ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LHX1	Sly41p	Low	5.3	1	27-49	IPEPPRGSYQHKKKDYSKESPSS	plas(22),pero(2),nucl(1),mito(1),E.R.(1),mito_nucl(1),cyto_pero(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LJ60	Tex1p	Low	9	1	382-405	DSTIIEKRRKNNGNDTNHNRRAGK	nucl(17.5),cyto_nucl(13.833),cyto(7),cyto_mito(5.499)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PHZ0	Rpt5p	Low	8.5	1	59-78	LEKIKDNKEKIKNNRQLPYL	nucl(13),cyto_nucl(13),cyto(11)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PJC8	Trs120p	Low	8.5	1	1216-1236	IIFDKKTSKLLPRSNRRILYN	nucl(12),mito(9),cyto_nucl(9),cyto(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PMK0	Kgd1p	Low	7.6	1	827-848	ANLFHMLRRQQHRQFRKPLALF	mito(17),nucl(7),cyto(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PXL5	YNL234W	Low	9.2	1	163-183	TLAPCIRPSKNKKKEVSKVDT	nucl(21),cyto_nucl(13.333),mito_nucl(11.333),cyto(4.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZ42	Ski7p	Low	9	1	572-592	ITKMTKPKLTSKPNSKNHTPV	nucl(15.5),cyto_nucl(12.5),cyto(6.5),mito(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LM38	Rrn7p	Low	9.2	1	79-100	QLLQQQQQQRSQKKSKKLTGLD	nucl(15),cyto_nucl(10.5),mito(6),cyto(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PPQ1	Rpl12ap	Low	5	1	84-103	ALKEPPRDRKKDKNIKHSGN	cyto(25.5),cyto_nucl(13.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q161	Pgm2p	Low	5	1	19-40	GTSGLRKKTKIFKDQPHYTENF	cyto(16.5),cyto_nucl(9),mito(5),pero(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3V3	Glycosylphosphatidylinositol anchor biosynthesis protein 11	Low	5	1	1-20	MSTKKRARKTVKKTVSFSDD	plas(24),pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q7L6	Chitin synthase	Low	8.8	1	514-536	EVDPRLRPRKYPKKPLGHNRAST	plas(23),nucl(2)	RPRKYPKKP (520-528, prob:0.708)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q9Z3	Coatomer subunit alpha	Low	6.1	1	280-299	WDLDKRTPVKQFKRENDRFW	mito(15.5),cyto_mito(11),cyto(5.5),nucl(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8QA44	Bre4p	Low	6.1	1	1002-1021	LSNCFRSKNKIPRYLPNPIM	plas(20),nucl(3),E.R.(2),mito_nucl(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LKR0	Vps33p	Low	6.9	1	654-675	IATLKHLQKKLSKKGINKRFII	nucl(6.5),cyto_nucl(6.5),E.R.(6),cyto(5.5),golg(3),mito(2),extr(2),pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LLM5	Rsm22p	Low	9	1	559-589	DLNVKKFQKLEKERIKQLKKDERQKSREIIE	nucl(16.5),mito_nucl(14),mito(10.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LN08	YHL008C	Low	5.9	1	603-624	LGGPPRRKIFTGPKHPHQCHTT	plas(13),E.R.(7),nucl(2.5),cyto_nucl(2),pero(2),golg(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LPE6	Tsc11p	Low	9.4	1	1412-1431	LENVIKHDNKREKRPTNFTR	nucl(17.5),cyto_nucl(10.333),mito(4.5),cyto_mito(3.833),cyto(2),plas(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LQT0	YCR072C	Low	8.3	1	1-24	MSTLIPPPSKKQKREAQLPREVAI	nucl(13),cyto_nucl(9.833),mito(8),cyto(4.5),cyto_pero(3.666)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PPV9	Glycine cleavage system P protein	Low	5	1	221-240	VSRKKKIKYVIDKKLHQQTK	mito(25),mito_nucl(13.833),cyto_mito(13.333)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PPW8	Protein ROT1	Low	5	1	200-221	ASTSSNKKRSLRQLVRRSLENR	extr(22),cyto(1.5),cyto_nucl(1.5),mito(1),E.R.(1),vacu(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4J4	Yef3p	Low	9.2	1	1003-1040	NKIAGGKKKKKLSSAELRKKKKERMKKKKELGDAYVSS	cyto(20.5),cyto_nucl(13),nucl(4.5)	KIAGGKKKKKLSSAELRKKKKERMKKKK (1004-1031, prob:0.999)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4X8	Agp2p	Low	5	1	550-574	YLGYKFIWKRGKDKCKNPREIDFSK	plas(26)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4Z8	YGR035C	Low	9.8	1	78-101	ENDLKRSKSQGRDKPRRSSNSRDN	nucl(20),cyto_nucl(14.5),cyto(7)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q6U9	Ice2p	Low	5	1	397-419	IPALQRKNDKQLRKSRRIMKGLY	plas(18),E.R.(6),mito(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q7X1	Rpl11bp	Low	7.6	1	131-155	MNRPGARVSRRKRCKGTVGNSHKTT	mito(10),nucl(9),cyto_nucl(9),cyto(7)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q828	Stress-associated endoplasmic reticulum protein	Low	8.8	1	16-39	NKNNEKFRKYGKKKVGKDDKKSAP	mito(13),plas(5),E.R.(3),nucl(2),golg(2)	NNEKFRKYGKKKVGKDDKK (18-36, prob:0.898)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8QAM8	Ssa3p	Low	5.8	1	240-260	ATEFKRKTKKDISNNQRSLRR	cyto(22),cyto_nucl(14.5),nucl(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PVE0	Csr2p	Low	9.7	1	867-886	RSNKNSKALHKIKQDKDHSK	nucl(19.5),cyto_nucl(14.833),cyto(7)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PVR5	Ddc1p	Low	8.6	1	557-581	DVDRKEMLKKEKLKHLKNSMYVRNG	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PXW3	Pac11p	Low	9.3	1	5-27	KELEEKRRQLKELRERRKQASLL	nucl(12),mito(10),cyto(2),pero(2),cyto_pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PY21	Nascent polypeptide-associated complex subunit beta	Low	9.6	1	17-38	ANKVGGTRRKINKKGNIFNSND	nucl(17.5),cyto_nucl(13),cyto(7.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q145	Nam7p	Low	8.2	1	69-88	SAKCVIKCNSCKKWFCNTKN	cyto_nucl(12),nucl(11.5),cyto(9.5),mito(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4I8	8-oxoguanine DNA glycosylase	Low	8.6	1	335-354	TTSGEIKKRKWNMIKETEQI	mito(10),nucl(9),cyto(6)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q5R2	Prolyl-tRNA synthetase	Low	6.5	1	520-544	EVRGIRWGKKDQWRKELEKKGQELE	mito(16.5),mito_nucl(11.5),nucl(5.5),cyto(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LIV1	Asi2p	Low	5	1	1-21	MSNRQHHRRGHRGERDDNDDY	plas(21),mito(2),pero(1),E.R.(1),golg(1),vacu(1),cyto_mito(1),mito_nucl(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LQL1	Clb3p	Low	9.7	1	389-409	RYACRRHNAIWRKYSSRRYLH	nucl(17.5),cyto_nucl(13.5),cyto(6.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PMC5	Ktr7p	Low	7.1	1	4-24	ILKPKVRRFLLDKHQRKRYIF	mito(6.5),nucl(6),E.R.(5),golg(5),cyto_mito(4.5),pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PNU8	Tos3p	Low	8.5	1	544-563	LVLKANDTQRKRRRMSLYKF	nucl(13),cyto_nucl(12.5),cyto(8),mito(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PPZ6	Hlj1p	Low	7.6	1	176-196	GSPFMRQQSRSRQRQQQAEEN	plas(10),nucl(8.5),cyto_nucl(6.5),cyto(3.5),pero(2),golg(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PQM9	Rpl41ap	Low	8	1	1-25	MRAKWRKKRTRRLKRKRRKVRARSK		AKWRKKRTRRLKRKRRKVRARSK (3-25, prob:1)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PY44	Cft1p	Low	8.2	1	175-196	QTANAFNKRKRTKLCEKFTGAS	nucl(11),cyto_nucl(9.5),cyto(6),E.R.(4),extr(2),pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8QB05	Ribonuclease P	Low	7.7	1	8-30	MSHTSKRVKKHPSLKTLTHKQIH	mito(15),nucl(9),cyto_mito(9)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LH12	V-type proton ATPase subunit H	Low	8.8	1	295-314	LQCCSTRVKQHKKVVKQLLL	nucl(13.5),cyto_nucl(10.5),mito(5),cyto(4.5),golg(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LM96	Cbp1p	Low	8.6	2	509-528, 542-561	SSLYIKKLCHYKKQNGKFVG, LNASKKDKIHWTKSNSNPFI	mito(20.5),mito_nucl(14),nucl(6.