ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000007148	Serendipita indica (strain DSM 11827)	G4T6S0	Uncharacterized protein	Low	8.1	2	5-24, 180-202	LYNSLPVRSQRRRPVSPSTH, LCFFISRRRKQRALNHNKQPSEK	mito(14),cyto(4),nucl(3),plas(2),extr(2),cyto_pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T7W3	Uncharacterized protein	Low	8	1	989-1011	EPRTRRHSTYFHHPERRRQQVPG	plas(16),E.R.(7),vacu(3)	KKKRKAGR (374-381, prob:0.78)
UP000007148	Serendipita indica (strain DSM 11827)	G4TBU0	Uncharacterized protein	Low	6.7	1	58-80	FGSKPLPKKRRVFLQKRGFRTGL	mito(12),cyto_nucl(6),nucl(5.5),cyto(5.5),plas(2),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TD66	Zn(2)-C6 fungal-type domain-containing protein	Low	7.8	1	95-128	SNPQNSDVKKRTKTQRACDKCRTKKIRCDVLPDT	nucl(11.5),cyto_nucl(10.333),cyto(8),cyto_mito(6.833),mito(4.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TEE0	Uncharacterized protein	Low	8	1	326-355	YVVPRLSKPPCPKIRAKERRRARKAAAASA	plas(11),mito(7),E.R.(6),vacu(2)	PKIRAKERRRARKAAA (337-352, prob:0.962)
UP000007148	Serendipita indica (strain DSM 11827)	G4TEE7	Uncharacterized protein	Low	7.2	1	189-209	FFYWWFRRRKLRQHEDARIVD	extr(11),nucl(6),mito(4),cyto(3),pero(1),golg(1),vacu(1)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TNJ4	Uncharacterized protein	Low	8.9	2	248-267, 312-341	CTICQRSSPNPKPYNRPDRA, LVNCEWCNKPLRQKNMKRHQKLYCPKAPGP	mito(8),cyto(7),nucl(5),pero(4),plas(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TRD6	F-box domain-containing protein	Low	9.5	1	521-543	ATKVPAARKKPICPQLRKFRISL	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T4Z5	Related to transcription elongation factor TFIIS	Low	7.8	1	237-260	TDAFQCGKCKQRKTIYRQAQTRSA	nucl(13),cyto_nucl(11.333),mito_nucl(9.333),cyto(8.5),mito(4.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T777	L-galactono-gamma-lactone oxidase	Low	6.8	1	585-605	WTSYTDREGKRQNARPHWAKH	cyto(8),cyto_nucl(8),nucl(6),extr(4),pero(4),cysk(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T9V6	Probable Protein required for hyphal anastomosis (HAM-2)	Low	9.9	1	378-402	TPAPSPPPSPKPKKQQYQTDQTKPF	plas(11),nucl(5),cyto(5),cyto_nucl(5)	KKAERKRAKERR (560-571, prob:0.859)
UP000007148	Serendipita indica (strain DSM 11827)	G4TA14	Probable isp4-oligopeptide transporter	Low	5	1	871-890	QYWIRRRHFKWWSRYNYILS	plas(25)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TG85	SUN domain-containing protein	Low	7.5	2	689-708, 969-988	QDPPRRPRRSSSQRSARYDD, QRSPRTKRSRFSFGSPRKPF	extr(14),plas(3),E.R.(3),golg(2),nucl(1.5),cyto_nucl(1.5),mito(1),pero(1),vacu(1)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TGG3	Uncharacterized protein	Low	9.8	1	382-403	STRWLLSRPKRLTKKARSNSST	mito(9),cyto_nucl(6),nucl(5.5),cyto(5.5),extr(4)	KKERRPRSGFRLFGRK (314-329, prob:0.735)
UP000007148	Serendipita indica (strain DSM 11827)	G4TP35	Related to YBT1-Vacuolar, full-size ABC protein transporting bile acids	Low	8	1	722-741	AKPAAPKKPWWKRRFWVKAA	plas(19),E.R.(4),vacu(3)	KPAAPKKPWWKRR (723-735, prob:0.8)
UP000007148	Serendipita indica (strain DSM 11827)	G4TPK4	Related to phenylacetyl-CoA ligase	Low	8	1	508-528	QPDFAKRVKGNKKEEQKVKEA	cyto(14.5),cyto_nucl(8),pero(6),mito(5)	RK (580-581, prob:0.603)
UP000007148	Serendipita indica (strain DSM 11827)	G4TDN0	Related to ADAM protease ADM-B	Low	7	2	792-816, 858-877	SLLSCLLRSCQKRKNSNQRINSAMP, SNNSSRRRDLRIDDQRRPSD	extr(25)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TE58	Uncharacterized protein	Low	8.1	1	7-28	RADTAELRQRHKRQNYTICSSE	nucl(13.5),cyto_nucl(11.333),cyto(8),cyto_mito(6.833),mito(4.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TIB8	Related to hypothetical hybrid sensor histidine kinase-Postia placenta	Low	8	1	10-35	GEESYGRHRSQRRRLAKPPGKQSETT	plas(24),mito(1),cyto(1),pero(1),cyto_mito(1),cyto_pero(1)	RRRLAK (21-26, prob:0.647)
UP000007148	Serendipita indica (strain DSM 11827)	G4TIZ3	Related to D-lactate dehydrogenase (Cytochrome)	Low	5.7	1	1-21	MRVRPPRLRLKPQTRQYSNSA	mito(16),cyto(3),nucl(2),plas(2),E.R.(2),cyto_pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TKM3	Uncharacterized protein	Low	5	1	604-626	LITEWKRLEKERNRPRTQSNEIW	mito(7),cyto(7),cyto_mito(7),cysk(6)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TN60	Uncharacterized protein	Low	9.5	1	23-44	HRNAHHFTLPRKRKRSMHYSSS	nucl(15.5),cyto_nucl(11),mito(8)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TSN2	GATA-type domain-containing protein	Low	9.3	1	35-54	KSDVIRKRSRHETEKRTSVS	nucl(18),cyto_nucl(13.333),cyto(6.5),cyto_mito(4.166)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TW06	Uncharacterized protein	Low	8	1	712-733	KEFAEEKKTRRASRLRKSAPRY	plas(15),extr(5),E.R.(5)	KKTRRASRLRKSAPR (718-732, prob:0.806)
UP000007148	Serendipita indica (strain DSM 11827)	G4U2J7	Related to WD40-repeat protein (Notchless protein) (Fragment)	Low	9.4	1	1-22	MSSQKSTKPKKQLRITNPSGSS	nucl(15.5),cyto_nucl(10),mito(6),cyto(3.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T6N5	Uncharacterized protein	Low	8	1	348-374	CIGWRRYRQSRERIRVGKRRSRPQFVG	plas(13),extr(11),E.R.(2)	RERIRVGKRRSR (358-369, prob:0.757)
UP000007148	Serendipita indica (strain DSM 11827)	G4T803	DUF4203 domain-containing protein	Low	7	2	760-783, 791-814	QDWQKYQDSTKRQQQQPQHRSSYI, ASDTMPRSRSPRPFPSQRPRSQLY	plas(20),E.R.(4),mito(1),extr(1),vacu(1)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TBC2	Related to guanine nucleotide-binding protein alpha-2 subunit	Low	9	1	300-321	KEYFKRRFLRLAQKSSRTKERE	nucl(14.5),cyto_nucl(12.5),cyto(7.5),mito(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TKR4	Related to methyltransferase	Low	6.5	1	384-403	YERRNKTKTFTPPPNPPGLQ	cyto(11),pero(6),cysk(6),nucl(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TRF4	Related to archipelago beta form (F-box-WD40 repeat protein)	Low	7	1	479-500	IATRSIRTPNYQRFRRPPQIGW	mito(12),cyto_nucl(7),nucl(6.5),cyto(6.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TSF2	Uncharacterized protein	Low	7.4	1	400-423	LSSRMNWGKKKPLQSGPPRQSSEK	cyto_nucl(12.833),cyto(12),nucl(10.5),cyto_mito(8.999)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TU50	Uncharacterized protein	Low	6.8	1	549-571	RFCAQEHKSRDCPNKANRKCTLC	cyto(11),cyto_nucl(9.833),cyto_mito(7.833),nucl(7.5),pero(5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T711	Uncharacterized protein	Low	9.1	1	263-282	SKNKSFTKPLRRRYLRRTDV	nucl(14.5),cyto_nucl(10.5),cyto(5.5),mito(5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T7J3	Uncharacterized protein	Low	8	1	294-314	AIYLWRRRRARKERQYGGTKE	extr(25)	RRRARK (300-305, prob:0.66)
