ProteomeAccession ScentificName ProteinAccession ProteinName Category ConfidenceScore #NoLS Positions SegmentSeqs PSORT NLS UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V223 Uncharacterized protein Low 5 1 311-333 VSFGRKSNSSGKQKSRKPIDGLW plas(14),extr(5),E.R.(3),mito(2),vacu(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9U2 Protein kinase domain-containing protein Low 6.9 1 599-621 GSTKDRADRARRMRHRQSHPVAS mito(6),cyto(6),cyto_mito(6),nucl(5),plas(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VZU4 Endopeptidase Low 8 1 470-514 MAKSKNHTAHNQNKKAHRNGIKRVQTQRYKSLKGVDPKFRRNAKF cyto(11),nucl(8),pero(8) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WND9 Uncharacterized protein Low 7.4 2 1252-1274, 1481-1502 ALQVRDLTKRYRKAKKPAVDGVT, RCTSTAARTKQRPRGPSPPDPA plas(24),nucl(1),cyto(1),cyto_nucl(1),E.R.(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V329 Endoplasmic reticulum protein Low 6.5 1 791-810 RPWNKIREYFRQRRNKLRGL plas(12),extr(5),nucl(4),pero(2),E.R.(2),mito_nucl(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VCR2 Uncharacterized protein Low 8.4 1 178-200 NWQLKMDKRKFSKSQKSRDDSNL nucl(11.5),cyto_nucl(9),mito(8),cyto(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGD1 Meiotic recombination-related protein Low 7.2 1 653-679 ASSAWRYKPFSHRTRRVRERSASWRPD mito(16),nucl(6),cyto(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJM5 Uncharacterized protein Low 8.7 1 405-430 QESSMRRRDGAPRAPRRHHRGPRGGK extr(15),cyto(5),cyto_nucl(4.5),pero(3),nucl(2) RRRDGAPRAPRRHHRGPRGGK (410-430, prob:0.981) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VT09 Uncharacterized protein Low 8.9 1 38-59 QSQPAKHPRPPLPQPPQPPQHA nucl(14.5),cyto_nucl(10.5),mito(7),cyto(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VVB2 RNA polymerase III transcription factor Low 7.4 1 93-113 LHTSAKRPAKRRPSHEVQLLL mito(13.5),cyto_mito(9),nucl(8),cyto(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VVN2 CUE domain-containing protein Low 6.7 1 252-273 SDTIRSTSTRRKRPPLPPIPTS mito(9),nucl(5),cyto(5),extr(5),cyto_nucl(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWX2 Uncharacterized protein Low 6 1 123-144 LYLTCRSIYRKLRIKNNPVLYH mito(15.5),cyto_mito(10.833),cyto(5),nucl(4),cyto_pero(3.833) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W8Y1 Uncharacterized protein Low 5.7 1 180-202 LPMPGSSRNSRKPKQSNDPLISY plas(13),extr(5),cyto(4),nucl(2),E.R.(2),cyto_pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V3P9 Uncharacterized protein Low 5 1 68-90 NGSRKMWARYRAKREQRKADQAE extr(11),plas(6),E.R.(3),mito(2),cyto(2),cyto_mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9S6 Metallochaperone Low 5 1 5-29 EVLAHPPPHKHHPRPPPPEQHPDLE mito(11),cyto(8),pero(3),cysk(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VCT4 Uncharacterized protein Low 9.1 1 143-164 SRNPSHRRPSRTLKPPTRNDIC nucl(14),mito(11),cyto_nucl(9) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJT0 MFS domain-containing protein Low 8 1 551-577 LVVARGGKWREKRKDRQAEKERKKAEA plas(22),E.R.