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LMT4	Pih1p	Low	9.1	1	1-22	MADFLLKPIKQRYKNENKYVAV	nucl(11),cyto(8),mito_nucl(8)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LNI7	Mrpl25p	Low	7.4	1	135-154	SKKGSQYAKRIDKIKKSQSI	mito(17),nucl(7.5),cyto_nucl(6.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LQA6	Rli1p	Low	8.7	1	8-37	IAIVSADKCKPKKCRQECKRSCPVVKTGKL	nucl(10),plas(6),mito(5),cyto(3),E.R.(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LQK6	Ent1p	Low	9.9	1	142-161	ERNMNIKGRNRKGRRGRGTG	mito(13.5),cyto_mito(8.833),nucl(7.5),cyto_nucl(5.833),cyto(3)	KGRNRKGRRGR (148-158, prob:0.861)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PI53	Pex15p	Low	9	1	245-272	INNKLQKDKMKYKDKQKGVKQKLHHFQE	nucl(16),cyto_nucl(14),cyto(10)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PI82	YOL111C	Low	8.3	1	44-66	PLPTLKYKYKQNHAKKLKLQHGQ	nucl(11.5),mito_nucl(10),mito(7.5),cyto(6)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PKW4	Dnm1p	Low	9.8	1	540-562	MDDIMKTRRKRNRELSKSKLAQQ	nucl(19),cyto_nucl(14.5),cyto(6)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PNX6	Ypt32p	Low	8.2	1	203-222	TISLTPAPKEDKKKKSSNCC	cyto_nucl(14),nucl(13),cyto(13)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3A7	Mitochondrial genome maintenance protein MGM101	Low	8.7	1	241-268	EKFVEHVTTKRKKKIWLRKDRQVEYPYK	mito(23),cyto_nucl(2.5),nucl(2)	RKKKI (251-255, prob:0.69)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3D7	Palmitoyltransferase	Low	5	1	272-295	LPIETYKYKKSKHTKDEKGLYFDV	plas(16),E.R.(4),mito(3),golg(2),cyto_mito(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q621	YER051W	Low	8.6	1	77-99	ISASSLRKGKRQRDTKKTEDGNH	nucl(13.5),cyto_nucl(13.5),cyto(10.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q7A1	Pho87p	Low	5	1	67-92	PGQPSSSKRKFTHKLKHKLFGSKQAS	plas(25)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q8G6	Glycogen [starch] synthase	Low	8.4	1	572-595	MEEFVNKTRRQRINQRNRTERLSD	cyto_nucl(13.5),nucl(13),cyto(12)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q9Q6	Prp9p	Low	9.3	1	54-80	ISENKVYKLKKVRRTRKQVILQQHEID	nucl(17.5),cyto_nucl(14),cyto(9.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LM67	DNA replication complex GINS protein PSF2	Low	9.8	1	24-44	PIKIFPRITTRQKINRNDRGV	nucl(19),cyto_nucl(12.5),cyto(4),pero(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LR38	Sco2p	Low	6.9	1	282-302	AYVPKEERERRSKKWYSFIFK	mito(16.5),mito_nucl(12.833),nucl(8),cyto_nucl(5.833)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PGP4	Asparagine synthase (glutamine-hydrolyzing)	Low	5	1	11-32	EDVHRYKPKALQLSKRIRHRGP	cyto(12.5),pero(9),cyto_nucl(7),mito(5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PGS4	Ath1p	Low	7.5	1	21-40	SSNSGNKKGTDKNSRFRHYC	plas(10),nucl(7),golg(5),cyto(2),mito(1),E.R.(1),vacu(1),cyto_pero(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PJK1	YDR332W	Low	5	1	599-619	AISSRFSKWRHSDPTPKQRDF	mito(23.5),mito_nucl(13.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PNL0	YGR026W	Low	8	1	1-28	MAKTIEVVRKKDPKKKNQSDPLAKQKLI	plas(18),E.R.(5),mito(2)	KDPKK (11-15, prob:0.63)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PPY9	E3 ubiquitin-protein ligase listerin	Low	9.7	1	1518-1538	VDRKLPSKTCPTCKNKFHGAC	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(2),pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PV50	Rho1p	Low	9.7	1	182-209	ASLMGKSKTNGKTKKNTTEKKKKKCVLL	mito_nucl(9.666),cyto_nucl(9.166),cyto_mito(9.166),nucl(9),mito(9),cyto(8)	KTNGKTKKNTTEKKKKK (189-205, prob:0.827)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4E4	Snf6p	Low	8.7	1	1-21	MGVVKKKRSHHGKSSRQQYYT	nucl(12.5),cyto_nucl(10),cyto(6.5),mito(5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q5P3	YKR011C	Low	9.5	1	313-349	TFDLKAWSRQRPRKFQLVEKKKLTKSSSNNHHRPHNN	nucl(17),cyto_nucl(12.5),cyto(6),mito(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q7A3	Prolyl-tRNA synthetase	Low	6.4	1	153-172	ATGGKKQQKKQQPSKSASAA	cyto(15),cyto_nucl(11.666),cyto_mito(10.166),nucl(7),mito_nucl(6.166)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LJN2	Hda2p	Low	8.5	1	218-239	DYDYSVKRNLKKRKFNNEDWLF	nucl(16),mito_nucl(12.333),cyto_nucl(9.833),mito(7.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LME2	Faa3p	Low	5.4	1	15-39	EHETAPRRNIRVKKRPVIRPLNSSA	plas(13),cyto(10),cyto_nucl(6.333),cyto_mito(6.333),nucl(1.5),mito(1.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LMH7	Syg1p	Low	5	1	16-41	RDKYIDYKVGKKKLRCYKDKLALEEE	plas(24),cyto(1),pero(1),E.R.(1),cyto_pero(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PH74	Ribosomal protein	Low	5	1	73-93	RRKGRVYIYCKSNKKHKQRQG	mito(22.5),mito_nucl(12.5),cyto(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PK85	Sma2p	Low	5	1	338-359	FLAANHYKTKPKKSDKCTESAS	plas(13),E.R.(7),mito(3),extr(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q1D9	Bzz1p	Low	9.4	1	166-187	IARNRCTKASNDRNKKKLNEKE	nucl(16.5),cyto_nucl(13.5),cyto(7.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4E7	Van1p	Low	9.2	1	39-60	QYDSKSLKSKYKYQPRSMSSKF	nucl(11),plas(6),mito(3),cyto(3),cyto_mito(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4I9	Succinate-semialdehyde dehydrogenase	Low	5.8	1	68-88	FKTYKNTSPRERSKWLRNMYN	cyto(19),cyto_nucl(12),nucl(3),mito(2),pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q6I6	Pho90p	Low	5	1	98-121	ITKPSPFRRMKEKIFDKRRSSSTS	plas(25)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q9M4	Pdc2p	Low	9	1	837-863	LNYVTLLKRIRKTKKQLGTKSIKIDNK	nucl(14.5),cyto_nucl(12.5),cyto(9.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LHS8	Mkk1p	Low	8.6	1	464-484	FIEYCLKKDSRERPSPRQMIS	nucl(17.5),mito_nucl(12.666),cyto_nucl(11.333),mito(6.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LIR1	YNL058C	Low	6.1	1	279-301	ATSNTSSPKKAHKRQTPSMFLDD	mito(6),plas(5),nucl(3),extr(3),pero(3),E.R.(3),cyto(2),golg(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LR89	Pep1p	Low	8.8	1	386-407	FFPAHRHRGKGKKSKSESKISV	E.R.(6),cyto(4),golg(4),pero(3),vacu(3),nucl(2),plas(2),extr(2)	RHRGKGKKSK (391-400, prob:0.838)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PHF4	YOR365C	Low	5	1	676-695	ECNGTRKPKISKIELCKQSS	plas(16),mito(5),E.R.(5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PKC0	YLR283W	Low	7.8	1	60-82	KNENKEKEQKEKEKEKENKHPIG	nucl(11),cyto_nucl(8.833),mito(6.5),cyto_mito(6.166),cyto(4.5),pero(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PQ55	Rad55p	Low	9.6	1	316-339	GEDRKRDATKRLKRTRSIEDRNTI	nucl(17.5),cyto_nucl(13),cyto(7.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PW92	Gnt1p	Low	6.1	1	35-56	NEEIKYYKKYFQQKKDGLQEIY	E.R.(7),golg(6),mito(4),pero(4),nucl(3),cyto(1),extr(1),vacu(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PYC8	Fmp30p	Low	7.5	2	18-54, 389-408	LVLTCKSKLCRPQTSWPSFKRHFSHIPRPTQKSSRKY, PCGQYCPEWHQRPRHINPQE	mito(19),cyto_mito(12.5),cyto(4),nucl(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZM2	Rnp1p	Low	7.9	1	14-38	SKTTTVVPEKKKFHKRALDERRSLY	cyto_nucl(13),nucl(11.5),cyto(11.5),mito(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q0K9	YDR387C	Low	5	1	330-351	NSTTTSGKRKRHRMEPRTIRAL	plas(22),E.R.