UP000007148	Serendipita indica (strain DSM 11827)	G4TLR4	Probable NDE1-mitochondrial cytosolically directed NADH dehydrogenase	Low	5	1	164-183	IIQPTRYITRHKKRRVLFYE	mito(26)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TQ65	Uncharacterized protein	Low	9	1	1-26	MSFRKLTTLKKKDKSKKSTSSVPYAH	nucl(13.5),mito(10),cyto_nucl(8),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T6R8	Uncharacterized protein	Low	9.2	1	167-202	EAARRRATPTIPRRKRTKSKKAKRAPEPQASKRSPQ	extr(12),mito(11),nucl(3)	RRRATPTIPRRKRTKSKKAKRAPEPQAS (170-197, prob:0.995)
UP000007148	Serendipita indica (strain DSM 11827)	G4T9C2	Transcription initiation factor TFIID subunit 2	Low	6.6	1	647-672	FEVPFNTKYKRVRRNTKRFIARQQAA	mito(11),cyto(9.5),cyto_nucl(8),nucl(5.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TEV6	Uncharacterized protein	Low	5	1	201-222	LIVSSFRRRMRRRRLDNQVTDM	plas(16),extr(9)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TGJ2	Probable endopeptidase K	Low	5	1	52-71	PALQRFTKRRTAPRVEIRDV	extr(26)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TID1	Uncharacterized protein	Low	5	1	520-545	ACAGYATYRYRKRRIHKSDLDVHSFD	extr(23),golg(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TJ56	Uncharacterized protein	Low	8.5	1	28-52	PPPIPFRKPGRSILKQPPPPQPKFF	nucl(12.5),cyto_nucl(10),mito(7),cyto(6.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TQ58	Uncharacterized protein	Low	9.6	1	47-67	LQGKVCGRHRRRFSERDRKGD	nucl(18),cyto_nucl(12.5),cyto(5),mito(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TRU6	PfkB domain-containing protein	Low	9.2	1	683-704	RPPGPTRIGKLKKEKMRLKEEQ	mito(22),nucl(3)	PTRIGKLKKEKM (687-698, prob:0.739)
UP000007148	Serendipita indica (strain DSM 11827)	G4T9G1	Uncharacterized protein	Low	5	1	410-434	TSMSRKSSKRSSKHSLKPRNEHPSA	plas(18),mito(3),extr(2),E.R.(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TA60	TPR_REGION domain-containing protein	Low	8.4	1	362-383	LITHHLRPTRRVRHQPRCILYG	nucl(13),cyto_nucl(11.5),cyto(8),mito(6)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TJN5	PH domain-containing protein	Low	8.1	1	67-86	AQVHAPTKGRSRRNTQQLIS	nucl(11.5),cyto_nucl(10.5),mito(9),cyto(6.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TJS0	Probable mutanase (Glucan endo-1,3-alpha-glucosidase)	Low	8.4	1	14-42	FAKHTRASWDDRRRRHHGRSRLDHAKPNI	extr(20),mito(3),nucl(1),cyto(1),plas(1),cyto_nucl(1),vacu(1)	RRH (27-29, prob:0.625)
UP000007148	Serendipita indica (strain DSM 11827)	G4TL11	Related to UTP4-U3 snoRNP protein	Low	9.4	1	738-758	DEGKKDNEKKGRPFENKTLSR	nucl(12),mito(7),cyto(5),plas(1),extr(1),pero(1)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TN14	Probable uracil permease	Low	5	1	28-48	NDDLRPVPPHQRTWKHRNFIA	plas(25)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TND4	DNA_mis_repair domain-containing protein	Low	7.7	1	283-305	DESPTKPNIRRSPRKLDKRPIYV	nucl(11.5),cyto_nucl(10.833),cyto(9),cyto_mito(7.333),mito(4.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TWF0	CxC2 domain-containing protein	Low	9.9	1	260-284	SISNVQVRQPKKRKRNTENYVTSWD	nucl(18.5),cyto_nucl(12),cyto(4.5),pero(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TWW2	Integrase catalytic domain-containing protein	Low	5	1	761-783	SSSYVPTKARRWRPKPNFEAPDH	mito(9),pero(7),mito_nucl(7),cyto(6)	
UP000007148	Serendipita indica (strain DSM 11827)	G4U2F1	Urease	Low	5	1	785-807	AVKGCRTVKKKDMKWNDATPKMR	mito(20),cyto(6)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T9Y1	Related to GIM4-Gim complex component (Prefoldin subunit 2)	Low	5	1	1-20	MASKQKSKSKQKSLTTEGSV	mito(25)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TEP0	Related to Alpha-1,3-mannosyltransferase	Low	5	1	2-25	SAKELASHRKRIERRTRIISKVID	plas(16),E.R.(6),extr(2),vacu(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TEW3	E3 ubiquitin-protein ligase	Low	9.8	1	719-742	IKWFWDCVRRWPPEKKSRLLQFTT	nucl(13),mito(5),cyto(4),plas(1),extr(1),pero(1),golg(1),vacu(1)	
UP000007148	Serendipita indica (strain DSM 11827)	G4U308	MYND-type domain-containing protein	Low	8.4	1	1-21	MAKKPKKHSSKLTSPKFNLDD	nucl(12),mito(9.5),cyto_mito(8),cyto(5.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4U330	Uncharacterized protein	Low	8	1	138-162	VSFFQKDKRARAPRVRRRDPRTPYS	plas(18),mito(3),vacu(2),mito_nucl(2)	KDKRARAPRVRRRD (143-156, prob:0.853)
UP000007148	Serendipita indica (strain DSM 11827)	G4T978	Uncharacterized protein	Low	8	1	95-119	ARAAEERRKHGKKRRGRRRADEGSS	cyto(6),extr(6),mito(4),plas(4),cyto_nucl(4),E.R.(4)	RVVRKEARAAEERRKHGKKRRGRRRA (89-114, prob:0.998)
UP000007148	Serendipita indica (strain DSM 11827)	G4TAD3	Proteasome endopeptidase complex	Low	6.1	1	231-250	VEKEKHYKFRRGTTDWKKDR	cyto(16),cyto_nucl(12.333),cyto_pero(8.999),nucl(5.5),mito(5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TDE9	Uncharacterized protein	Low	7.4	1	33-52	DPNSARRKPSLNRCRRVTAC	plas(8),nucl(6),mito(5),golg(4),cyto(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TKS7	Uncharacterized protein	Low	9.5	1	30-51	KVERKEAKKVKATKGKGKGNAE	mito(16),cyto(6),nucl(4)	GGKSAAKAAKKAKAAAKVERKEAKKVKATKGKGKG (14-48, prob:0.995)
UP000007148	Serendipita indica (strain DSM 11827)	G4TNC7	Eukaryotic translation initiation factor 3 subunit B	Low	7.8	1	668-691	QELAQTSKGRKNAKRRDEEQEETV	cyto(12.5),cyto_nucl(12),nucl(10.5),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TQB6	NB-ARC domain-containing protein	Low	8	1	973-997	GLTDSFKSSKRRWKINPTHRELPIP	mito(10),nucl(8),cyto(5),plas(1),pero(1),E.R.(1),golg(1)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TSI7	Related to KRE5-killer toxin-resistance protein	Low	5.9	1	1318-1337	VTYKWPSWLRSQREKQRVIW	mito(8.5),cyto_mito(7),extr(5),cyto(4.5),nucl(3),vacu(2),plas(1),pero(1),E.R.(1),golg(1)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TWB5	Uncharacterized protein	Low	5	1	12-35	INLRRALQRAPRKLHRARNQEEEL	mito(25)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TWI3	Peptide hydrolase (Fragment)	Low	5	1	10-30	TQPKRVGKIINRVRSRRESRY	plas(20),mito(3),E.R.(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T6P4	Related to YEH1-steryl ester hydrolase	Low	6.6	1	340-361	FPFNVLRKIKWKRWQRLFGKLD	mito(7),plas(7),cyto(5),nucl(4),golg(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T6R5	Uncharacterized protein	Low	5	1	37-61	VSLPVWKHTYKKRRNQPKTTSIYSI	plas(19),extr(2),E.R.(2),vacu(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TH46	1,3-beta-glucan synthase	Low	7	2	199-218, 1710-1733	NPGLQRLKSVKKKGAQKTGA, IRAPLYSMKVRKQRRWMVVKYGVV	plas(26)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TI56	WD_REPEATS_REGION domain-containing protein	Low	5.7	1	443-465	IPIPNPFKSRRPRGTRPKSVYDI	plas(14),E.R.(4),cyto(3),nucl(2),mito(2),pero(2),mito_nucl(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TKX3	Uncharacterized protein	Low	5.5	1	17-41	LYPTNTTPVKHRRLQRRRRFIIVFA	plas(11),mito(5),E.R.(4),cyto(2.5),cyto_nucl(2.5),nucl(1.5),extr(1),cysk(1),vacu(1)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TLU0	Uncharacterized protein	Low	8.7	1	22-43	STDPDKVRKERAKDRLRKAEEE	plas(19),E.R.(3),nucl(2),cyto(1),pero(1),golg(1),mito_nucl(1),cyto_pero(1)	KERAKDRL (30-37, prob:0.651)