(3) RGGKWREKRKDRQAEKERKKA (555-575, prob:0.958) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLX8 Uncharacterized protein Low 8 1 516-553 PQTPTEKHKTHGKKPKKCKPKSKRSKLEHARRSRRRFH extr(26) KHKTHGKKPKKCKPKSKRSKLEHARRSRRRFH (522-553, prob:0.998) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VN30 Uncharacterized protein Low 5 1 7-29 LSIPSAFRTRQRPKTAQAKAQTS mito(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VNT8 Regulation of budding-related protein Low 9.5 1 744-770 EVFPREFAKCRRCRKAKYCSKECQSKA nucl(16.5),cyto_nucl(10.5),mito(6),cyto(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQ00 Uncharacterized protein Low 5 1 247-267 GFVVWRCMKRRRARDEKSAFV extr(26) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VS06 Uncharacterized protein Low 6.2 1 1-20 MGQRQRSSRTTRHGRRETSF mito(19),cyto(4),nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VVD1 Uncharacterized protein Low 8 1 906-927 AAQLKKKEKKRGPARKLVKDEE plas(22),extr(2),E.R.(2) KKKEKKRGPARKL (910-922, prob:0.961) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WGA5 Uncharacterized protein Low 8.4 1 99-121 DGNYKHHKGHKHHEKDERGWKKW mito(11),plas(7),pero(2),E.R.(2),golg(2),nucl(1),cyto(1),cyto_nucl(1),vacu(1) KHHKGHKHHEKDERGWKK (103-120, prob:0.747) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9M6 Uncharacterized protein Low 9.2 1 36-59 IFNPTLIPPKRRQRNKVDDQSTES nucl(16.5),cyto_nucl(13),cyto(6.5),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VEP5 Uncharacterized protein Low 9.3 1 265-288 EATTGQSKKRRSRLAEQEDRKPVI cyto(18),cyto_nucl(12.5),nucl(5),pero(2) PRIAGKKKRKSADAAPEAGPSRLRPEATTGQSKKRRSR (240-277, prob:0.953) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VMQ9 Alpha-1,2-mannosidase Low 5.3 1 1-21 MSKVPTPKRRASPPPRVSETT plas(12),mito(10),nucl(1),cyto(1),cyto_nucl(1),pero(1),E.R.(1),vacu(1),cyto_pero(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VNK1 AMP deaminase Low 7.8 1 945-966 VLDSRSRKRSQTDLKRRSQLGM cyto_nucl(10),nucl(9.5),cyto(9.5),pero(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRR7 Vesicle-fusing ATPase Low 7.1 1 26-45 YTVRCPTGPNRLTNRKRTSS cyto(15.5),cyto_nucl(13.833),nucl(10),cyto_mito(8.666) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUS1 Reverse transcriptase Low 6.4 1 62-84 VERHAIPTLKKRRASRLKLADGS mito(11),cyto(7.5),cyto_nucl(6.5),nucl(4.5),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWK2 Trehalase Low 5 1 588-610 GTNGGGRRRRWWRRQQGDPNADP extr(26) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W3H2 Uncharacterized protein Low 5 1 330-351 MSTHPASKKRIKALRKEQPEAM mito(17),extr(4),plas(3),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W6E7 Phospholipid metabolism-related protein Low 8 1 188-232 PPPAPAQLERGRRRRRLRHGSLERRPPPQRRGRPPPERGHCRLAE plas(23),E.R.(2) LERGRRRRRLRHGSLERRPPPQRRGRPPPER (195-225, prob:0.994) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W7G9 Actin-related protein 8 Low 7.9 1 42-65 QAGPSEKAPRRVYNRKVKNPAGDF cyto(15),cyto_nucl(14.5),nucl(12) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WLE3 Uncharacterized protein Low 9.6 2 1-27, 531-554 MMNRRDERDPKKKQQGGKKEDDFQQPK, VGAYLYLRRRRLRRQLAARGGRVS plas(9),cyto(8),nucl(7),mito(1),pero(1),vacu(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VG53 Uncharacterized protein Low 8 1 218-242 FPLSPCVCKKEKKKSIVKKELGIKS cyto(12),cyto_mito(11.833),mito(10.5),cyto_nucl(7.833) KEKKKSIVKK (227-236, prob:0.713) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLU0 Uncharacterized protein Low 8.1 1 82-102 SPQPEVKTPRRPRKSVNKAVA cyto(16),nucl(8),mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRE4 Uncharacterized protein Low 7.5 1 72-91 SVSSRGSRRRKAPPIHYLPA plas(10),nucl(7.5),cyto_nucl(5.5),mito(5),cyto(2.