(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q435	Shr3p	Low	8	1	181-207	SAGKTSEKTKKNDNKPKGAQKRKNAKK	plas(12),E.R.(6),mito(5),pero(3)	KTSEKTKKNDNKPKGAQKRKNAKK (184-207, prob:0.988)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LI86	Palmitoyltransferase PFA4	Low	5	1	74-99	GIWPNFCKKCQNYKPERSHHCKSCNQ	plas(15),mito(4),E.R.(4),golg(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LIA8	Mediator of RNA polymerase II transcription subunit 15	Low	9.7	1	963-982	GSGKRKPTKAVQRVRDQDSV	nucl(18.5),cyto_nucl(13.5),cyto(3.5),mito(2),plas(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LL43	Ies3p	Low	9.6	1	226-250	NANSLAFNRTKRRKINKNGLLENIL	nucl(19),cyto_nucl(14.5),cyto(8)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LNJ2	Tom20p	Low	6.4	1	34-53	RNSPQFRKMLRQRAKEQSKM	mito(12),nucl(4),pero(4),plas(3),cyto_nucl(3),cyto_pero(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PLP1	Peptidyl-prolyl cis-trans isomerase	Low	9.7	1	12-31	PTPWTVRYSKSKKREYFFNR	nucl(17.5),cyto_nucl(12),cyto(5.5),vacu(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PQP7	Cdc50p	Low	5	1	7-34	GAKVPLTKEKPVSKRPPNTAFRQQRLKA	mito(8),plas(8),E.R.(5),cyto_mito(5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PX18	6-phosphogluconolactonase-like protein	Low	9.2	1	77-96	EDGVIKKLKKDKERRFKIAL	cyto(17),cyto_nucl(12.833),cyto_mito(9.999),nucl(5.5)	KKLKKDKERR (82-91, prob:0.714)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PX88	Protein IBD2	Low	9.3	1	230-253	SVSSKRHSRTKHFKKNGHVRRHDF	nucl(18),cyto_nucl(13.333),cyto(6.5),cyto_pero(4.166)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PYU7	Translation factor GUF1, mitochondrial	Low	9.9	1	607-631	SDVSRRKKLLAKQKEGKKHMKTIGN	mito(12.5),cyto_mito(9.833),nucl(8.5),cyto_nucl(7.833),cyto(6)	VSRRKKLLAKQKEGKKH (609-625, prob:0.892)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q283	DNA-directed RNA polymerase subunit	Low	7.2	1	137-161	RMGILKKILDQCKKQRRCLHCGALN	cyto(13.5),cyto_nucl(12.833),nucl(10),cyto_mito(8.666)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q2Y1	Ynd1p	Low	8.1	1	537-557	VKTGIKRKLKFLRRSDPSSRL	nucl(10),cyto(5),golg(4),cyto_mito(4),mito(3),plas(3),cyto_pero(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q730	Multifunctional fusion protein	Low	5	1	17-38	SQLAHIKPPKHIKNEPIKPFRS	mito(21.5),cyto_mito(12.5),cyto(2.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q7P4	Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase	Low	5	1	316-335	RSFMKLYKIRIKRKPVQTFF	plas(14),mito(8),E.R.(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LPX5	Ceramide very long chain fatty acid hydroxylase	Low	5	1	332-354	SKLPPFMRKLKKYHLEHHYKNYQ	plas(20),E.R.(4),mito(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PI41	YOL019W	Low	5	1	520-542	ITQGYKPAYKRRMQNKNLPRATT	plas(12),E.R.(7),extr(3),pero(2),mito(1),cyto(1),golg(1),cyto_mito(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PPG0	YEL001C	Low	5.5	1	191-216	ISYYYMKSKTQQRPTKKSVTDKRVDE	E.R.(7),extr(5),cyto(4.5),golg(4),cyto_nucl(3.5),mito(2),nucl(1.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q2A1	Mlh2p	Low	9.6	1	669-688	GLRACVKKRGRTEVTPNEWC	nucl(19),cyto_nucl(12.833),cyto_mito(4.666),cyto(4.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q2R6	Ftr1p	Low	5	1	334-353	PAYWIKNKKKQELTEEQKRE	plas(20),E.R.(4),mito(1),extr(1),vacu(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q365	Anp1p	Low	8.3	1	483-506	LLDDNDKNKKKPPKEVPLDFDPDR	nucl(9),mito(9),mito_nucl(9)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3M2	YDR065W	Low	9.1	1	84-103	LMKPLKKTSKQLKTTKIVKS	mito(16),nucl(11)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3Y8	Protein acetyllysine N-acetyltransferase	Low	9.6	1	529-552	CDWAIPHKKWNELKNKKFECQEKD	nucl(17.5),mito_nucl(12),mito(5.5),pero(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4U0	Chk1p	Low	8.2	1	399-418	DDLARPRKSRLQFNPNKLTK	nucl(13),cyto_nucl(10.333),cyto_mito(6.166),mito(5.5),cyto(5.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q581	Mtw1p	Low	9.5	1	216-238	ALLQKLKSKGKEKKDYRTRYINI	nucl(16.5),cyto_nucl(14),cyto(6.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q590	Fun30p	Low	9.7	1	101-123	LQSARERLTRLRQQRQNWTWNKN	nucl(18.5),cyto_nucl(14),cyto(6.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q5M5	General transcription and DNA repair factor IIH helicase subunit XPD	Low	8.3	1	681-701	LADRRFSRKRSQLPKWIAQGL	nucl(12),cysk(11),cyto_nucl(9),cyto(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LH97	Mei5p	Low	9.2	1	33-55	DDNRICKKGDKDLKKHTNQKQLV	nucl(17.5),cyto_nucl(12.833),cyto(7),cyto_pero(4.333)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LJG0	Alkaline phosphatase	Low	8.7	1	16-38	GSISSPRPKARRVSKRSKIIVST	extr(8),plas(5),golg(4),mito(3),E.R.(3),nucl(2),cyto_mito(2)	RPKARRVSKR (22-31, prob:0.728)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LL19	YLR012C	Low	9.7	1	71-95	YMNAYIPKYRRKRDFPKYNMMKKTL	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LMB0	Cps1p	Low	7	2	5-24, 49-68	AEKKAPKKSLWQRHRTFLGG, AKPPHGGKGHRQSNKCKKIE	extr(7),E.R.(7),plas(3),cyto_mito(2),vacu(2),golg(2),pero(2),cyto(2),mito(2),cyto_pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PJT4	YMR102C	Low	8.8	1	124-151	NYLREPKYIKMLKRRKNLKQFRRLFLAQ	nucl(17.5),cyto_nucl(13.833),cyto(9),cyto_mito(5.333)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PRK7	Pex32p	Low	6.9	1	393-413	KYSSLESFTRSRRWKRRLFHL	plas(13),nucl(5),E.R.(4),cyto(2),mito(1),pero(1),golg(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PX85	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial	Low	8	1	105-128	DGIESKKGRRTRKIKIFNNNWLFF	mito(13.5),cyto_mito(9.5),cyto(4.5),plas(4),golg(2)	KGRRTRK (111-117, prob:0.672)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PXZ8	Sbe2p	Low	8.9	1	536-558	EELQRNKKRDDKVKKNEQNRITF	nucl(19),cyto_nucl(13.333),mito_nucl(11.499),cyto(4.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PYN9	Bul2p	Low	9.7	1	22-44	TEDNIHLLRKRRQQQLPRDSTEA	nucl(23),cyto_nucl(13.333),mito_nucl(12.833)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q0B3	Lem3p	Low	7.3	2	43-62, 265-284	VKPVHTKSRRPKEDAFTQQR, NWESDKKRFKKTKYNYTQIT	plas(15),E.R.(3),golg(3),vacu(2),mito_nucl(1),cyto_mito(1),pero(1),cyto_nucl(1),cyto(1),mito(1),nucl(1),cyto_pero(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q257	Alt1p	Low	5.8	1	47-68	SSTKLKAFRKVRPALQRHNSSW	mito(18.5),cyto_mito(11.833),cyto_nucl(4.333),cyto(4),nucl(3.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4Y3	Ira1p	Low	8.3	1	996-1021	PTILKGTKSPKPNKSRKNSDDKQLKF	nucl(9),plas(7),E.R.