UP000007148	Serendipita indica (strain DSM 11827)	G4TQ11	Uncharacterized protein	Low	8.4	1	109-133	PVEFHKPYLHRRPKSTRVLHTPRMH	nucl(11.5),mito(11),cyto_nucl(8),cyto(3.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TU08	Uncharacterized protein	Low	8.1	1	688-710	AQIRERKERDWTRDHARRVRNQR	nucl(11),cyto_nucl(10),cyto(7),mito(4),plas(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TXT0	RNase H domain-containing protein	Low	9.8	1	175-196	ITKTEARDRRRESRRFKRAAKI	mito(9.5),cyto_mito(9.5),cyto(8.5),nucl(6)	KTEARDRRRESRRFKRAA (177-194, prob:0.894)
UP000007148	Serendipita indica (strain DSM 11827)	G4TY86	F-box domain-containing protein	Low	9.2	1	520-539	FPVPRRFVPQRPPLRWRLPA	nucl(15.5),cyto_nucl(12),cyto(7.5),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4U0M5	BHLH domain-containing protein	Low	9.9	1	1-20	MNHVKSEKRRRDTIRDGYLT	mito(18),nucl(5),cyto(4)	PRRGRPKGSGRTVNGKKTGKGK (38-59, prob:0.907)
UP000007148	Serendipita indica (strain DSM 11827)	G4T953	Related to Rac1 GTP binding protein	Low	5.8	1	176-195	AVLYPTAKPKERKKPGCVVA	cyto(22),nucl(2),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TCJ7	Uncharacterized protein	Low	9.7	1	230-254	IFYFRRARKARKRMLAEKNKRPTRH	extr(8),nucl(5.5),cyto_nucl(5.5),mito(5),cyto(4.5),plas(2),pero(2)	RRARKARKRMLAEKNKRPTR (234-253, prob:0.952)
UP000007148	Serendipita indica (strain DSM 11827)	G4TKE6	Related to nuclear envelope protein NEM1	Low	7.9	1	34-53	GRPQRAKSYNRIVPRRPSHH	nucl(8),mito(8),mito_nucl(8),cyto(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TM68	Uncharacterized protein	Low	7.9	1	386-409	SGDGGRPKWRRGEQCKRVFRTKGT	nucl(11.5),cyto_nucl(9.333),cyto(6),cyto_mito(5.833),mito(4.5),pero(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TME8	Uncharacterized protein	Low	8.7	1	236-256	AKLTQTKRQKRSQTLRRWILY	plas(20),mito(3),nucl(2),cyto_mito(2)	IRRQRRGKGMHLNLPRRGK (161-179, prob:0.805)
UP000007148	Serendipita indica (strain DSM 11827)	G4TMN7	Related to glyoxal oxidase	Low	5	1	30-51	SPHANKRQTQHHRIAQKAKRAA	extr(23),plas(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TPD5	Uncharacterized protein	Low	6.1	1	41-62	ALSLRGCFRRREYRRRFIRAVD	extr(11),mito(6),nucl(3),pero(3),E.R.(2),cyto_pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TQ01	Uncharacterized protein	Low	7.4	1	68-91	SVILWLTKRRVRRRSREQIRAFLW	nucl(7.5),cyto_nucl(7),cyto(5.5),plas(5),mito(4),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T927	Related to SSK2-MAP kinase kinase kinase of the high osmolarity signal transduction pathway	Low	9.6	1	182-203	AWLTFRAKLRRRTLDEERKRVE	nucl(16.5),cyto_nucl(11),cyto(4.5),mito(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TDE0	Uncharacterized protein	Low	8.3	1	203-228	VLSCCEHKQSRNKRNRVPSLPRRSNP	nucl(10),mito(10),mito_nucl(10)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TIT0	Related to General alpha-glucoside permease	Low	5	1	38-57	QGTTTSKKSIERRMNWKDFF	plas(26)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TJ24	Uncharacterized protein	Low	8.6	1	475-494	KAEKARYRAEREQRRRNKLE	cyto(14),cyto_nucl(8.833),cyto_mito(8.833),cysk(7),nucl(2.5),mito(2.5)	KAEKARYRAEREQRRRNK (475-492, prob:0.757)
UP000007148	Serendipita indica (strain DSM 11827)	G4TT79	Related to glyoxal oxidase	Low	5	1	25-44	PSHSLKRSAHRRGLTHKAKR	extr(26)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TUH7	Uncharacterized protein	Low	5	1	343-363	TFTNEETKQKKKRASNASSLE	plas(22),E.R.(2),golg(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TVF1	Integrase catalytic domain-containing protein	Low	7.9	1	644-666	PEPVRLPSPPRRRCRNKVEMLYE	nucl(10.5),cyto_nucl(10.5),cyto(9.5),mito(2),plas(2),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T5F8	Related to PCH2-putative ATPase	Low	8.3	1	432-457	ATTSESSRNRIHPKQRTRSAEKWVQD	nucl(11.5),cyto_nucl(11),cyto(7.5),pero(5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TA73	Uncharacterized protein	Low	7.2	1	25-44	PEPIWIRQARRSQRRLDGSG	cyto(9.5),cyto_nucl(9),nucl(7.5),mito(6),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TE64	MYND-type domain-containing protein	Low	7.8	1	49-68	YSTHQPSRQHQQRYYQPPRS	mito(14),nucl(9.5),cyto_nucl(7),cyto(3.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TEV3	Ceramide glucosyltransferase	Low	5	1	21-43	GLLGWREARKRYFRRNNALTSYS	plas(21),E.R.(3),vacu(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TFY3	Uncharacterized protein	Low	9.9	1	268-290	GQWQCPHCFKQFRRRDRVKEAVE	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TGK9	Related to WD-repeat protein, putative-Talaromyces stipitatus	Low	9.9	1	1127-1151	ITVVSPATRKKKKIKSPPTRGVFVD	cyto(11.5),cyto_nucl(9.5),nucl(6.5),pero(5),mito(2)	RKKKKIKS (1135-1142, prob:0.837)
UP000007148	Serendipita indica (strain DSM 11827)	G4THR2	Related to Co-chaperone protein HscB, mitochondrial	Low	6.5	1	2-21	FHLRRISKTIINPRQPRRAV	mito(23),nucl(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TJB7	Related to MRPL9-mitochondrial ribosomal protein, large subunit	Low	9.5	1	5-34	RAKMLKAWKMERTRKWHEKKANARAARIRF	mito(11),cyto(10.5),cyto_nucl(8.5),nucl(5.5)	KAWKMERTRKWHEKKANARAA (10-30, prob:0.816)
UP000007148	Serendipita indica (strain DSM 11827)	G4TKI8	Mitoc_mL59 domain-containing protein	Low	9	1	156-175	GRKIAFKRPKSERERQGKAD	mito(18),cyto(5),nucl(3),cyto_pero(3)	KPRPRKTIGMYEGRKIAFKRPKSERERQGKAD (144-175, prob:0.919)
UP000007148	Serendipita indica (strain DSM 11827)	G4TVB6	Uncharacterized protein	Low	9.6	1	21-43	LWRFLHKRVEKARQKNGRPNPVI	nucl(12),mito(11),cyto(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TY59	Uncharacterized protein	Low	8.5	1	1-23	MRFKLFKSNKKSHAKKDDLPRSS	nucl(12.5),cyto_nucl(9.5),mito(8),cyto(5.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TZR6	Uncharacterized protein	Low	9.7	1	1-23	MSSLRSRKHPWEKENRSKSHSRI	nucl(18.5),cyto_nucl(13),cyto(4.5),mito(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TBK3	Uncharacterized protein	Low	8.7	1	329-354	WDVIKLPPKKLPVRRKSYNRWWLTCL	nucl(10),cyto(8),mito(3),pero(3),plas(1),E.R.(1),golg(1)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TCR6	Related to PTM1-member of the major facilitator superfamily	Low	5	1	436-456	IAELRQRKQRYKLRMFRRLQL	plas(20),mito(3),extr(2),E.R.(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TFA0	Uncharacterized protein	Low	9.9	1	284-315	SFGIMYRNRNRKKREQERKERYKRRRLSDGED	mito(9.5),cyto_mito(7.5),nucl(6),cyto(4.5),extr(4)	NRNRKKREQERKERYKRRR (291-309, prob:0.96)
UP000007148	Serendipita indica (strain DSM 11827)	G4TJ58	Uncharacterized protein	Low	8	1	431-451	PTPPDEKVKNITKKKNAAENT	extr(12),cyto(6),mito(3),plas(3),cyto_nucl(3)	KRGKKLGGKTAMRARAK (229-245, prob:0.844)