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VV85 Uncharacterized protein Low 5 1 365-388 EAEDSKGERQQRKYYNRRGKVIGT mito(14.5),cyto_mito(10),pero(7),cyto(4.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VX10 Ion_trans domain-containing protein Low 5 1 50-69 APTTAHRRPRRTSSNPIKSG plas(21),E.R.(3),vacu(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W019 Fatty-acid synthase complex protein Low 5.8 1 1223-1242 LEPSQLKEYKEKRRERELDS cyto(17),cyto_nucl(11),mito(5),nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WP63 Peptidase_M24 domain-containing protein Low 6.8 1 4-27 DPPPESRYYRDRDPKERRATYFPN plas(9),mito(7),nucl(5.5),cyto_nucl(5),cyto(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VIE4 Uncharacterized protein Low 6.9 1 30-53 ALSRANRSFRREARWRLRPLEHFD cyto(9.5),cyto_nucl(8.5),nucl(6.5),mito(3),pero(3),cysk(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKN6 Dimer_Tnp_hAT domain-containing protein Low 9.9 2 108-131, 230-253 LQPPSPSLRRSPRERSPRRLSMES, LQPPSPSLRRSPRERSPRRLSMES nucl(10.5),cyto_nucl(9.5),cyto(7.5),mito(5),extr(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VL87 Uncharacterized protein Low 8 1 47-70 RFAAQHKLKHPSRRSRHSKPIATA extr(12),plas(10),E.R.(3) KHPSRRSR (55-62, prob:0.659) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VS56 Uncharacterized protein Low 9.8 1 485-515 VEQVTPRKTPKSKSSKPTTPSRVRHQIRQIE nucl(17),cyto_nucl(10.5),mito(8) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VXE7 Plasma membrane ATPase Low 5 1 29-50 ATEEEPKKKREYKGFEEKHEGD plas(22),E.R.(2),golg(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V8Q1 Oxidored_FMN domain-containing protein Low 7.8 1 371-395 IFAPRTPRPSKPSTRPRRWASHTSS nucl(9.5),cyto_nucl(9.5),cyto(8.5),mito(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9H9 Chitin synthase Low 5 1 952-973 DEVPPKKETKEQKQKDIYANFR plas(26) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9J6 Endoplasmic reticulum chaperone BiP Low 5.6 1 1-25 MAYPRATIRPKRSRAAKAQRSILAN E.R.(8),mito(7.5),cyto_mito(6),golg(4),cyto(3.5),nucl(2),extr(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VB61 Uncharacterized protein Low 5 1 80-99 CQRAPEPRERRSRVRRQDTE extr(20),plas(2),vacu(2),mito(1),cyto(1),E.R.(1),cyto_mito(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKN9 Uncharacterized protein Low 5 1 320-341 VYIFWRRLRRRGKNASNNNLTD extr(18),plas(3),E.R.(3),mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VMQ0 Trehalose 6-P phosphatase Low 9.1 1 21-43 PHDLHRWPSRRLKASPRVCKLKL nucl(14.5),cyto_nucl(10),cysk(6),cyto(4.