(4),pero(3),golg(2),cyto_pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q5Q6	Altered inheritance of mitochondria protein 9, mitochondrial	Low	8.2	2	65-86, 484-510	TWGSWLKNDKQQKEKRFTKFSI, QYQFMFKRTRNQHKWEKKLNENNPPLI	mito(23),nucl(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PMV5	H/ACA ribonucleoprotein complex subunit	Low	9.3	1	121-149	RFLPKPKVAGPPKPKNKKKRGGAPGGRGG	mito(15.5),cyto_mito(11.166),cyto_nucl(6.833),nucl(6),cyto(5.5)	PKPKVAGPPKPKNKKKRGGAPGGRGGAPMGRGGARGGFRGGRGGSSFRGGSRGGSSFRGGSRGGSSFRGGSRGGSRGGFRGGRR (124-207, prob:0.999)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PWB0	Ded1p	Low	9.9	1	22-41	VPPHLRGKPRGARNNSSNYN	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZ36	Leucyl-tRNA synthetase	Low	7.3	1	867-891	LPEGRKYLMNKKIKKFVMKNNVVSF	mito(18),nucl(6),cyto(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q1Q3	Elp2p	Low	6.9	1	751-770	ADKVTRLRWSHSKRNGKFYL	cyto(14),cyto_nucl(11.5),nucl(7),pero(2),vacu(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q493	YCR026C	Low	8.1	1	40-62	AWTRMKYWFYRNRLKWTNNRLVM	nucl(9.5),plas(9),cyto_nucl(6.5),golg(3),cyto(2.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q494	Sec59p	Low	5	1	31-51	HKTNMRARKVNQSKNARDFEC	plas(12),mito(8),E.R.(5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q8C1	Cytoplasmic tRNA 2-thiolation protein 1	Low	9.4	2	23-48, 285-304	ELCHSRKALIRRPKNLSKLCKQCFCS, NLALKAKKSNAKKKVVKFVD	mito(11.5),cyto_mito(9),nucl(8),cyto(5.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q9B2	Mrpl24p	Low	6.7	1	85-105	ISESKAKTRKKWLPNIVKKGL	mito(16.5),cyto_mito(10.333),nucl(6.5),cyto_nucl(5.333)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LHR2	YOR223W	Low	8.1	1	53-74	HWLRRMCRELRPQQTQNRRLKF	plas(9),nucl(8),cyto(3),E.R.(3),vacu(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LNW1	Ime4p	Low	8.9	1	526-574	NSHNTGTKKSDKKSNSKFQQQQYWNNINNSNYRTEIKQKNSNKNQTGFE	nucl(13.5),cyto_nucl(9.5),mito(5),cyto(4.5),pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PP41	Mdj1p	Low	5	1	471-490	SEQVLKKQKQEEEKHAKKDD	mito(21.5),cyto_mito(12.5),cyto(2.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZ91	Bub3p	Low	9.1	1	275-296	ISCWNLQTRKKIKNFPKFNENS	nucl(11),cyto(5),extr(5),mito(2),pero(2),vacu(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q0L5	Sensitive to high expression protein 9, mitochondrial	Low	6.6	1	137-157	LPSEREQHRKKWSRKLEFYFD	mito(10),nucl(5),plas(4),cyto_nucl(4),cyto(3),pero(3),cyto_pero(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q146	MMS19 nucleotide excision repair protein	Low	9.3	1	1001-1022	VPVLSDKKRIVRKQCIDTRQVY	nucl(16),cyto_nucl(13),cyto(8)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q2R2	54S ribosomal protein L31, mitochondrial	Low	8.3	2	16-41, 64-84	LWKIPWRMSTHQKYRQRERLRNVDQV, ALESKKKYKPRSKTLRLLNKS	mito(21),nucl(3.5),cyto_nucl(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q2R4	YER140W	Low	9.3	2	6-28, 118-146	TTVAKDTTKKRLIRRNSAPPAIH, FKSYRQHYHLQKRSGHKHKKPFEYKITTR	plas(18),nucl(6),mito(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q2Y3	Ctk2p	Low	7.5	1	10-31	FFSRPFLSKRQIQRAQKNTISD	mito(12),nucl(8),cyto_nucl(7.5),cyto(5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LHJ2	Kre5p	Low	5	1	1166-1185	WPQWLRPQRFSSRRRDVSKF	E.R.(11),extr(8),golg(4),cyto(1),plas(1),pero(1),vacu(1),cyto_pero(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PJH3	Ribonuclease H2 subunit B	Low	8.2	1	317-338	SVSIKKVTKKIVQSKKSRVAIG	cyto_nucl(14),nucl(12.5),cyto(12.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PP18	Protein-tyrosine-phosphatase	Low	9.3	1	363-383	EEYRLQKKKLKDDKKVVQANI	nucl(12),cyto(8),mito_nucl(8)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PPU8	Glutamate decarboxylase	Low	5	1	558-585	QDDIPTPEKTEKNKKLKERTTRNYRGTC	mito(15.5),cyto_mito(11.833),cyto(7),cyto_nucl(6.333)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZC6	YOL015W	Low	9.3	1	542-562	LFQNRTREKFKQFRNDLHRVA	nucl(16),cyto_nucl(11),mito(6),cyto(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZE6	Sul2p	Low	8	1	711-738	EVKKATRRGQLIRHRKKSDRPWNDPGPW	plas(24),E.R.(1),golg(1),vacu(1)	RRGQLIRHRKKS (717-728, prob:0.737)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q2E1	YGL140C	Low	5	1	1067-1089	DDFINGKSKPKKTWRSTTPFDGS	plas(19),E.R.(5),mito(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3G9	YDR514C	Low	7.1	1	440-459	NANNGKPKVNDNGRKKPRDL	mito(17),mito_nucl(13.5),nucl(8)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4L8	Tyrosine--tRNA ligase	Low	9.6	1	353-384	KGYPVAAPQKSKKTKKPKNKGSKYPGAPKTDE	cyto(20),cyto_nucl(15.5),nucl(7)	QKSKKTKKPKNKGSKYP (361-377, prob:0.965)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q806	Erg4p	Low	5	1	439-465	VHRAFRDQAKCKRKYGKDWDEYCKHCP	plas(21),E.R.(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q8E7	YFR038W	Low	9.7	1	150-181	DNSSAEQPVKRQKTKKKSITDFFKKQKKQEDV	nucl(18.5),cyto_nucl(13),cyto(4.5),mito(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LKD7	YLR253W	Low	5.6	1	12-38	FEVFRRYVRTSKRIPQRNPRTRRVLLM	mito(15.5),cyto_mito(11),cyto(5.5),nucl(2),plas(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LKM2	Pex30p	Low	9.4	1	387-410	SKDDTYSKYTRRRRWVRTAELIKA	plas(12),nucl(11),cyto(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PRN1	Tat1p	Low	5	1	47-76	QVKAQSTDSKPRLRNKCKKFFDSFKRQLPA	plas(25)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PY95	Ssy1p	Low	5	1	265-286	FHRSRATRKYHIQRKLKVRHIQ	plas(26)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PYU3	YOR238W	Low	9.6	1	242-267	WYATRDALRTKKKSRNPFNRTAPYTQ	nucl(12),mito(9),cyto(5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZE1	Sls1p	Low	7.9	1	47-72	LVKNDHKLLRHTPSRKRIPKESENED	nucl(14),mito_nucl(11.499),cyto_nucl(10.833),mito(7.5),cyto(4.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZG3	tRNA wybutosine-synthesizing protein 4	Low	9.9	1	65-84	EYFKFFVPKRIKRSPCINRG	nucl(17),cyto_nucl(11),mito(4),cyto(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q1L9	Mrps35p	Low	6.4	1	33-57	AYPFYPFKKLGRQHPKKHDTNLKVA	mito(18),cyto_nucl(5),nucl(4.5),cyto(4.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3S9	Tsc13p	Low	6.1	1	285-308	VQMYAWAQKKNKKYHTRRAFLIPY	plas(17),cyto(3.5),nucl(3),cyto_mito(2.5),pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q442	26S proteasome regulatory subunit RPN1	Low	8	1	15-41	QSQINAKKQTSNKKDKKKEEEEQLSEE	cyto_nucl(12),nucl(11),cyto(9),mito(5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q888	Gcn1p	Low	6.9	1	152-179	DNQEDTKKPQDKQNQHRKRIRHCIFQST	cyto(14.5),cyto_nucl(12.5),nucl(7.5),mito(2),E.R.(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q9A9	Mrps17p	Low	8.8	1	17-36	QKTVKVRVERKVFNKKINKE	mito(13),nucl(12.5),cyto_nucl(7.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LJV9	Cdc1p	Low	8	1	2-51	VYRNRSKSILSKHSKKSDDKVHHKSHSKKKSKSKNKKKSRSYWRHILIVW	plas(22),mito(3)	SKHSKKSDDKVHHKSHSKKKSKSKNKKKSR (12-41, prob:0.996)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LL66	GPI ethanolamine phosphate transferase 3	Low	5	1	14-38	SNDEKIIYKSRIKKFQKNHKFYIIL	plas(20),mito(2),pero(2),E.R.(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PGM1	Rpl11ap	Low	7.2	1	131-155	MNRPGARVSRRKRCKGTVGNSHKTT	mito(10),cyto(8.5),cyto_nucl(8.5),nucl(7.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q014	Nam9p	Low	7.5	1	410-431	HVYGRKEPKKPFFTPWKPRPFL	mito(17),nucl(7.5),cyto_nucl(5.