UP000007148	Serendipita indica (strain DSM 11827)	G4TVW7	Related to TSR1-protein involved in 20S rRNA accumulation	Low	6.2	1	1-27	MSQAQSKLNRRNQAKQIQKAKRQSLVE	mito(22),nucl(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TXG4	Cupin_2 domain-containing protein	Low	8.3	2	275-297, 317-336	DKLFYPTKLKHRRHEHWWWKDVP, EYPTWETKARKKYVRSDEDM	cyto(17.5),cyto_nucl(12.833),cyto_pero(9.666),nucl(6)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TBT7	Related to Na+/H+ antiporter	Low	5	1	360-381	LWAPSRRKCPNPKSQTMERRTD	plas(18),E.R.(5),extr(2),vacu(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TE53	NTF2 domain-containing protein	Low	7.3	1	8-28	LAPPAKKQQVHRPNKIDRPEV	mito(8),cyto(8),cyto_mito(8),nucl(7)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TG56	F-box domain-containing protein	Low	6.7	1	14-38	VLSMRGEHKIRRKRVQNAQRACIFT	mito(14),nucl(5),cyto(5),cyto_nucl(5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TNU0	Related to O-methylsterigmatocystin oxidoreductase	Low	5	1	448-474	VYRILPREGKCRAKCRQPRIYRFSIQI	plas(17),E.R.(6),mito(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TY52	Related to Superoxide dismutase	Low	5	1	5-25	KRTTTSFCRTRRTRELRYVFT	mito(26)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T5M5	Mitochondrial inner membrane protease subunit	Low	6	1	139-160	CVQGRVPRKLEKQPSPRPSRTE	mito(12),cyto(10.5),cyto_nucl(7.5),nucl(3.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T868	Related to NADPH oxidase cytosolic protein p67phox	Low	7.3	1	180-204	TVLEKSRPSKWQRPRHDPLLRNSRT	cyto_nucl(9.5),cyto(9),nucl(8),cysk(4),mito(2),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TJD9	Probable EXG1-exo-beta-1,3-glucanase (I/II), major isoform	Low	5	1	37-59	ANTRNDRVTKCRVKRKEGQGILV	extr(21),mito(6)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TJZ4	Uncharacterized protein	Low	9.3	1	316-336	IRPLKCTRCGHRTTRKDDMKT	nucl(18),cyto_nucl(14.5),cyto(9)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TK96	Uncharacterized protein	Low	9.3	1	275-294	ESIRKDIKRMRIKRLIQSFQ	cyto(14),cyto_nucl(11.5),nucl(5),mito(3),extr(2),E.R.(2)	KAKK (163-166, prob:0.635)
UP000007148	Serendipita indica (strain DSM 11827)	G4TMT5	Uncharacterized protein	Low	7.7	1	234-254	PYVFWWKHRKAWKFIPPQERL	mito(10.5),nucl(9),cyto_mito(8.5),cyto(5.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TN13	Related to O-methylsterigmatocystin oxidoreductase	Low	6.6	1	32-51	YFLLRDKSSRKYPPGPPKLP	mito(8),nucl(5),cyto(5),cyto_nucl(5),cysk(4),cyto_pero(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TQ20	Related to NACHT and WD40 domain protein-Penicillium marneffei	Low	7.3	1	1-20	MKQFIKKVKKKVQSASSSGT	mito(11),nucl(7.5),cyto_nucl(6.5),cyto(4.5),pero(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TWE2	Related to kinesin light chain (Fragment)	Low	9.7	1	526-546	YLDIFRKSRRRLLRRKPEFGS	mito(13.5),cyto_mito(10),nucl(6),cyto(5.5)	KSRRRLLRRK (532-541, prob:0.732)
UP000007148	Serendipita indica (strain DSM 11827)	G4T506	Uncharacterized protein	Low	5.7	1	461-483	LFPLHIGRLKKQRKIPRQSMMMG	plas(18),cyto(3),nucl(2),vacu(2),cyto_mito(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T6Y1	Uncharacterized protein	Low	9.3	1	48-70	LLSRHVNKCHTNEKKNPNAPQGA	nucl(16.5),cyto_nucl(9.833),mito(4.5),extr(4),cyto_mito(3.833)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TB35	Uncharacterized protein	Low	6.1	1	506-525	NIRHPKYYHKLLERLRRQNY	plas(20),nucl(3),mito(2),cyto_nucl(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TCY6	Uncharacterized protein	Low	5	1	581-604	VVVLVILRRRKRNQRVDNSPAVDN	extr(27)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TQJ7	Related to sensory transduction histidine kinase	Low	9.9	1	138-164	RLRSRPLSRLTRRSKGRRKPTLKLNEL	nucl(8),cyto(8),cyto_nucl(8),pero(6),cyto_mito(6),mito_nucl(6)	RLRSRPLSRLTRRSKGRRKP (138-157, prob:0.936)
UP000007148	Serendipita indica (strain DSM 11827)	G4TRW5	F-box domain-containing protein	Low	6.8	1	822-842	DPTTVRYVKGREKRERQWAGY	plas(7),mito(6),cyto_nucl(6),nucl(5.5),cyto(5.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TSR9	Uncharacterized protein	Low	5	1	395-420	SVSNPLRFPRRPRTTPSRKNDNTSFL	plas(19),E.R.(4),mito(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T6K4	Probable GTPase activating protein	Low	9.3	1	240-263	ILSPSSNTPRHRRRGRPHSYSGSP	nucl(15.5),cyto_nucl(10),cysk(7),cyto(3.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T9G9	Uncharacterized protein	Low	5	1	400-419	KSNEDSTPTKRRRHVPVQMH	extr(17),plas(6),mito(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TGK4	Uncharacterized protein	Low	8.2	1	105-128	VQPSPIPRKTTRKKSASNSMRQVD	mito(13),nucl(8),cyto(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4THX5	Uncharacterized protein	Low	8.2	1	429-453	LVAPLKRCSRRGCLKRGRYFCQACA	mito(10),nucl(8),cyto(7)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TID5	Protein-tyrosine-phosphatase	Low	9.4	1	885-910	SSPCVTAEMKRQKSRGRQLLERTFKP	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TLN0	Uncharacterized protein	Low	5	1	99-123	RIYISMCKRQCRKCRKADSHEGWTV	cyto(7),plas(7),mito(6),E.R.(3),extr(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TRE1	Related to capsular associated protein-Cryptococcus neoformans	Low	8.4	1	594-614	LEGVPRKKKPRVLDGDKQLHR	plas(18),mito(6),nucl(1),pero(1),vacu(1)	RKKKPR (599-604, prob:0.73)
UP000007148	Serendipita indica (strain DSM 11827)	G4TS82	Uncharacterized protein	Low	8	1	477-498	KVDKARSKGKVKSEEKNRKDGE	plas(20),E.R.(4),cyto(1),extr(1),golg(1)	KPKVDKARSKGKVKSEEKNR (475-494, prob:0.854)
UP000007148	Serendipita indica (strain DSM 11827)	G4TUW7	Uncharacterized protein	Low	6.2	1	619-641	TGRGESRREREKRMEREQHGRLN	plas(6),E.R.(6),extr(5),nucl(3),cyto(3),cyto_nucl(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TWH4	Uncharacterized protein (Fragment)	Low	8.7	1	55-78	QAKAEKIVKKNWKKDKQLNSNYQA	nucl(12.5),mito(11),cyto_nucl(8),cyto(2.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TZ02	Related to aspartic peptidase A1-Laccaria bicolor	Low	8	1	48-73	ISIPLVRRSRPRPFRKGKLSSKELAD	extr(27)	RRSRPRPFRKGK (54-65, prob:0.763)
UP000007148	Serendipita indica (strain DSM 11827)	G4U1R7	Uncharacterized protein	Low	5	1	13-33	VIDLKDKRSRKKLDLFKAFTK	cyto(26)	
UP000007148	Serendipita indica (strain DSM 11827)	G4U2G7	Uncharacterized protein (Fragment)	Low	8.2	1	15-37	TFTMSTQKSTKHKKQHLPVDSSG	nucl(12.5),cyto_nucl(11.5),cyto(9.5),pero(5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T6N1	Uncharacterized protein	Low	5	1	329-352	GLFLIWRRRYRRQNHPSIGKKSAN	plas(16),extr(7),E.R.(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TEC1	Probable DIP5-glutamate and aspartate permease	Low	5	1	33-54	AGREEERKKRTLRRELNSYQVT	plas(27)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TG76	Uncharacterized protein	Low	5	1	272-293	LGVRMWKCSKKRHDGQVQLGEE	extr(8),plas(7),E.R.(6),mito(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TIP4	Ubiquitin carboxyl-terminal hydrolase	Low	9.3	1	67-87	HPFTLNIRRRPKPTIKRDDGA	cyto(10),cyto_mito(9.833),mito(8.5),cyto_nucl(8.333),nucl(5.5)	RPK (76-78, prob:0.605)