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VMR6 Uncharacterized protein Low 8.7 1 174-194 VSCEAKPRDKEVWRKMQNKRS nucl(13),cyto_nucl(9.5),mito(5),cyto(4),pero(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VP05 Ribosomal protein S12 Low 8.7 1 46-65 QLIRGDRKHKTKQSKAPLLE mito(23),nucl(2),cyto(2),cyto_nucl(2) GAKKPKA (158-164, prob:0.698) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VPR0 Glyco_transf_28 domain-containing protein Low 8 1 332-358 DDDPDPQRRAEKKRERKLDKKTEPASN mito(20.5),cyto_mito(12.5),cyto(3.5) RRAEKKRERKLDKKTEPASNHKARKARAAAK (339-369, prob:0.984) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VS29 Cleavage and polyadenylation specific protein Low 5.7 1 1059-1079 GVSNWRLKYRCKDPTRNPVSA cyto(12.5),cyto_nucl(8),mito(7),nucl(2.5),plas(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VV56 Peptidase A1 domain-containing protein Low 7.7 1 672-691 SDSTLRSSKHRNTLRQKSMV plas(12),nucl(7),mito(3),cyto(2),golg(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W2S6 Uncharacterized protein Low 5 1 1-24 MPRTANKNPKAKPQVGKNKNSAAA mito(22),cyto(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WBK1 Pseudouridylate synthase Low 8 1 71-94 ASAAEKPKFVKKKKEPVQFQWGAQ mito(18.5),cyto_mito(12.5),cyto(5.5) K (82-82, prob:0.606) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLS4 Uncharacterized protein Low 6 1 22-42 YTDYKTKLRCRATCRALRQFT mito(7),cyto(6),extr(6),cyto_nucl(5.5),nucl(3),pero(2),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQ93 Acyl-coenzyme A oxidase Low 5.8 1 80-102 QRSLARGKKLKQLQKQHNWSFED pero(10.5),cyto_pero(9.5),cyto(7.5),mito(5),nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VT29 Uncharacterized protein Low 5 1 80-118 SECRNGKCKCSVRRDQHGKCNVPSKKPHPPRPTNGHGHG extr(15),cyto(3),E.R.(3),pero(2),cyto_mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTQ6 Uncharacterized protein Low 5 1 459-480 ALATIFFRRRRRQRLDREVTAA extr(26) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VYI1 ATP-dependent RNA helicase A Low 8 1 222-250 PEEVRTAPQKEKKTRGKRKHRAATAEQHE mito(13),cyto(12) QKEKKTRGKRKHRA (230-243, prob:0.946) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W2B5 Uncharacterized protein Low 5 1 244-263 YLKTIKSKPRHTNLKVWVTC cyto(16),cysk(8),cyto_mito(8) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W7Q0 Uncharacterized protein Low 8 1 566-590 GEGKTRPPPAERTRRPRRVAQEEDA extr(13),plas(6),mito(3),cyto(3),cyto_mito(3) RGEGKTRPPPAERTRRPRR (565-583, prob:0.808) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V6Z3 Uncharacterized protein Low 9.6 1 115-149 CFAWLFRSRRSRSKKPKKAKKSKKTKSKRSFMSTP cyto(9.5),cyto_nucl(8),plas(7),nucl(5.5),mito(5) RSRRSRSKKPKKAKKSKKTKSKR (121-143, prob:0.999) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGH9 Autophagy-related protein 13 Low 7.5 1 251-270 LPAYRLFRRLRRQNNGLRLG mito(10),nucl(8.5),cyto_nucl(7),cyto(4.5),extr(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VI52 Protein-nucleus import-related protein Low 7.7 1 906-929 FSIACTPHRQARKPQKKDGETGDT nucl(13),mito_nucl(10.833),cyto_nucl(10.333),mito(7.5),cyto(6.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VNH7 Uncharacterized protein Low 9.3 1 210-240 DLDALRPPPKERRKKKPAPPQPPRQSAFRRF cyto(11.5),cyto_nucl(8.5),nucl(4.5),E.R.(3),mito(2),plas(2),extr(2),pero(2) RPPPKERRKKKPAPPQPPR (215-233, prob:0.982) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VSR4 Chitin deacetylase Low 9.5 1 284-304 ADDFRKRVPPPKGARMPKGMK cysk(8),cyto_nucl(6.833),nucl(5.5),cyto(5),cyto_pero(4.499),mito(4),pero(2.5) RKRVPPPKGARMPKGMK (288-304, prob:0.838) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWQ1 Copper transporter Low 5 1 74-95 GLTTAQRQRRHRRTLRATPFQQ plas(15),pero(4),cyto(2),extr(2),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W985 Uncharacterized protein Low 8 1 316-343 SLSPLRRIWPARRLQRRRPGCRRALPPA plas(13),mito(6),E.R.