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q147	YPL066W	Low	9	1	244-264	PTLFSTKKKFKSKLKLKSVTT	nucl(13.5),cyto_nucl(10),cyto(5.5),mito(5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q2M9	Swp82p	Low	9.8	1	482-508	TGLQNVRKVRTKKWKKYWQYKAGIPIG	nucl(20),cyto_nucl(14.5),cyto(7)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8QB68	Cln3p	Low	8.5	1	49-68	IASTKSKNPKLVKRELQAHH	nucl(12.5),cyto_nucl(9.5),mito(8),cyto(5.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LLE0	DNA primase large subunit	Low	7	1	499-528	HPNLYFERSRQLQKKQQKLEKEKLLNNGNQ	mito(16.5),mito_nucl(13.499),nucl(9),cyto_nucl(6.833)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PGS7	Histidine--tRNA ligase	Low	8	1	28-58	APAAPKAPKAPKAPKASKKNKLQVSLKTPKG	mito(25.5),cyto_mito(13.833)	APKAPKAPKAPKASKKNKL (31-49, prob:0.952)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PVL7	Cox11p	Low	5.4	1	67-86	QQLRELKRARERKYKDRTVA	mito(15.5),cyto_mito(9.333),plas(3),cyto_nucl(2.333),cyto(2),nucl(1.5),extr(1),pero(1),E.R.(1),golg(1),vacu(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q1Z5	Mpc54p	Low	9.7	1	431-452	KTVDKNRKYYPPTTKKCIKYVT	nucl(19.5),cyto_nucl(14.833),cyto(7)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q427	Mss116p	Low	7.1	1	53-72	KNDSNRRPGNSRFNSRPRAS	mito(16),nucl(6),cyto(2),extr(1),golg(1),vacu(1),cyto_pero(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q464	Dop1p	Low	8.7	1	11-32	DSNNKQLDSKQKKFRANVERAL	nucl(13.5),cyto_nucl(9.333),cyto_mito(4.333),cyto(4),mito(3.5),plas(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4J9	Glycogen [starch] synthase	Low	7.5	1	570-595	DYMEEFVKKTRRQRINQRNRTERLSD	cyto(13.5),cyto_nucl(12),nucl(9.5),pero(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q758	Gyp7p	Low	9	1	144-164	CPSTTDKLKRLRKSMNPFDDS	nucl(13.5),cyto_nucl(10),mito(7),cyto(3.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8QAS4	Pyruvate carboxylase	Low	5	1	953-972	PLRSDVLRNKRRKLTCRPGL	cyto(16.5),cyto_nucl(9.5),mito(7)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LH66	Isoleucyl-tRNA synthetase	Low	6.8	1	962-989	KLQILVEQSKRKNCPRCWKANSAKEDEL	mito(21),nucl(5.5),cyto_nucl(3.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LKC7	Tem1p	Low	8.3	1	209-236	GSQQHRLHSKSQDRKKHYTRKSSSSSTS	nucl(14),cyto_nucl(11.333),cyto(6.5),cyto_mito(6.166),mito(4.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZ37	Alpha-1,3-glucosyltransferase	Low	8	1	8-32	QNMAVTKKAKLKKNDEPKKTLKTAP	plas(21),E.R.(3),pero(2)	KKAKLKKNDEPKKT (14-27, prob:0.774)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZC1	Ifm1p	Low	5.8	1	35-60	INQQRLYAKGRRRNQISKKEMKPLNF	mito(22.5),cyto_mito(12.5),nucl(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q109	Protein FYV10	Low	9.2	1	469-491	NVYDLKKLKKLAKTLKKQNLISL	nucl(16.5),cyto_nucl(13.5),cyto(9.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q308	GDP-mannose transporter	Low	5	1	228-247	LYTVAKQKKTQQQKLLAATL	plas(13),mito(5),E.R.(5),golg(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3I9	Pex2p	Low	6.1	1	206-233	LLASAKRQGQRQRQRQRRESKTVCSHCD	mito(13),cyto(6.5),cyto_nucl(5.5),nucl(3.5),pero(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3X5	YDR338C	Low	5	1	41-60	NPLVRKFRARTRNTDQRSFR	plas(20),mito(3),E.R.(2),mito_nucl(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q466	tRNA (guanine(37)-N1)-methyltransferase	Low	7.1	1	359-387	NRKIKIPLPVRKRHRSQQQQQQQQQQPPQ	mito(13),cyto_nucl(8.5),nucl(7.5),cyto(6.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q810	Calcium-transporting ATPase	Low	5	1	180-201	LQFAKLNKKKEDRKIIVIRNDQ	plas(22),E.R.(2),golg(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q8R1	DNA repair protein RAD51 homolog	Low	7.5	1	349-368	TTRLGFKKGKGCQRICKVVD	cyto_nucl(10.5),cyto(10),nucl(9),mito(3),cysk(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LI73	Pep12p	Low	8.9	1	251-272	SNELRRAMRYQKRTSRWRVYLL	nucl(13.5),cyto_nucl(10.5),cyto(4.5),plas(3),golg(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LMW1	Non-specific serine/threonine protein kinase	Low	8	1	635-661	LDSNLEKKKRKRGSRGGKKGRKSRTAN	plas(10),E.R.(8),cyto(2),pero(2),golg(2),vacu(2),cyto_pero(2)	KKKRKRGSRGGKKGRKSR (641-658, prob:0.997)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LQG5	ATPase GET3	Low	8.5	1	281-303	QEHNCKRCQARWKMQKKYLDQID	cyto_nucl(14),nucl(13.5),cyto(11.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PJA9	Itr1p	Low	5	1	544-569	GFNIKASKALTKKRKQQATRVHELKY	plas(26)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PMI7	Sln1p	Low	6.5	1	944-964	EFNPESRKNRRVKFNVAKSIK	plas(8),E.R.(7),nucl(4),pero(4),mito(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PYF9	Nab3p	Low	8.7	1	753-773	HHNQTQPPQHQQQQHQQQQQQ	nucl(17.5),cyto_nucl(14.833),cyto(9),cyto_pero(5.499)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZ92	Qri5p	Low	9.9	1	73-109	MQLDSVMRKRKKKMKKHKLRKRRKKEKAERRKLSQGR	mito(22),nucl(5)	RKRKKKMKKHKLRKRRKKEKAERRKLSQGR (80-109, prob:1)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q1R9	Bud8p	Low	7.5	1	458-478	NPTIKKPAQSIRRSRKKDIDT	plas(12),nucl(8),cyto_nucl(5.5),golg(2),mito(1),cyto(1),pero(1),E.R.(1),vacu(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q273	Ras1p	Low	9	1	261-281	NYDNESNKKRNGNNRNHDNAP	nucl(15),cyto_nucl(12.5),cyto(6),mito(2),extr(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q808	Opy1p	Low	9	1	218-241	GILYTKVKKKKLFNRAKWQKFNVE	nucl(13.5),cyto(9),mito_nucl(8.5),mito(2.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LIN0	Isocitrate dehydrogenase [NADP]	Low	5	1	399-420	VSKRLKYMIRSSNKSKKCTCKL	cyto(15),cyto_nucl(9.5),pero(6),mito(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LIT4	Ipi3p	Low	8.8	1	225-244	DLSLIDSKKKQKKQEEKGDE	nucl(14.5),cyto_nucl(14.5),cyto(9.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PIW4	YNL194C	Low	5	1	258-285	QPQPRSNGKFFKKFRVKKRTVTNPGDEP	plas(21),E.R.(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PK69	YML082W	Low	7.2	1	79-106	CFPSYRVAKRCREYIRRKCADRNGKVRI	cyto_nucl(10.833),cyto(10.5),nucl(9),cyto_mito(7.666),mito(3.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PVQ6	Aurora kinase	Low	8	1	27-48	SKINKPWRISHSPQQRNPNSKI	mito(14.5),mito_nucl(14),nucl(12.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PYC3	YPL110C	Low	8.5	1	1006-1027	WSNNRMRLTKTFKKNNFKGNAR	nucl(13.5),cyto_nucl(10.333),cyto(6),cyto_mito(5.333),mito(3.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q0C7	Mon2p	Low	9.7	1	584-607	GDSTKDKELKRRLHPRNINSRQVS	nucl(14),plas(8),cyto_nucl(8)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q0Z3	DNA-directed RNA polymerase subunit beta	Low	8.7	1	308-327	LLLRGFKKRYPQLQNRTQVL	nucl(13.5),cyto_nucl(11.5),cyto(8.5),pero(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q2G7	Golgi apparatus membrane protein TVP38	Low	5	1	307-326	LYFKTKKRYLELQNRDRQVS	plas(26)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q534	Hsp26p	Low	7	1	185-206	TLTIPKLKPQKDGKNHVKKIEV	cyto(12),cyto_nucl(11.5),nucl(7),pero(3),vacu(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q5U4	Lhs1p	Low	9.6	1	808-846	SRLNEVKKLYLRKFRSQKRKEEKLKRKLEQEQSRGNNQT	E.R.