UP000007148	Serendipita indica (strain DSM 11827)	G4TM60	Uncharacterized protein	Low	6.9	1	40-66	DRLPEDKRNQAKQKRFIREQYERQQRA	mito(14),nucl(5.5),cyto_nucl(4),E.R.(2),golg(2),cyto(1.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TRL4	Non-specific serine/threonine protein kinase	Low	6.2	1	2077-2102	PLVEWEHERRRKERHRSSNTNRPVVD	mito(10),cyto(9),plas(4),nucl(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4U2F5	N-terminal Ras-GEF domain-containing protein	Low	8.3	1	1103-1125	KTLYTIFRRQTKRPPLRHLSAYE	nucl(12),mito(12),mito_nucl(12)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TDJ8	Related to N-acetyltransferase	Low	5	1	5-26	RSSLCHTARKKHVHRYHEWMKS	mito(22),cyto(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TFY9	Uncharacterized protein	Low	5	1	6-25	LCNMPSKPLRHRAMRGKEAL	extr(14),mito(8),golg(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TI05	Uncharacterized protein	Low	5	1	1015-1040	GLERKLKAYRKECRKVAKAKQRVLTY	plas(25)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TL24	Uncharacterized protein	Low	8	1	146-165	RHAFLHRQRRAKPRERVRST	plas(13),extr(9),E.R.(4)	K (157-157, prob:0.6)
UP000007148	Serendipita indica (strain DSM 11827)	G4TMS9	Uncharacterized protein	Low	5	1	105-126	VGCWLVRRRRNRALNAHRRRST	plas(18),extr(5),E.R.(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TPL4	Uncharacterized protein	Low	5	1	113-135	AQPNRKAPWRWRRRTYEHGTRTT	plas(8),mito(7),extr(5),E.R.(3),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TQX8	Uncharacterized protein	Low	7.5	1	17-41	DLLLRERPDKNPKTHSKPPNSMVNN	nucl(8.5),cyto_nucl(8.5),cyto(7.5),mito(4),pero(3),cysk(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TRT4	Uncharacterized protein	Low	5.7	1	10-32	AVQWVWRSRTRDKRQVKVCVVRA	mito(11),extr(5),plas(3),nucl(2),cyto(2),cyto_nucl(2),pero(2),cyto_pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TTJ1	Uncharacterized protein	Low	5	1	16-38	HNEHESRRWRGRKGVRGPSWLRM	plas(24),E.R.(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TTL3	Related to MRPL3-Mitochondrial ribosomal protein, large subunit	Low	8.8	1	425-450	KAQRRGGSKTSCRRERIRGSPRGKGG	mito(22),cyto_nucl(3),nucl(2.5),cyto(2.5)	KAQRRGGSKTSCRRERIRGSPRGKGG (425-450, prob:0.837)
UP000007148	Serendipita indica (strain DSM 11827)	G4TYJ8	Uncharacterized protein (Fragment)	Low	8	1	196-218	GLLFWRMDRRKSKRKARDLDYAT	plas(22),E.R.(2),vacu(2)	RRKSKRK (204-210, prob:0.742)
UP000007148	Serendipita indica (strain DSM 11827)	G4TZ08	Palmitoyltransferase	Low	5	1	126-146	SSRKWCRTCWAPKPDRTHHCS	plas(18),mito(4),cyto(2),mito_nucl(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TZC2	Related to archipelago beta form (F-box-WD40 repeat protein)	Low	8	1	578-597	SKNFRLLKQEIDRRRNKASD	cysk(9),nucl(8),cyto(7),pero(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4U108	Uncharacterized protein	Low	8.9	1	179-198	RPYHCTCDKCRNGNNPRKFF	nucl(14.5),cyto_nucl(11.5),mito(6),cyto(5.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T7G4	Glyco_hydro_cc domain-containing protein	Low	8	1	44-74	ISPNHGGIIKRKRNLHKQRKRCLAQNNPGTT	extr(25)	IKRKRNLHKQRK (52-63, prob:0.791)
UP000007148	Serendipita indica (strain DSM 11827)	G4T7Q4	Related to Het-c heterokaryon incompatibility protein	Low	8	1	698-744	GSDSDNDKPKKDKKKKNKNKDSDSESDGKPKKDKKDKHKHGYDSSYG	extr(18),plas(4),pero(2),E.R.(1),golg(1),vacu(1),cyto_pero(1)	HGKKHKNKGSDSDNDKPKKDKKKKNKNKDSDSESDGKPKKDKKDKHK (690-736, prob:0.997)
UP000007148	Serendipita indica (strain DSM 11827)	G4T8T6	Uncharacterized protein	Low	7	1	415-434	NNIILKKWWKQQSHRWQHYG	nucl(7.5),cyto_nucl(6.833),mito(6.5),cyto_mito(6.333),cyto(5),extr(3),vacu(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TA24	Uncharacterized protein	Low	5	1	54-80	LPYKDRPVPERKYTKQWFKRSWNTAVH	plas(26)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TBQ5	Uncharacterized protein	Low	8.9	1	72-95	AIVLKKFWRHTPNKWKPSPRLWGA	nucl(14),cyto_nucl(11.5),cyto(7),mito(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TCQ6	Protein ZIP4 homolog	Low	8.5	1	110-136	ASYEHTLNTRPQKWRRRGRHATIDVAR	nucl(13),cyto_nucl(12),cyto(9),pero(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TG61	Uncharacterized protein	Low	9.6	1	18-40	GAKDDARGNKKRKIQRGEFLSLL	plas(10),nucl(4.5),cyto_nucl(4.5),mito(4),cyto(3.5),pero(2)	GVKRGR (743-748, prob:0.646)
UP000007148	Serendipita indica (strain DSM 11827)	G4TH58	Phospho-2-dehydro-3-deoxyheptonate aldolase	Low	8.3	1	503-525	FLLSNHYKKQRRGYAKGERPNYI	nucl(9),mito(6),cyto(4),pero(3),plas(1),extr(1),E.R.(1),golg(1),cysk(1)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TPF1	Related to A.gambiae ATP-binding-cassette protein	Low	5	1	419-438	KYSADKSKRWTRREKESRVA	plas(25)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TQD5	Uncharacterized protein	Low	7.3	1	6-28	NELAKALSRRRKDVPRRPIIFVA	mito(12.5),nucl(9.5),cyto_mito(8.833),cyto_nucl(7.333),cyto(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TTI7	Uncharacterized protein	Low	7.8	1	30-51	TRDWLQFQRRPKFPHNQRCTFQ	nucl(10.5),cyto_nucl(10.5),cyto(9.5),pero(3),mito(1),plas(1),extr(1),vacu(1)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TU77	Probable nuclear protein SNF4	Low	6.9	1	4-31	HETPTSPPQNLKKNRKISQRRARSGSVA	mito(17),nucl(5),cyto(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T8B3	Related to 3-oxoacyl-[acyl-carrier-protein] reductase	Low	5	1	699-724	SDSSPSRSPMRNRNGRLRNSRRVLPL	extr(18),cyto(5),mito(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TDN5	WD_REPEATS_REGION domain-containing protein	Low	7.8	1	439-461	DSSTVRKRSSRLRTRPRMLDAHR	mito(12),nucl(8),cyto(3),pero(3),cyto_pero(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TG27	Protein kinase domain-containing protein	Low	7.2	1	582-604	RDFVQKCLQKNPKKRMTLQQALE	mito(15),nucl(7),cyto_nucl(6.5),cyto(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TVE8	Uncharacterized protein (Fragment)	Low	6.2	1	96-115	LNRLRFKQIGKSNHKRRHGM	extr(16),nucl(3),mito(3),mito_nucl(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TX36	Uncharacterized protein	Low	7.3	1	1-23	MKEVFKWTRKGEEKKKQYSDLHS	cyto_nucl(10.833),nucl(10),cyto_mito(7.832),cyto(7.5),mito(6.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T695	Related to B56-delta regulatory subunit of protein phosphatase 2A	Low	9	1	181-200	IPIVGKPPKKQRSSRFHVTE	nucl(13.5),cyto_nucl(10),cyto(5.5),mito(5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TG80	Uncharacterized protein	Low	9.2	1	46-69	LKSSQGRVSRPPPPKRFKADEWTA	nucl(15),cyto_nucl(12),cyto(7),mito(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TKD4	Uncharacterized protein	Low	9.5	1	299-326	GSAAAEPRSRHRKKKRAKGANKKRTEDD	plas(14),mito(5),nucl(4),cyto(1),extr(1),E.R.(1),vacu(1)	PRSRHRKKKRAKGANKKRT (305-323, prob:0.997)