(4),extr(2) ARRLQRRRPG (326-335, prob:0.724) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WTU6 Uncharacterized protein Low 8.8 1 873-900 APTPEAEPVKKKRKSKSKSQPKSSLPQE cyto(11.5),mito(11),cyto_nucl(7.5),nucl(2.5) VKKKRKSKSKSQPK (881-894, prob:0.944) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJ06 Uncharacterized protein Low 5 1 26-45 GTMARKWRANECRSRSKARV extr(12),cyto(7.5),mito(6),cyto_nucl(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJF7 Nuclear mRNA splicing protein Low 9.3 1 247-275 FETHTPRIRLRRAKTPPPKSSPPKDPPAA cyto(16),cyto_nucl(11.5),nucl(5),mito(5) IRLRRAKTPPPKSSPPK (254-270, prob:0.806) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKU0 Uncharacterized protein Low 8.3 1 16-40 IPPQAAESKRDRKRRETVNKIEMLH nucl(10),mito(10),mito_nucl(10) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLG5 Uncharacterized protein Low 8.3 1 50-75 EASGSYTPTKNRRRQRTSTMNTDPPH nucl(12),mito(11),cyto_nucl(9),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VMG9 Uncharacterized protein Low 9.3 1 204-227 ARNTRSWMPRTPRRRSSRESDYSY nucl(16),cyto_nucl(11),mito(6),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQK3 Microtubule motor Low 8.3 1 1277-1299 PLVNSMNGKRPKNKRIDSTSSDI mito(14),nucl(10.5),cyto_nucl(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VR80 DAO domain-containing protein Low 5 1 381-403 EDRLPTHLKNKWRINRPVPEAPS cyto(20.5),cyto_nucl(11.5),mito(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUE8 Uncharacterized protein Low 9.4 1 208-229 FLFFRRRRRRYAPLKPLPREAR cyto(7.5),cyto_nucl(6.5),mito(6),plas(5),nucl(4.5),pero(2) RRRRRRYAPLKP (212-223, prob:0.773) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWC8 Histone deacetylase Low 9.6 1 459-486 ERASREGSKGRRRSRSPRTPAERPDRPE cyto(16),cyto_nucl(12),nucl(6),pero(3) GRRHRQSHRERSERAERASREGSKGRRRSRSPRTPAERPDRPER (444-487, prob:0.995) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W047 Translocation protein SEC62 Low 8 1 210-242 VGFWDEPKKKKLRKVGEKRRKEKREKRAAAAAN plas(20),E.R.(5) PKKKKLRKVGEKRRKEKREKRAA (216-238, prob:0.998) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W183 Amino acid/metabolite permease Low 7 2 597-619, 740-760 GKRLSWYQRRDSRQPVKRRLDAV, LSYPPPPTHRPYPAPPRRPRT plas(23),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WJ73 Uncharacterized protein Low 8 1 354-378 ALAWILLRRRKQKRETRERMPKLEI extr(18),plas(8) RRRKQKRETR (361-370, prob:0.736) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WWU8 Uncharacterized protein Low 8.4 1 29-54 DLLNPLRTARHHPQRQNRKAKWATVP cyto(24),nucl(1),mito(1),E.R.