(13),nucl(4),mito(2),extr(2),pero(2),golg(2)	LRKFRSQKRKEEKLKRK (818-834, prob:0.919)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q6Q4	Fal1p	Low	7.7	1	7-27	EDQKLKFKTSKKLKVSSTFES	nucl(11),cyto_nucl(10.333),mito(8),cyto(7.5),cyto_pero(4.666)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q8G1	Establishment of cohesion protein 1	Low	7.1	1	1-21	MRARKSQRRTSSKPNLIQSKL	mito(14.5),mito_nucl(12.333),nucl(9),cyto_nucl(6.333)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LJP7	Inositol-pentakisphosphate 2-kinase	Low	7.5	1	250-272	IDVDLKPKKKWTHWVKTENQLES	mito(13),nucl(7.5),cyto_nucl(6),cyto(3.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LQ75	Ena1p	Low	5	1	1041-1063	ELYKYGKRRYFKTQKAHNPESDL	plas(23),golg(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LQC9	Trehalase	Low	8.3	1	34-62	VYYGPPTDPRKQKQAKPTKINRTRTMSVF	nucl(11.5),mito_nucl(10),mito(7.5),cyto(6)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PX14	Mannosyltransferase	Low	5	1	118-137	MFDKITKKKKEEKEEKDIYV	plas(15),E.R.(5),mito(4),golg(2),cyto_mito(2),mito_nucl(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZH6	Ygk3p	Low	7.7	1	28-49	IVSTKNREKRKMYVREGKRIGY	mito(15.5),mito_nucl(13.5),nucl(10.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q073	Cpr7p	Low	9.6	2	352-371, 373-393	DYRLCKEKNPDDKVVKQRIE, VENLIEKKKEKTRKNISKFFS	cyto_nucl(15),cyto(14),nucl(10)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q1X4	Erg25p	Low	5.9	1	288-309	AKASREERMKKRAVNNAQKKTN	mito(13.5),cyto_mito(8.5),nucl(3),extr(3),cyto(2.5),plas(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3R4	Sds3p	Low	9.7	1	3-28	IQKVGNKDLSRKDKRRFNIESKVNKI	nucl(18),cyto_nucl(12.5),cyto(5),mito(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LNK7	Mdr1p	Low	9.4	1	591-611	CEKDKEPAFRKQKRNFLQRLF	nucl(14.5),cyto_nucl(9),mito(4),golg(3),cyto(2.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PH17	Ribonuclease T(2)	Low	7.1	1	286-307	FPKGYVPPSRRRPNKGERYRGV	mito_nucl(9.666),nucl(9.5),mito(9.5),cyto_nucl(7.833),cyto_mito(7.833)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PI06	Aus1p	Low	5	1	1373-1394	WPKVFRFCTKLIPHKGKKTVQH	plas(25)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PXP7	Rim21p	Low	9.2	1	454-482	HNNNSNSSKNEKKKQRKAMVRKRLGLDRP	plas(12),mito(7),nucl(3),E.R.(3)	NEKKKQRKAMVRKR (463-476, prob:0.873)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q2I8	Rho4p	Low	9.1	1	273-292	DTNISVSKPKRLRKNKCILM	nucl(16.5),cyto_nucl(13),cyto(6.5),mito(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q2J3	YKL063C	Low	9.3	1	127-158	VDAEKQKQINKDKKEQKQQKQQLQKEKQDIAK	nucl(16.5),cyto_nucl(11),mito(4),cyto(2.5),pero(1),E.R.(1),golg(1),cysk(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3F7	Jem1p	Low	7.7	1	610-630	RSNPHRKPFAQGPKQNNMFKN	nucl(8.5),cyto_nucl(6.5),extr(5),cyto(3.5),E.R.(3),golg(3),pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3X7	YIL152W	Low	7.5	1	101-122	TSSTSHRSPRKQEKQPQKFYLT	mito_nucl(11.999),mito(11.5),nucl(11),cyto_nucl(8.833)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q7G7	Rts3p	Low	9.6	1	10-30	MNKDVKYKKAVAKPARDRQTS	nucl(18),cyto_nucl(12),mito(5),cyto(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LI41	Ktr1p	Low	5	1	56-75	FKYTRVKSSKYKGSREKATF	golg(10),extr(6),E.R.(6),mito(2),cyto(1),pero(1),vacu(1),mito_nucl(1),cyto_pero(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LN33	YDR541C	Low	6.2	1	29-54	VIGTVRSHEKKEKLRRQFQHNPNLFL	cyto(11),cyto_nucl(8.5),pero(6),nucl(4),vacu(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LRN8	Fat1p	Low	8.2	1	617-637	TDNHKVLKKIYREQKLPKGID	mito(14),nucl(8),cyto(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PGM6	YPR109W	Low	7	1	14-33	IGNKRVYELRKRNFQRNLVN	plas(17),nucl(5.5),cyto_nucl(4),cyto(1.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PHR0	Dci1p	Low	8.3	1	252-271	SGEPFKRFQQLQKGNRRHKL	mito_nucl(11.332),nucl(11),mito(11)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PLB6	Mrpl13p	Low	8.1	1	37-58	RDFMSWFKRKKQEEHKEPVKDT	mito(15),nucl(9.5),cyto_nucl(6.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q264	Yvc1p	Low	5	1	537-559	VKETREAKRIKYNRMKRLNDDAN	plas(18),golg(4),vacu(2),mito(1),pero(1),E.R.(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4L4	YLR281C	Low	8.3	1	109-133	LLQWHRQQKRAQRRRSVAKYERSEE	mito(14.5),nucl(11),cyto_mito(8)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q853	Pyruvate carboxylase	Low	9.5	1	950-975	PEPLRSDVLRNKRRKLTRRPGLELEP	cyto(16.5),cyto_nucl(11.5),nucl(5.5),pero(4)	KRRK (961-964, prob:0.637)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PXX2	YPR157W	Low	7.3	1	254-273	EAVEKFKKLRKTKRHEDGND	extr(8),nucl(6),mito(3),cyto(3),vacu(3),cyto_mito(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q141	Aminopeptidase	Low	9.8	1	829-849	FGFNYNYKKRLNKNGKSQDEI	nucl(17.5),cyto_nucl(11.5),cyto(4.5),cysk(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3P9	Eps1p	Low	9.6	1	664-691	TIAKGPSSYRRYKIRKHYKAKRNAVGIL	E.R.(7),golg(5),nucl(4),plas(4),pero(3),cyto(2)	RYKIRKHYKAKR (674-685, prob:0.726)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3Y4	Stp4p	Low	9.9	1	262-287	SSLKDSSKITKQRKKKECPICHNFYA	nucl(21),cyto_nucl(15.5),cyto(6)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LH74	Mex67p	Low	9.3	1	411-430	LEANKKTGKNNYQKNRRYNH	nucl(14.5),cyto_nucl(10),mito(5),cyto(4.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LL60	Pre-mRNA-processing factor 19	Low	8	1	442-464	SKSLTVHKFDKKTKSWRGDESNT	mito(10),nucl(9.5),cyto_nucl(7.5),cyto(4.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LLG2	Lac1p	Low	8	1	2-31	STLKPKTSNNNLKVKSRPRRKSSIGKIDLG	plas(23),mito(2)	KSRPRRK (16-22, prob:0.685)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LLK7	YKL100C	Low	8.8	1	134-153	HDDDEDKKKKKNSKRFYDMM	plas(17),E.R.(4),nucl(2),golg(2)	KKKKN (141-145, prob:0.706)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PHC7	Magnesium transporter	Low	7.2	1	393-418	LSNSASSKLKKKRTWWKLTTHRLGIL	mito(18),nucl(6),cyto(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PIC3	YNR048W	Low	9.8	1	1-38	MGLILRWKEKKQRSSKQEKVQKSRKPANTSFRQQRLKA	plas(17),nucl(5),E.R.(2),mito(1),cyto(1),golg(1),cyto_mito(1)	KEKKQRSSKQEKVQKSRK (8-25, prob:0.758)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PJL3	YDR219C	Low	9.8	1	291-313	LIFRDSKPLQTKKKDNPRMKISS	nucl(20.5),cyto_nucl(13.333),cyto(5),cyto_mito(3.833)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PN44	Branched-chain-amino-acid aminotransferase	Low	5	1	23-45	LDASKLKITRNPNPSKPRPNEEL	mito(20),cyto_mito(13.5),cyto(5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZ60	Pin2p	Low	8.7	1	153-182	DFDLEKQKEKTKRKQKRQRNKEEHSPSRVV	extr(13),mito(4),golg(3),mito_nucl(3),nucl(2),pero(2),E.R.(2)	QKEKTKRKQKRQRNK (159-173, prob:0.927)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q183	Prm4p	Low	5	1	3-22	ADSSILKKHTPTKRNTRIVS	E.R.