UP000007148	Serendipita indica (strain DSM 11827)	G4TMT9	Related to STE6-ABC transporter	Low	8	1	1111-1136	LQNRYSGRFTRKNKEKREDVNKKYYD	plas(21),E.R.(4)	HQGQKRIRRLRSRPLKPA (886-903, prob:0.877)
UP000007148	Serendipita indica (strain DSM 11827)	G4TNR2	CNH domain-containing protein	Low	7.3	1	395-415	ASNGSVRQRNHPRNRSNSRGQ	cyto(9.5),cysk(8),nucl(7),cyto_mito(5.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TQ42	Uncharacterized protein	Low	5	1	388-410	EEDSPRRKLVKPSRSKNQANLGL	plas(22),E.R.(2),vacu(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TUD7	Related to Engulfment and cell motility gene 1 protein	Low	7.4	1	617-636	AQKRQSRPWRYMRLDRNLKY	mito(16),nucl(7),cyto(2),pero(2),cyto_pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TWY7	WD_REPEATS_REGION domain-containing protein	Low	6.9	1	1-20	MSSRKSDKSKKSHNIVNISG	mito(9),plas(6),cyto_mito(6),nucl(5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T9F4	Related to myo-inositol transport protein ITR1	Low	5	1	567-586	VPIFIRKHILRQKNVQEQPP	plas(25)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TBQ9	Related to MPE1-Role in mRNA 3` end formation	Low	8.1	1	530-555	DSAYQRLPVNPRRRANKRPADWELDG	cyto(11),nucl(8),mito(7)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TCE3	Related to SAD1-SnRNP assembly defective	Low	9.7	1	15-36	AEDAAKPGKRQKKTENTDTTSQ	nucl(18.5),cyto_nucl(12),cyto(4.5),pero(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TIG0	Conserved oligomeric Golgi complex subunit 6	Low	7.2	1	39-64	PPSSRSKDATTTKRKSRQARVEETVD	mito(17),nucl(6),cyto(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TL99	Related to cell division protein CDC50	Low	5.7	1	19-39	EDAQGKKKGDWKRPANTAFKQ	plas(22),nucl(2),mito(2),mito_nucl(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TNI4	Uncharacterized protein	Low	9	2	27-50, 125-147	NSFQRNSQTRTRVNKQQHKTWNMF, DTNPTRKITYTRKKEKSSQLAER	mito(13.5),cyto_mito(9.333),nucl(8.5),cyto_nucl(6.833),cyto(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TTP7	Uncharacterized protein	Low	6.6	1	279-301	FYQWSSWRQKRRAKKNMESKMQL	extr(11),mito(6),nucl(4),cyto_mito(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4U2I2	Probable mannosyltransferase involved in N-linked and O-linked glycosylation	Low	5	1	33-57	TSFSSLNSKWRNKPEPPRPKPVFVD	extr(9),golg(8),E.R.(6),mito(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4U2N0	Uncharacterized protein	Low	7	1	1-29	MPLLTNPSRPKPPRYYKQRQAAHRNSEST	mito(14),nucl(6.5),cyto_nucl(6.5),cyto(5.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4U356	Uncharacterized protein	Low	5	1	2-24	IDTNGRRVIWKRRPPQTRRLLLL	extr(9),mito(7),plas(6),cyto(2),E.R.(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T592	Related to glucose regulated stress protein, HSP70-like	Low	8	1	815-849	LQNHVLKMSKRKFPKPPVKKDKPKEEKEGEKEKGE	extr(9),E.R.(6),plas(3),golg(3),mito(2),vacu(2),cyto(1.5),cyto_nucl(1.5)	MSKRKFPKPPVKKDKPKEEKEGEKEKGEPKE (822-852, prob:0.99)
UP000007148	Serendipita indica (strain DSM 11827)	G4TCA7	Uncharacterized protein	Low	9.5	1	141-163	LCTAQKRCSRLRKRKGIDCRCVS	nucl(17),cyto_nucl(12),cyto(5),mito(2),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TID0	Uncharacterized protein	Low	8	1	308-333	LGPLAYLRWKKAKRRPKSLSLLTSPL	extr(25)	WKKAKRRPK (316-324, prob:0.812)
UP000007148	Serendipita indica (strain DSM 11827)	G4TJC3	Uncharacterized protein	Low	8.9	1	107-126	MIESCKRKPNLAKHVKKLSI	nucl(13.5),cyto_nucl(9.5),mito(7),cyto(4.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TJH1	WD_REPEATS_REGION domain-containing protein	Low	9	1	1-20	MSKWFKGKGKTSRSKNTSTA	mito(15),nucl(10)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TPI6	FGGY_C domain-containing protein	Low	5	1	534-556	AYVARWGWRKKTRPDEKHPGFED	extr(14),mito(7),cyto(3),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TU06	Uncharacterized protein	Low	6.2	1	25-49	KLEPSLPKSSSKKKRSSTTPETPAP	extr(13),mito(4),nucl(3),plas(3),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TWH0	Uncharacterized protein	Low	6.2	1	1-30	MPWRSSSWLSWQKPNPKQKHRLNPNSSIIA	plas(9),mito(6),cyto(4),nucl(3),E.R.(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TWL1	Endoplasmic reticulum junction formation protein lunapark	Low	5	1	378-408	EETPSKRPGQKVTQRRQTRNSRKSIKEVEGH	mito(9),cyto(7.5),cyto_nucl(5),extr(4),plas(3),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TWM7	WD_REPEATS_REGION domain-containing protein (Fragment)	Low	6.9	1	1-27	MSSRRPTTSTNKTRNPKDPLRERGLKQ	mito(18),nucl(5),cyto(2),plas(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TWW4	Uncharacterized protein	Low	8.9	1	1-29	MRGCRVSSPGRPHCCRRRPTLTPTKPTSF	nucl(13),mito(11),cyto_nucl(9)	
UP000007148	Serendipita indica (strain DSM 11827)	G4U041	Uncharacterized protein	Low	9	1	23-42	ITKKLLPERRGKHQPRCILY	nucl(10),mito(9),cyto(6)	
UP000007148	Serendipita indica (strain DSM 11827)	G4U1M2	Uncharacterized protein	Low	8.5	1	151-172	AQVPRSQLRPHQRHPPDRRLRS	nucl(11.5),mito(9),cyto_nucl(7.5),cyto(2.5),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4U2I3	Uncharacterized protein	Low	8.7	1	133-154	LGLCLIRRWRRNRTRARTRSVV	nucl(12.5),cyto_nucl(9.5),cyto(5.5),mito(4),pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T800	Uncharacterized protein	Low	9.2	1	207-226	VWFILVRRNKAQRARPARRY	cyto(10),plas(10),cyto_nucl(8),nucl(4)	ARP (220-222, prob:0.61)
UP000007148	Serendipita indica (strain DSM 11827)	G4T9J9	Probable ENA5-Plasma membrane P-type ATPase involved in Na+ and Li+ efflux	Low	5.4	1	1071-1098	EMYKLAKRLYYRRQSKAKTRRELEREAA	plas(22),E.R.(2),nucl(1),cyto(1),cyto_nucl(1),golg(1)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TAC8	FHA domain-containing protein	Low	8.7	1	269-289	GSITSERRRKHKQSDDGEETD	nucl(13.5),cyto_nucl(9.5),mito(5),cyto(4.5),plas(1),pero(1),cysk(1),vacu(1)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TC38	Related to curved dna-binding protein	Low	8	1	376-402	KELLVRPLRESKKDKKAKKKAEKEDEE	cyto(20),mito(4.5),mito_nucl(3.5)	LRESKKDKKAKKKAEK (383-398, prob:0.968)
UP000007148	Serendipita indica (strain DSM 11827)	G4TEF1	Uncharacterized protein	Low	8	1	43-66	GPFATPKSPRSPPRTPRNRNQVLL	mito(13),nucl(10.5),cyto_nucl(7.5),cyto(3.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4THA4	Mitochondrial import inner membrane translocase subunit TIM44	Low	8	1	193-213	YEEKEARRLRRQKRLAKAGKS	mito(27)	KEARRLRRQKRLAKAGKSGGIGK (196-218, prob:0.957)