(1),mito_nucl(1) KPKTGGNGGGGGGGKKKNKKNKKKN (439-463, prob:0.996) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V6T2 Uncharacterized protein Low 8 1 26-46 AVKTTKAKRSEPSPKPKPTAP mito(26) GAVKTTKAKRSEPSPKPKPTAPGGERRKDKPK (25-56, prob:0.972) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VA83 Uncharacterized protein Low 5 1 572-595 VERSLERKISSRRKPVPRLSEDEE extr(23),plas(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFV9 J domain-containing protein Low 6.5 1 321-345 AREEAKKFGHQRREQIKRRVRESNV mito(10),nucl(4),cyto(4),plas(4),cyto_nucl(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGK9 Uncharacterized protein Low 5.4 1 26-47 LQIAKRVSRGWRRRANKEELYH cysk(14),cyto(7),pero(3),nucl(1),mito(1),extr(1),mito_nucl(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VM35 ATP-dependent Clp protease ATP-binding subunit Low 8.9 1 146-167 AEPEKPVRGRRRKSTEEDQRSA mito(16),cyto(4.5),cyto_nucl(4),nucl(2.5),pero(2) RR (155-156, prob:0.603) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VP85 Uncharacterized protein Low 7.4 1 246-269 EALIRQHHQRGKKNRENWGKTCPS cyto(13),nucl(6),mito(3),extr(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRC0 Uncharacterized protein Low 8 1 314-339 SPGLSSMPPHRPKRRVHMRLITPDPP plas(13),extr(7),E.R.(4),mito(3) AKTKAKRASIVTVKSMKSGKSRRASILTARSKLSGRSKHSNKAG (248-291, prob:0.859) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRH2 Uncharacterized protein Low 9.9 1 219-243 LRDAHDRRDRLRQCKTPRKPDENAW nucl(17.5),cyto_nucl(11),mito(4),cyto(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VT16 Uncharacterized protein Low 8 1 26-54 KAAKTSSTKEGGKKRTKKRVESYSSYIYK mito(26) PAAASKAPAKAAKTSSTKEGGKKRTKKR (17-44, prob:0.957) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VT19 Pep3_Vps18 domain-containing protein Low 7.8 1 159-179 GNASAQQKKPRPLRLRANVTA nucl(9.5),cyto_nucl(9.5),cyto(8.5),plas(3),mito(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VW30 Nuclear mRNA splicing protein Low 8.8 1 145-167 DDWHPRRCHRPGRRAAHVPRRLP cyto(7.5),extr(7),cyto_nucl(5.5),plas(4),mito(3),nucl(2.5) HRPGRRAAHVPRR (153-165, prob:0.715) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W2G9 MFS domain-containing protein Low 7 2 18-39, 492-511 GGDHTLRRKPWLRKTTPWADIV, MYIYGRRIRRWTKPGREADD plas(23),mito(2),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W3S5 Ndufs7, NADH:ubiquinone oxidoreductase 20 kd subunit Low 5 1 193-214 FGMLQLQRKMRRNRAGVRWYRS mito(23),cyto(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W6I4 Cytoplasm protein Low 9.9 1 61-94 EEEAPVAAKKKQNKKKKNKKKKKGGESAASTPAK mito(10.5),cyto_mito(10),cyto(8.5),nucl(7) AKKKQNKKKKNKKKKKGG (68-85, prob:0.999) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W8D3 OTU domain-containing protein Low 9.2 1 2-28 VDKRKGKASAPVKRKLRRIASPTPSPS mito(22),nucl(3) KRKGKASAPVKRKLRRI (4-20, prob:0.921) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WWU1 Uncharacterized protein Low 5 1 87-109 YGRYAPPTSRWRQRARRSADSSQ cyto(14),mito(6),pero(3),plas(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1UZY4 Hexose transporter Low 5 1 14-33 NTHPCWWKDRCLRRNVVHLL plas(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9F9 Glutamate biosynthesis-related protein Low 8 1 190-211 GERKAVNKAKAIKRARRDRATN cysk(14),cyto(12.5),cyto_nucl(7) KAVNKAKAIKRARRDR (193-208, prob:0.863) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VE17 CBM21 domain-containing protein Low 9.9 1 4-28 TEPAAPPLPKRPSMRRHSRGSANDA nucl(17),cyto_nucl(11),mito(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VF30 RPN13_C domain-containing protein Low 5 1 42-70 NGHGNGKGHGRKCKPKQPKPTQSEQPQVS extr(16),plas(9) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGU6 