(8),extr(7),pero(3),golg(3),mito(2),cyto_pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q1M8	Pip2p	Low	9.4	1	4-51	TDTSSPKISKISKKRNRLSFVCQACRKAKTRCDQEKPRCGRCTKQNLF	nucl(13.5),plas(8),cyto_nucl(7.5),mito(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q205	Lipoyl synthase, mitochondrial	Low	5.8	1	63-86	LSATSPGKNLRRNRRRITEFKDAL	mito(23),nucl(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LKR4	Utp21p	Low	9.4	1	738-759	DVIRQRSKPKEAPKKSEKLPFF	plas(16),nucl(4),mito(4),mito_nucl(4)	PKEAPK (746-751, prob:0.616)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LKU7	Sterol 3-beta-glucosyltransferase	Low	8.6	1	25-46	DMLSRISRRHHRLSKSLSKLKH	nucl(13),cyto_nucl(12),cyto(9),vacu(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PKZ7	Rpl10p	Low	6.4	1	1-30	MARRPARCYRYQKNKPYPKSRYNRAVPDSK	mito(17),nucl(4),cyto(4),cyto_nucl(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PVH5	Pdr12p	Low	5	1	247-267	FALKCKTPRVRIDKMTRKQYV	plas(23),E.R.(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZQ2	Pho91p	Low	5	1	126-150	QSQNVVRNRKSKSQQRQRRFSSVSS	plas(24),pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZU8	YNL080C	Low	6.1	1	288-315	NRPSSSNSQSPKRSKKPPQNAFNFTTKR	plas(17),nucl(3),E.R.(3),mito(2),cyto_nucl(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q152	Sur1p	Low	5	1	336-357	SPNLLARQQKRLRKDSNTNILI	plas(9),E.R.(9),golg(6),cyto(1),extr(1),pero(1),cyto_pero(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q1K8	Rsr1p	Low	8.6	1	252-271	GTAATSQQQKKKKKGSCSIL	nucl(19),cyto_nucl(12.666),mito_nucl(12.666),mito(4),cyto(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q2R1	Oxa1p	Low	5	1	377-398	QESFNEKRKNSKVKIVHKSNII	mito(17),plas(4),E.R.(3),extr(1),pero(1),golg(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3J4	Pso2p	Low	8	1	28-47	GTYCKGTRTQSTKRQRYLTE	nucl(13),mito_nucl(11.833),mito(9.5),cyto_nucl(9.333)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q443	YDL199C	Low	5	1	104-123	ILQLRSKKIRHSSRTLRASF	plas(24),E.R.(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q7F4	Nat2p	Low	5	1	272-294	ATALDITKRKPRTKSQKWFNGLM	mito(12),E.R.(4),extr(3),pero(3),plas(2),cyto_pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8QB02	Csh1p	Low	5	1	340-362	VRNEYNSRGKRLRKDSNIPYNNV	plas(11),E.R.(8),golg(5),mito(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LLN4	Ribose-phosphate diphosphokinase	Low	7.8	1	89-110	IPQFPYSKQCKMKKHRGAITAR	cyto(14),nucl(7),mito(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LM01	Ymr1p	Low	8.5	1	579-601	KTKSVWNYFRSRRKQFLNPNFVQ	mito(10),nucl(9),cyto(5),golg(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LM58	YJL084C	Low	9.6	1	754-777	EENKHKKDTISKKKENKDVKNLAS	nucl(19.5),cyto_nucl(13.333),cyto(6),cyto_mito(3.833)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PMJ1	Axl2p	Low	5	1	786-808	STEPDRRPSKKRLVDFSNKSNVN	extr(12),plas(4),E.R.(4),mito(2),cyto(2),golg(2),cyto_mito(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PPD8	High osmolarity signaling protein SHO1	Low	6.3	1	1-23	MSVSSKIRPPPRKSPRMATDHSF	plas(16),nucl(3.5),mito(3),cyto_nucl(3),golg(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PRH8	Rim2p	Low	6.7	1	309-330	HEVVRTRLRQTPKENCKRKYTG	cyto(15.5),cyto_nucl(11.5),nucl(6.5),pero(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q3K5	Non-specific serine/threonine protein kinase	Low	8.4	1	342-366	TPARSIQITKQKRKKPTKISSTTSS	nucl(16.5),mito_nucl(11.666),cyto_nucl(11.333),mito(5.5),cyto(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q421	YDL177C	Low	8	1	72-95	LVPQHDQKKKSSKNNKNNNTDKSK	mito(13.5),mito_nucl(13),nucl(11.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q786	YCR043C	Low	6.1	1	94-115	TWRSGGKKNKLGWNKKKDDFKI	cyto(10),extr(6),mito(5),nucl(3),plas(1),pero(1),golg(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LGT9	Syt1p	Low	7.7	1	70-93	VESAKKHSKLSRIRHKMSRLDLNF	nucl(9.5),mito(9),cyto_nucl(9),cyto(7.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LGY1	Coatomer subunit zeta	Low	9.1	1	41-60	FNSVKKQKEFEKQLHRKTHK	nucl(15.5),cyto_nucl(15),cyto(7.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LIL3	YNR014W	Low	9	1	190-213	HSDPSCPCNRHHHRRNSVAVKFNK	nucl(17.5),cyto_nucl(11.833),cyto_mito(5.333),cyto(5),mito(4.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LR98	YIL166C	Low	5	1	497-521	ATKFYYISRNRYKERKWNSLTKEEQ	plas(22),golg(2),mito(1),pero(1),E.R.(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PVG0	Opy2p	Low	7.8	1	111-137	VSLFFINKKYWRPKRQRNKALKLEEES	nucl(8.5),mito(6),cyto_nucl(5.5),golg(4),E.R.(3),vacu(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q407	YDL146W	Low	9.4	1	464-486	AESLTKRKVRTVPPPPPPSRKCG	nucl(17.5),cyto_nucl(12.333),cyto(6),cyto_mito(3.833)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4B6	Mip6p	Low	8.5	1	20-43	PRTISKTSSKEKDVKQKNFKMIFT	nucl(16.5),cyto_nucl(12.833),mito_nucl(11.832),mito(5.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q5E4	Glutamyl-tRNA synthetase	Low	9.2	1	529-551	PQEPKVEMKPKHKKNPAVGEKKV	cyto(19),nucl(3),pero(3)	KHKK (539-542, prob:0.62)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q5G7	Fe-S cluster assembly protein DRE2	Low	8.8	1	248-273	ITMITCGKSKTKKKKACKDCTCGMKE	nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LPS2	Avt2p	Low	5	1	433-455	TNLLLTSKKKSWKAKLPYYLCIC	plas(26)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LPX0	YMR310C	Low	7	1	1-21	MSGMKKFKKVEKPLSQTRHYS	mito(17),nucl(6.5),cyto_nucl(6),cyto(2.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q479	Threonine synthase	Low	8.6	1	477-499	PEDLKKLSTLKKKLKFIEKADVE	nucl(9),mito(8),cyto_nucl(8)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4D3	Stp2p	Low	9.7	1	315-334	SERIREKKKTSKMKMIKTSD	nucl(18.5),cyto_nucl(14),cyto(6.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q5A6	Sed5p	Low	9.4	1	10-36	FQQSVLSYKKRNKNFKEQQRERLQEQE	nucl(18),cyto_nucl(12.833),cyto(5.5),cyto_mito(4.166)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q6Z6	DNA ligase	Low	6.9	1	586-605	HYEPSKRSRNWLKLKKDYLD	mito(14),mito_nucl(12.666),nucl(10),cyto_mito(8.666),cyto_nucl(6.666)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q768	Sfb3p	Low	9.6	1	22-45	HAGGASSKKSRRPHRAYHNFSSGT	nucl(17),cyto_nucl(13),cyto(7)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LGV2	Axl1p	Low	9.2	1	1012-1039	NYAINNRQMKQHRRIRNKIAEKRLHFQE	nucl(15),cyto_nucl(11),mito(5),cyto(5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LP11	Rtf1p	Low	9.6	1	165-191	IKASKLSQLKKQRARKNRQYSDNEEEK	nucl(18),cyto_nucl(12.5),cyto(5),mito(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LRP2	Yro2p	Low	8	1	297-338	DSDSSIKEKLKLKKKHKKDKKAKKAKKAKKAKKVQEEEEEAA	plas(25)	KEKLKLKKKHKKDKKAKKAKKAKKAKK (303-329, prob:1)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZH2	YLR020C	Low	6.1	1	45-74	PRDTRSSRTKIQTSDKKKRQPARHSWPLSI	E.R.(8),extr(6),golg(4),nucl(3),mito(2),cyto_nucl(2),pero(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q1T6	Csr1p	Low	8.9	1	37-61	QNNSASSTPPKKKKSSWFSKLQSSE	nucl(15.5),cyto_nucl(13.5),cyto(10.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q2W5	YNL046W	Low	5	1	33-52	TANRLRKLLRRRQSHQPFLK	plas(25)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q475	Img1p	Low	5	1	133-155	IDLLRPHTSNRQRNKHYYIRGTK	mito(25)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4T7	YGR125W	Low	5	1	786-810	LFQYKQLREKAKKRLEERKQSNVVS	plas(16),E.R.