UP000007148	Serendipita indica (strain DSM 11827)	G4TSY9	Uncharacterized protein	Low	9.8	1	23-44	ASSGLQKKKGRSIKQKQPDAEL	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TUF2	Uncharacterized protein	Low	8.5	1	1-20	MTKPPKPPKRSRNTVTETTS	nucl(12),mito(11),cyto_nucl(8.5),cyto(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TVY0	Uncharacterized protein	Low	8	1	149-171	RQENSEHKKKSKRETEKAKRYEA	plas(25)	EHKKKSKRETEKAK (154-167, prob:0.867)
UP000007148	Serendipita indica (strain DSM 11827)	G4T7M6	Acetyltransf_6 domain-containing protein	Low	8	1	459-480	QPAPPKLSKKQQKKIAKAKAEA	plas(19),E.R.(4),mito(2)	PKLSKKQQKKIAKAK (463-477, prob:0.794)
UP000007148	Serendipita indica (strain DSM 11827)	G4TAK9	DNA polymerase epsilon catalytic subunit	Low	5.7	1	2197-2220	QVQDLKCTKCKRIKVDNLNLHCQC	mito(21),cyto(3),nucl(2),cyto_pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TBA2	Related to zinc finger protein Gcs1p	Low	9	1	25-45	DNKLCADCKRNGKKDARWASW	nucl(15.5),cyto_nucl(12.5),cyto(4.5),mito(3),pero(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TBS3	NACHT domain-containing protein	Low	8.2	1	5-28	QKLEGLFHRRKKSKTTPAESGSNT	nucl(11.5),cyto_nucl(10),cyto(7.5),mito(7)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TBX9	Histone deacetylase	Low	6.4	1	373-393	NPDDRKPQRLWDRRVQRNDEF	mito(18),cyto_nucl(5),nucl(4.5),cyto(4.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TFU2	Related to coenzyme A diphosphatase	Low	9.1	1	302-326	EEIHWDWKREERREREKRLRASGEP	mito(16),cyto_mito(11.5),cyto(5),nucl(4)	KREERREREKRLRASGEPVKGDKRYKSRL (309-337, prob:0.933)
UP000007148	Serendipita indica (strain DSM 11827)	G4TKT3	Endo-1,4-beta-xylanase	Low	5	1	175-194	KTYQQIWSVRRNKRRNGTIS	extr(26)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TL59	Ribosomal protein L37	Low	8	1	13-37	TKTHTLCRRCGRRAFHRQHKTCASC	mito(11),cyto(9),mito_nucl(9)	KAKRRKTTGTGRMRYLRHVSRKFKNGF (52-78, prob:0.818)
UP000007148	Serendipita indica (strain DSM 11827)	G4TPL5	Uncharacterized protein	Low	8	1	106-128	ELATKRWKIGRKRLDGRPKQEVR	extr(8),E.R.(6),plas(5),mito(3),cyto(2),golg(2),mito_nucl(2)	RWKIGRKRLDGRP (111-123, prob:0.764)
UP000007148	Serendipita indica (strain DSM 11827)	G4TPY2	Uncharacterized protein	Low	5.5	1	180-199	GFWFCLKHRRRQPSGNPGAH	extr(9),mito(7),plas(7),cyto_nucl(2),nucl(1.5),cyto(1.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TRA1	Related to septum formation maf	Low	8	1	16-36	GINKMKKKKIVLASNSPRRLE	mito(17.5),cyto_mito(14),cyto(9.5)	KMKKKK (19-24, prob:0.68)
UP000007148	Serendipita indica (strain DSM 11827)	G4TYL6	Uncharacterized protein	Low	7.5	1	98-124	LSSRDKEQTSRPPRRHLRTLRWHAKEA	mito(15),nucl(8.5),cyto_nucl(6.5),cyto(3.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T883	Probable glutamate synthase (NADPH)	Low	9.6	1	1936-1958	FELLPKPPAKRGRDNPWPQWPRI	cyto(9.5),cyto_nucl(8),mito(6),nucl(5.5),plas(5)	RERPKKLDKLRGFMKYKRLGEHYRPARRR (1616-1644, prob:0.82)
UP000007148	Serendipita indica (strain DSM 11827)	G4TA71	Uncharacterized protein	Low	6.2	1	810-836	PARPRESKVDSLKRNRQQKPEKDIREF	plas(11),mito(5),nucl(3),cyto(3),cyto_nucl(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TFI1	Related to actin cytoskeleton organization protein-Laccaria bicolor	Low	7.1	1	1083-1104	ALGGSKKKTHPSFKPLRVKAMS	cyto(10),cyto_nucl(9.833),nucl(8.5),cyto_mito(6.833),pero(6)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TG28	Probable ubiquitin-conjugating enzyme E2	Low	7	1	153-173	NWEGYKKKVRRLVRRSAEEAW	mito(15),nucl(6.5),cyto_nucl(6),cyto(4.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TJL4	DUF676 domain-containing protein	Low	6.1	1	336-360	PAILAKYPRRCKRRATITKSYSSKA	cyto(9.5),cyto_nucl(7),plas(4),nucl(3.5),mito(3),extr(2),E.R.(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TNR8	F-box domain-containing protein	Low	6.8	1	4-29	VPRFLQRPLHTQKRQVTRQTNPNVPL	mito(15),nucl(5),extr(2),cyto(1),plas(1),pero(1),E.R.(1),golg(1),cyto_pero(1)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TRV5	Spindle assembly checkpoint component MAD1	Low	8.6	2	89-108, 649-669	LTKLKHDKEKVERDRRWFAE, IVFSQPTKKSKRERGPLEGED	mito(19.5),cyto_mito(11),nucl(6)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TT12	Related to PUS1-pseudouridine synthase 1	Low	6.1	1	118-137	PESSRRTKYQRGLRGTRKTG	mito(15),cyto_mito(11.5),cyto(6),nucl(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TUH9	NACHT domain-containing protein	Low	7.8	1	1-20	MSKLWPKGKGKTTRSKDTSN	plas(16),nucl(7),mito(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TXP2	Uncharacterized protein	Low	6.9	1	526-547	AQTLKFLRKTGRLRTRRTGEEE	mito(17),nucl(5.5),cyto_nucl(4.5),cyto(2.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4U3C8	Probable RPL3-60s ribosomal protein l3	Low	8.7	1	82-111	SEELKRRFYKNWYRSKKKAFTKYAKKMSEA	cyto(15),mito(7),nucl(2),plas(1),pero(1),E.R.(1)	KKLPRKTHKG (209-218, prob:0.694)
UP000007148	Serendipita indica (strain DSM 11827)	G4T611	Related to SNF1-carbon catabolite derepressing ser/thr protein kinase	Low	5.8	1	486-507	APAPKEKKSKLRWHYGIRSRSP	plas(17),cyto(6),nucl(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T6I9	Uncharacterized protein	Low	7.1	1	356-378	KPESGNPIKRVKKHTRLNLETLL	cyto(12),mito_nucl(8),nucl(7.5),mito(7.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T6T0	RRM domain-containing protein	Low	9.3	1	460-488	NGTDKDASKRDKKKQKEKEKKVDKGGPTE	mito(17),cyto_nucl(4.5),nucl(4),cyto(3),pero(3)	SKRDKKKQKEKEKKVDK (467-483, prob:0.964)
UP000007148	Serendipita indica (strain DSM 11827)	G4TCI6	Uncharacterized protein	Low	8	1	382-408	VVAFFVWKKYAKKKEKKEYKAVPVGHE	extr(17),plas(10)	KYAKKKEKKE (390-399, prob:0.809)
UP000007148	Serendipita indica (strain DSM 11827)	G4TCQ0	Zn(2)-C6 fungal-type domain-containing protein	Low	8.8	1	39-58	CAECRRMKLKCSRTIPCQNC	nucl(10),cysk(9),cyto(5),mito(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TFI6	Uncharacterized protein	Low	8	1	181-203	SYSPSHYPKSGRRKKRNVDEEML	plas(13),extr(9),E.R.(2),mito(1),cyto(1),pero(1),cyto_mito(1),cyto_pero(1)	GRRKK (191-195, prob:0.676)
UP000007148	Serendipita indica (strain DSM 11827)	G4TJK5	Uncharacterized protein	Low	8	1	274-300	VFFLMRRSRRSLKKYNKRRARDGPDGM	extr(24),plas(3)	RRSRRSLKKYNKRRAR (279-294, prob:0.852)
UP000007148	Serendipita indica (strain DSM 11827)	G4TKH1	Uncharacterized protein	Low	8	1	8-35	RDPLLPQARRSQSRWRRPHPRWLIPLAL	plas(23),E.R.(2)	PRKRVILVGARKDPKSPRGRGRSA (531-554, prob:0.902)
UP000007148	Serendipita indica (strain DSM 11827)	G4TP65	DUF1713 domain-containing protein	Low	9.9	1	306-343	SPGVAMDSVKRKKKKKMNKHIYKKRRKRERAQRRRLGK	mito(16.5),mito_nucl(13.166),nucl(8.5),cyto_nucl(5.833)	KRKKKKKMNKHIYKKRRKRERAQRRRLGK (315-343, prob:0.999)
