGKKYRG nucl(9.5),cyto_nucl(8.5),cyto(6.5),mito(6),extr(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q5A7 RING-type domain-containing protein Low 6.9 1 403-425 NPLAPRPRPERERDRQRPYRSMQ mito(10.5),cyto_mito(9.333),nucl(8.5),cyto_nucl(8.333),cyto(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q659 Uncharacterized protein Low 9.8 1 470-490 PSPPRKVKLDVPKSKSKKSFT extr(13),nucl(5.5),cyto_nucl(5),mito(4),cyto(3.5) SPPRKVKLDVPKSKSKK (471-487, prob:0.724) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAY7 CNH domain-containing protein Low 6.9 1 1130-1150 GTAGATRRHLRRQGRERDGDG mito(14),cyto(8),nucl(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QD41 Clr5 domain-containing protein Low 5 1 58-78 TPKMYRTRIRRWGIDKNNKGS cyto(10),mito(6),cyto_nucl(6),pero(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QF08 F-box domain-containing protein Low 5.9 1 136-157 DIYARCRQRRGRGKASRTSWHR extr(12),cyto(6.5),cyto_nucl(5),mito(3),nucl(2.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGW4 Peptidase M20 domain-containing protein 2 Low 6.1 1 403-422 LDEVKRQWRRDMKATREQFE cyto(16),cyto_nucl(11),nucl(4),mito(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHC6 Uncharacterized protein Low 7.1 1 302-333 RGPGRLQSSTRSRRCNKKKKFAPSIQDCHDPS mito(7),nucl(6),cyto_mito(6),cyto(5),extr(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHH5 HeLo domain-containing protein Low 5.5 1 105-128 AVSYEAKKKERRHLRGTNHIREFF mito(10.5),cyto_mito(10.5),cyto(9.5),nucl(2),extr(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q134 Septin-type G domain-containing protein Low 7.8 1 130-152 ISTINSPRRVRRRKDPTPFNILI mito(14),nucl(9.5),cyto_nucl(7),cyto(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q243 AAA domain-containing protein Low 9.8 1 9-34 DLDRRERDDKDKKVKNDDNKGNQNGG nucl(13),cyto(10),pero(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q2J7 Cytochrome-b5 reductase Low 7.8 1 81-104 MPKNTLKFWKNLRREKLNNTNCLR cyto(10),pero(8),nucl(7) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q300 Uncharacterized protein Low 5.9 1 117-140 WVYVALRRRYRRNQTLKKLRAEFF extr(9),mito(8),cyto(3.5),cyto_nucl(3.5),nucl(2.5),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QAI1 Uncharacterized protein Low 5 1 310-336 GTTPRPDRYNARNKHRRPSFGNEKPSR extr(12),plas(11),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFT6 Uncharacterized protein Low 5 1 5-30 YVEVRVALQRRVRRRRPWLEAAQTPF mito(9),cyto(8),mito_nucl(8) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGF1 Uncharacterized protein Low 5.7 1 52-73 APVGLSKREKAKQHFRRFWWAY plas(14),golg(3),nucl(2),mito(2),extr(2),mito_nucl(2),cyto_pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHP1 Fungal_trans domain-containing protein Low 7.3 1 103-130 TSSSKRSSPGRSDIRRRRHQQQSFSCTT mito(16),nucl(6),cyto(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QM63 tRNA-binding domain-containing protein Low 8.6 1 186-208 AGAAAKKQKKEKKERAPKQPAAP cyto(22),cyto_nucl(13.333),mito_nucl(2.666),nucl(2.5) AAAKKQKKEKKERAPKQP (188-205, prob:0.968) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNW0 Uncharacterized protein Low 8 1 3-24 PSWYYQKPPSWKTRDANRARAA mito(13),nucl(8),cyto(6) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q470 Zn(2)-C6 fungal-type domain-containing protein Low 8.8 1 42-68 AAQACDTCRSRKQRCDEQRPKCGTCQK nucl(10),mito(6),cyto(4),extr(4),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q4V3 Uncharacterized protein Low 8 1 100-121 QERPAVPQPKRRKTTNENDPTP nucl(10.5),cyto_nucl(10.5),cyto(9.5),mito(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q592 Chitin synthase Low 7 2 785-812, 815-839 MRESRVWRRLSQRQRRRRQQERGYVVEV, DDGGNRQRPQQQQQQQQQQQQQPRG plas(18),E.R.(4),vacu(2),mito(1),extr(1),pero(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q6T3 Uncharacterized protein Low 8.3 1 272-293 KLSTRARALSQRRRNNIRARAE nucl(11.5),mito(10),cyto_nucl(8.5),cyto(4.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7J3 Uncharacterized protein Low 8.3 1 639-660 TTTATSRTSRKKTKQETSAYTR nucl(11),mito(11),mito_nucl(11) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFR6 Cation_ATPase_N domain-containing protein Low 8 1 1063-1088 NDNDNNNGRHGRRRRRRSGTGPASVL plas(11),cyto(9),pero(3),E.R.