(7),mito(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q6T3	Erp3p	Low	9.6	1	123-145	QDDARHERRKARKVQRNLRDSKI	E.R.(11),golg(5),nucl(4.5),cyto_nucl(3.5),plas(3),cyto(1.5)	RRKARK (130-135, prob:0.678)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q7Q5	Mrpl16p	Low	5	1	40-59	EYAPRFKIVQKKQKGRVPVR	mito(18.5),cyto_mito(12.833),cyto(6),cyto_nucl(4.833)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LHA1	Bem3p	Low	9.4	1	20-40	QYNNHRSKKDKAIEQIEKRTS	nucl(17),cyto_nucl(13.5),cyto(8)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LP48	Met10p	Low	8.9	1	54-73	QDLKRWSQKKGDESRSKTFF	nucl(14.5),cyto_nucl(12),mito(6),cyto(4.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PKZ5	YLR065C	Low	9.5	1	155-178	ASEGQSKSKRQMKRDRRGDGDSKI	mito(9.5),cyto_mito(7.5),nucl(5),cyto(4.5),plas(4),E.R.(2)	KSKRQMKRDRRGDGDSKIKVK (161-181, prob:0.811)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PQ06	YDR115W	Low	8.9	1	80-105	LARAKSKQGSKILKRRKLKGRWFLSH	mito(20.5),cyto_mito(11.333),nucl(3.5),cyto_nucl(2.833)	KRKRTFGFLARAKSKQGSKILKRRKLKGR (72-100, prob:0.977)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PR22	Vac17p	Low	9.9	1	372-393	SESFQSKKGKKSKGLNDERISN	nucl(19),cyto_nucl(13.5),cyto(6)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q026	Signal recognition particle receptor subunit beta	Low	6.5	1	225-244	EGSVSKKNITKWRKWIDEKI	mito(12.5),cyto_mito(9.666),cyto_nucl(6.833),nucl(6),cyto(5.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q362	YEL043W	Low	9.3	1	900-925	MTPKMPSKGLSKPSHKRNQSNSSISS	nucl(12),mito(4),cyto(4),extr(4),cyto_mito(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LLB3	Uip5p	Low	5	1	414-439	VYIRVFQRRFRTIRLRRQRANSHSVG	E.R.(9),plas(6),golg(5),mito(3),extr(2),cyto_mito(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PGV4	Muk1p	Low	8.4	1	585-607	GVGKREIQKSWKKYKGYKFDDLT	nucl(15.5),cyto_nucl(12.333),mito_nucl(10.166),cyto(7)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PPH0	Protoporphyrinogen oxidase	Low	5.8	1	218-238	LFDNMRKKSKDKKGNNSSQPL	mito(14),cyto(5),extr(4),nucl(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q159	Utp9p	Low	9.3	1	471-490	LNSIKDKHTKKNVKHLKSAL	nucl(16),cyto_nucl(12),cyto(6),mito(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q5Q5	Avt3p	Low	7	2	8-28, 608-627	DGSDRTRSRGNYKNNKNNTTM, ASGKHNPKVKWLKNYFRCAV	plas(26)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LK59	Ymd8p	Low	5	1	55-76	GIYIRIRHKPMKNVLRRENSFN	plas(14),E.R.(6),mito(4),golg(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PI86	Itr2p	Low	5	1	574-597	GFNIKASKALAKKRKQQVAQGAAH	plas(27)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PJW3	Trm9p	Low	7.3	1	174-196	NLKPKSTSPSQPKPKPKPDLTNI	cyto(11),cyto_nucl(10.5),nucl(8),pero(5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q0M0	Dit1p	Low	8.9	1	392-413	LLEHFQRYSRKKFKKTISMIAF	nucl(14),cyto_nucl(12),cyto(8),golg(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q133	YPR078C	Low	9.4	1	120-142	YGQDWKRRMNKWFRKNKSQFTTQ	nucl(17),cyto_nucl(13),cyto(5),mito(4)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q8B1	Phospholipid-transporting ATPase	Low	5.8	1	1255-1278	QFQNAIRKVRQVQRMKKQRGFAFS	plas(21),nucl(2),E.R.(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LRF2	Mba1p	Low	5.7	1	32-58	ILNKGSETTKKKDKNKQQDFNPRHLGV	mito(23),nucl(2),cyto(2),cyto_nucl(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PPC2	Shc1p	Low	8.1	1	492-512	GTVPRRHPESTQKYRKPSDEI	cyto_nucl(14.833),nucl(14),cyto(9.5),cyto_mito(6.498)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PYV0	Sec63p	Low	6.2	1	68-98	SDEIKQFRRKFDKNSSKKSKIWNKRNIMIIV	mito(6),E.R.(6),cyto(5),nucl(3),golg(3),cyto_pero(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PZP7	Lro1p	Low	8.7	1	58-85	YGEDIDRKKDKKSKKRWRDSRRLIFILG	plas(19),nucl(2),mito(2),E.R.(2),golg(2),mito_nucl(2)	GHKRRRGISGNAKRKEYGEDIDRKKDKKSKKRWRDSR (42-78, prob:0.991)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q213	YLR225C	Low	9.4	1	35-55	KLEWYCRTSNHKKFKSHSLLR	nucl(12),cyto(9),mito(3),pero(1),golg(1),vacu(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q355	Cdc11p	Low	8.3	1	5-27	IDASSALRKRKHLKRGITFTVMI	nucl(16),mito_nucl(12.999),cyto_nucl(10.833),mito(8.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q418	YDR179W-A	Low	8.2	1	25-44	YKGLLSKKGHTRLRSKPSNN	nucl(14.5),mito_nucl(11.832),cyto_nucl(11.333),mito(7.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q6A7	Loh1p	Low	8.9	1	152-175	DEEKKEEAKEKRKRLDKIKNILTV	E.R.(9),cyto(6.5),cyto_mito(5),nucl(3),mito(2.5),extr(2),pero(2),vacu(2)	EAKEKRKRL (158-166, prob:0.782)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q8Q1	Golgi to ER traffic protein 2	Low	9.2	1	4-28	LTETEKRRLLRERRQKKFSNGGASS	plas(22),nucl(3)	RERRQ (14-18, prob:0.627)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LRH9	Mrps9p	Low	8.7	1	250-278	GVLTRDYRHVERKKPGKKKARKMPTWVKR	mito(21.5),mito_nucl(12.833),nucl(3),cyto_nucl(2.833)	VERKKPGKKKARKMPTWVKR (259-278, prob:0.993)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PNG1	Asparagine synthase (glutamine-hydrolyzing)	Low	5	1	13-32	VHHFKPKALQLSKRIRHRGP	cyto(14),cyto_nucl(9),pero(8),mito(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PV45	Alpha-1,4 glucan phosphorylase	Low	8	1	43-67	TMIPLKSRSLWNKHQVKKFDKPEDF	cyto_nucl(12.5),nucl(12),cyto(11),pero(2),vacu(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q208	Cpr6p	Low	7.8	1	344-371	ILKAIHDTKLKRKQQNEKAKKSLSKMFS	cyto(15),nucl(7),mito(3)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q2D3	Fps1p	Low	8	1	543-569	MIMRAWFRRPGWKKRNRARRTSDLSDF	plas(23),mito(1),cyto(1),pero(1),vacu(1),cyto_mito(1),cyto_pero(1)	RRPGWKKRNRARR (550-562, prob:0.851)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q2L1	Ira2p	Low	7.7	1	1-21	MSQPTKNKKKEHNDDAQPSYM	plas(14),nucl(7),E.R.(3),golg(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4A9	Ecm14p	Low	7.4	1	232-253	TWSNDRLWRKNRQRTRVPQCFG	cyto_nucl(9),nucl(8),cyto(8),extr(3),mito(2),pero(2),golg(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q5E3	Isa1p	Low	8.5	1	124-151	KSDCSCTEAPKKRKRKLRPRKALITLSP	mito(22.5),cyto_mito(12),nucl(2)	PKKRKRKLRPRKALIT (133-148, prob:0.99)
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q833	Dolichyl-diphosphooligosaccharide--protein glycotransferase	Low	5	1	695-718	VGASTRSSTKPRRSIKRPELGLRV	plas(22),E.R.(2),mito(1),golg(1),vacu(1)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LHX9	Frt1p	Low	9.2	1	102-121	EPALRDKKHLHVTNKRSHRT	nucl(11),cyto(6),mito(3),pero(2),E.R.(2),golg(2)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8LR63	Kip1p	Low	9.2	1	53-72	IHVYVRCRSRNQREIEEKSS	nucl(15.5),cyto_nucl(10.5),mito(6),cyto(4.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8PW97	Myo2p	Low	9.5	1	861-880	DLQKKIRKELKQKQLKQEHE	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	
UP000006968	Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644)	J8Q4D6	Hmlalpha1p	Low	7.8	1	2-29	FTSKPAFRIKKTSKSHRNSTISKKVRDK	nucl(12.5),mito_nucl(12.499),cyto_nucl(10.166),mito(10)