UP000007148	Serendipita indica (strain DSM 11827)	G4TSA4	Uncharacterized protein	Low	7.5	1	161-184	CSYCGRRHSRPVRRRACSNKHTNQ	mito(11.5),cyto_mito(8.5),nucl(8),cyto(4.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TTB5	Uncharacterized protein	Low	9.7	1	1865-1890	VDEFGNQRPPGRRKNSSRKVIPGWSD	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TTJ2	Related to kinesin light chain	Low	9.2	1	1529-1568	EFTTRRPTRRFKGSTDKSGQLKEKCDKATSNKRKRDEADD	nucl(16),cyto_nucl(11.5),mito(6),cyto(5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TU96	Related to glyoxal oxidase	Low	5	1	669-695	VKRNISSAKRSNVHRRRHLLHGRQRAS	extr(20),plas(5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T981	Lipoyl synthase, mitochondrial	Low	5.8	1	290-309	GQYMRPTKRHMKVHRYVEPE	mito(19),cyto(5),nucl(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TBD9	Uncharacterized protein	Low	9.1	1	307-330	TVCAFTRRKLRAKRRARQRFQFIG	plas(8),mito(6),cyto(4),nucl(3),cyto_pero(3),pero(2),golg(2)	RRKLRAKRRAR (313-323, prob:0.87)
UP000007148	Serendipita indica (strain DSM 11827)	G4TES9	Uncharacterized protein	Low	8	1	175-202	LELARRQKLAARNRRKMKKKKVSRSSTS	extr(7),golg(6),plas(4),mito(3),E.R.(2),vacu(2),cyto_mito(2),mito_nucl(2)	RRQKLAARNRRKMKKKKVSR (179-198, prob:0.987)
UP000007148	Serendipita indica (strain DSM 11827)	G4TH64	Glycerol kinase	Low	5	1	512-534	DGSREERWRKWQRAIERSRGWDE	cyto(20.5),cyto_nucl(11),cysk(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TUT2	Related to F-box and wd40 domain protein, putative-Talaromyces stipitatus	Low	7.3	1	2-24	DVARGLKSRLKQKFRAREAQDGS	mito(13),nucl(6),pero(5),cyto(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TVJ5	Uncharacterized protein	Low	8	1	64-91	LADVDYDKKTRRWRKRNARRGSGDTVKP	cysk(18),cyto(5),pero(3)	KKTRRWRKRNARRG (71-84, prob:0.901)
UP000007148	Serendipita indica (strain DSM 11827)	G4TX45	Protein FYV4, mitochondrial	Low	8	1	143-165	AREPQPKKTQRGWGPPIRKKTVP	mito(23.5),cyto_mito(13.5)	PKKTQRGWGPPIRKKTVPIKP (148-168, prob:0.79)
UP000007148	Serendipita indica (strain DSM 11827)	G4TYH7	Uncharacterized protein (Fragment)	Low	8.8	1	1-23	MDIFRKIRKKSKKTQGTTLTPTT	mito(24),nucl(2)	KIRKKSK (6-12, prob:0.692)
UP000007148	Serendipita indica (strain DSM 11827)	G4T5F3	RNA helicase	Low	5	1	23-49	HTSSASLRGQSKRKHPPPRNWVLQHAD	mito(19.5),cyto_mito(13),cyto(5.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T7C3	Uncharacterized protein	Low	6.3	1	12-32	IGPVNNTKKLRHKASKPIITW	mito(15.5),cyto_mito(10.833),cyto_nucl(5.833),nucl(5.5),cyto(5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T7G0	Related to aryl-alcohol dehydrogenases	Low	8.2	1	680-702	GVLSRPRKDRNATHRAKNDRWFS	mito(11),nucl(8),cyto(6)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TCT7	Uncharacterized protein	Low	5	1	597-622	VRNRNHPSLVRSTRQRRRGKIYMMSY	plas(25)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TG09	Uncharacterized protein	Low	9.4	1	410-437	IAPLVYYLRRHRKNRRRMLIHRYPNWRV	cyto(9.5),cyto_nucl(7.5),extr(7),nucl(4.5),mito(3)	HRKNRR (420-425, prob:0.666)
UP000007148	Serendipita indica (strain DSM 11827)	G4TKC4	Probable CCT6-component of chaperonin-containing T-complex (Zeta subunit)	Low	6.7	1	437-456	LSHHLSTKTKKNAKGRVKLG	cyto(16.5),cyto_nucl(13),nucl(6.5),mito(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TVF5	rRNA-processing protein	Low	9.4	1	94-117	KAKMSAKKLARMRRRQGRTKKING	mito(20.5),cyto_mito(11.5),nucl(5)	EIQRRKEITKERKERAEERKRLEEMKAKMSAKKLARMRRRQGRTKKING (69-117, prob:0.994)
UP000007148	Serendipita indica (strain DSM 11827)	G4T7Z4	Probable protein CCN1-putative cell cycle control protein	Low	7.4	1	49-70	LDEYRGRKRKEFEERIRRTPGN	nucl(10.5),cyto_nucl(9.833),cyto_mito(8.333),cyto(8),mito(7.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4T9I1	Related to YND1-apyrase (NDPase/NTPase)	Low	7.3	1	571-590	IYLKLKKRLRMTFRRFLRQT	nucl(6),extr(6),mito(5),cyto_nucl(5),cyto(4)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TCN5	Related to SIN3 protein-binding protein STB2	Low	9.3	2	62-82, 851-873	VSPKTGRPYPNRLRAHKPSHS, RIPELQKEVKKHREQFWQQRRLA	mito(11),nucl(7.5),cyto_nucl(7.5),cyto(6.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TDJ6	Uncharacterized protein	Low	8.2	1	377-404	QPPRDITHLSRRRQRTRQKQTQEMAKEF	mito(11),nucl(8),cyto(6)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TG30	WD_REPEATS_REGION domain-containing protein	Low	7.1	1	9-33	TSGSLPLTRRQTNKKNKLYNTANVG	mito(11),cyto_nucl(9),nucl(7),cyto(7)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TIJ7	F-box domain-containing protein	Low	7.1	1	4-28	VAKLQRLGYRRRIKRELRGVDQRLQ	mito(18),nucl(6),cyto_nucl(5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TJR2	Endo/exonuclease/phosphatase domain-containing protein	Low	8.5	1	312-331	SKDPTFRKPWWNKQCQDLHK	mito(10),nucl(9),pero(3),cyto(2),golg(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TM61	Uncharacterized protein	Low	8.8	1	156-185	KPSMGARQSKQTRRKGDKRKAPRMSRPSFN	mito(17),cyto(7),nucl(2)	SKQTRRKGDKRKAPRM (164-179, prob:0.93)
UP000007148	Serendipita indica (strain DSM 11827)	G4TQE4	Probable AFG3-protease of the SEC18/CDC48/PAS1 family of ATPases (AAA)	Low	5	1	38-62	ILPSRDAKLERPRPVQHKRDPGPSA	mito(20.5),cyto_mito(12),cyto(2.5),plas(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TSH1	C2H2-type domain-containing protein	Low	5	1	247-268	SINLSKRLKKTQRRMNTEARNF	mito(23),cyto(2),pero(2),cyto_pero(2)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TXJ3	Chitin_synth_1N domain-containing protein	Low	8.6	1	42-65	SLDPQRVHRRYKNKKPSELFHRNL	nucl(12.5),mito(9),cyto_nucl(9),cyto(4.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TBH3	Related to cation translocating ATPases	Low	8	1	901-924	TVKVLMRASGRRRRREGRIYEAVG	plas(20),E.R.(3),vacu(2)	GRRRRRE (910-916, prob:0.748)
UP000007148	Serendipita indica (strain DSM 11827)	G4TG95	Uncharacterized protein	Low	8.7	1	286-305	EQITSPGRRRRKQAGSRERA	extr(11),mito(8),nucl(2),cyto(2),plas(2),cyto_nucl(2)	RRRRKQA (293-299, prob:0.731)
UP000007148	Serendipita indica (strain DSM 11827)	G4THG2	Ubiquitinyl hydrolase 1	Low	9.3	1	952-975	DDLWYCPRCKKHQQATKKFELWKT	nucl(16.5),cyto_nucl(13),cyto(8.5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TJZ8	Uncharacterized protein	Low	7	1	221-244	SNPTSPAERAKRQKQKPRSFDQVI	extr(10),nucl(5),cyto(5),cyto_nucl(5)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TL93	Uncharacterized protein	Low	6.2	1	388-414	MVSARRMITQIRKRRPQLRISTCRPVD	mito(13),cyto(6),plas(4),nucl(3)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TSZ8	Uncharacterized protein	Low	5	1	62-88	KSNDGYEKPQRFKPKKKWNDLPFLVFF	plas(27)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TUP5	Related to glyoxaloxidase 2	Low	5	1	23-52	SSSLSPSGHHHRRQEVRRRLQKRQDTETTP	extr(19),plas(6)	
UP000007148	Serendipita indica (strain DSM 11827)	G4TVZ4	Uncharacterized protein	Low	9.2	1	85-113	GNDQGPAKKKTKKEEKVKKKPVKALLSFG	cyto(16.5),cyto_nucl(11.999),cyto_mito(11.666),nucl(6),mito_nucl(5.999)	GPAKKKTKKEEKVKKKPVK (89-107, prob:0.982)