(3) RHGRRRRRRS (1071-1080, prob:0.885) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFU7 Uncharacterized protein Low 5 1 468-488 LMFLNRRHAKRREQLGKNAVL plas(26) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIA5 Uncharacterized protein Low 8 1 296-316 RGKGAKGKTRKGKGALKQEGS cyto(17.5),cyto_mito(12.5),mito(6.5) LRGKGAKGKTRKGKGA (295-310, prob:0.951) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQ69 Uncharacterized protein Low 5 1 18-40 ASAYSKRHPRYMRLRQRFNNGTA extr(21),mito(3),cyto(3),cyto_mito(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQF3 Uncharacterized protein Low 5 1 43-67 SSSSLRSASSRRRRQARLRRSLSLV plas(23),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q0R1 Glycosyltransferase family 1 protein Low 7.9 1 11-30 QSPQDPSYTRERKNRARIEN nucl(10),mito(9),cyto_nucl(8),cyto(4),pero(3) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q1L9 Uncharacterized protein Low 8.9 1 69-93 STDASDQTGRRKRKRYEVVLHSSPF nucl(13.5),mito(9),cyto_nucl(9),cyto(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q247 Uncharacterized protein Low 9.3 1 3-28 DADDNRNYHHKPRRSQRPRIHFLLRW nucl(15.5),cyto_nucl(10),mito(7),cyto(3.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q575 54S ribosomal protein L4, mitochondrial Low 5 1 37-58 ALLKRHKYRGARDNKDHSKHRG mito(22.5),cyto_mito(13),cyto(2.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCI3 DMAP_binding domain-containing protein Low 5.4 1 1723-1743 QTPTKDHRTEQQQQQQQRQEQ plas(20),mito(2),E.R.(2),nucl(1),golg(1),cysk(1),cyto_mito(1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCI5 Uncharacterized protein Low 9.1 1 156-181 PSEEPKPQPKPPPEPKQQPQPPPPQP extr(13),mito(5),nucl(3),cyto_mito(3),plas(2),cyto_nucl(2) KREEPSEEPKPQPKPPPEPKQQPQPPPPQPASAKPEAPKGAWEKAREEMRRREEERKAKEAEAKKKEETARRLRELREREARERDLKEKLRQEQEAKERERLERELREKVERELREKIERENKEREEARLKEEQRKLEEERARQEKERQAARERERKEREERLARLRREQEEKEKKEKE (152-330, prob:0.996) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QCY6 HET domain-containing protein Low 9.6 1 436-466 RVYFYRRRQAVWKDRRERKRPRAEEILKTEF cyto(8.5),cyto_nucl(7.5),mito(7),nucl(5.5),extr(5) WKDRRERKRPR (447-457, prob:0.833) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QD40 Glycoside hydrolase family 31 protein Low 6.7 1 1-22 MASSRYRYTFPRNPKANPKAVV mito(15),nucl(5),cyto(5),cyto_nucl(5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QFI7 MFS domain-containing protein Low 5 1 203-226 VSEVPHRSNRPRRKYTQRLAFRRI plas(21),E.R.(2),vacu(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QGE6 Zn(2)-C6 fungal-type domain-containing protein (Fragment) Low 8.4 2 4-34, 79-98 PGRFSTGCLRCRQRKVKCDEARPSCRRCCIY, AGKKQGQQHQHQHQHQHQHQ mito(16),nucl(4),extr(4),plas(2),cyto_nucl(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QI34 Uncharacterized protein Low 9.6 1 166-190 AFFIWWARRRMKRRRRSTLLTPLDV extr(14),mito(5),nucl(4),pero(2) RRRMKRRRR (173-181, prob:0.835) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QIU9 Uncharacterized protein Low 5 1 224-243 MSSSSKSKVKRKVVARAEEE extr(17),cyto(6.5),cyto_nucl(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJR8 Uncharacterized protein Low 8 1 1456-1488 EEMEGKGKGKGKRKKKKEKKEKRGAAGWRDVER plas(22),mito(3) KGKGKGKRKKKKEKKEKRGAAGWRDVER (1461-1488, prob:1) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QJW8 Uncharacterized protein Low 9.5 1 1-25 MPDPAARNRKSLKKRVDKRAAAAAS mito(19),nucl(4),cyto(3) RNRKSLKKRVDKRA (7-20, prob:0.834) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QNJ1 Uncharacterized protein Low 9.7 1 498-517 LHQLCFTRRNRQERAQEGDG nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(2),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QQA7 ACB domain-containing protein Low 5.8 1 271-293 LLLIWMRKRRDRRLEDNVRAIFR mito(11),cyto(5),plas(3),nucl(2),pero(2),E.R.(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2Q7P5 Delta(24(24(1)))-sterol reductase like protein Low 5 1 21-40 VETPGRRSTRRKAQVLPESD plas(24),mito(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QG40 Uncharacterized protein Low 5 1 2-23 LSSGFWKRRSLRVPDNQRTKAA plas(25) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QG98 Uncharacterized protein Low 5 1 256-277 DSTGRRKHYYPKRKQMLRQLLQ plas(14),cyto(6.5),cyto_nucl(4.5),mito(3),pero(2) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QHI0 Uncharacterized protein Low 8.6 1 16-42 MSFVKYISKKPQKLQNRQQSKNCRSTG mito(13),nucl(11.5),cyto_nucl(7.5) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QMK6 ERG4/ERG24 ergosterol biosynthesis-like protein Low 5 1 182-204 ACEIDRKRFKTDKRNKGKPYTGG plas(23),E.R.(4) UP000007322 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) G2QPQ3 SPX domain-containing protein Low 5 1 104-124 VRPPTRASDRTNNERHRRPSS plas(25)