Elongation factor 3 Low 9.5 1 1007-1046 LGNPITKAKTKKKVTSAEARKKKKERMQRRKRGEEVFSDE cyto(20),nucl(4),mito(2) KAKTKKKVTSAEARKKKKERMQRRKR (1013-1038, prob:0.996) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VPF7 Uncharacterized protein Low 8 1 87-106 ASVFPIRRSRRARREERPDE plas(18),mito(4),cyto(2),extr(2),mito_nucl(2) RRSRRARREER (93-103, prob:0.768) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VPM9 Uncharacterized protein Low 8 1 323-356 GINPPTESGKNRKKKCVRRQKRNGVHGHRRAGPH extr(27) GKNRKKKCVRRQKRNGVHGHRRAGPHGGRSR (331-361, prob:0.971) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUJ4 Mitoc_mL59 domain-containing protein Low 8 1 166-189 IYANRRQLFKGHKRERERAERKAE mito(22),cyto(3) KGHKRERERAER (175-186, prob:0.752) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VVI6 Uncharacterized protein Low 9.8 1 17-38 FSSSSHMRRHVRNHKGERAFTC nucl(17),cyto_nucl(11.5),cyto(4),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VYA9 Uncharacterized protein Low 9.2 1 159-184 AAWLMLKKRPCKRCGEKVRPKDTIFH nucl(16.5),cyto_nucl(14),cyto(8.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VYN7 Exocyst protein Low 9.9 1 51-70 LNKHGRPLLHKGKKNSNGTF nucl(18.5),cyto_nucl(13),cyto(6.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W669 Uncharacterized protein Low 8 1 194-213 ADVDVQTPRRSNRRRTRKDE plas(12),mito(6),cysk(3),cyto_mito(3),mito_nucl(3) RRR (206-208, prob:0.627) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WX56 Uncharacterized protein Low 5 1 84-104 FYKMRWSKTKAGRNKARPLPP cysk(17),pero(6),cyto(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V218 MFS domain-containing protein Low 5 1 113-134 DDKNTIRREKTHKWHQPKALIM plas(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V5G9 Rab GTPase activator Low 7.6 1 700-723 SAESASQLRQRRKNQAARRTVPAE nucl(8.5),cyto_nucl(8.5),mito(8),cyto(7.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VG25 Eukaryotic translation initiation factor 2A Low 8.8 1 209-233 GAAAGGEKKKRQRTKNKKADVDGAT cyto(11.5),mito(11),cyto_nucl(7.5),nucl(2.5) AGGEKKKRQRTKNKK (212-226, prob:0.934) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGU1 Uncharacterized protein Low 7.6 1 52-73 SPASLEKKKKYRFSRPICKTEY cyto(15),cyto_nucl(13.5),nucl(10) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VIG1 Eukaryotic translation initiation factor 3 subunit L Low 7.3 1 565-588 RAAPLPTQRKKQEKKEQQEGKPEQ cyto(10),nucl(7),pero(5),cysk(4),mito_nucl(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQ05 Uncharacterized protein Low 5.4 1 242-268 IQHEHESSRTRHRRNTRLNQEAQSRPT mito(16),extr(8),nucl(1),cyto(1),plas(1),cyto_nucl(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQK9 Uncharacterized protein Low 9 1 193-216 VDLGTPKRTTPKKKKTPPVTLAAN mito(15),nucl(3),cyto(3),cyto_nucl(3),pero(3),cyto_pero(3) KKK (204-206, prob:0.622) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VSZ1 Uncharacterized protein Low 5 1 471-492 GDNCICKCKCDQKGAQPMPRFE extr(16),cyto(4.5),mito(4),cyto_nucl(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VT25 Uncharacterized protein Low 7.7 1 394-413 IEENKAKLPRVNKRTRQILD mito(12),nucl(7),cyto_mito(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTS2 Uncharacterized protein Low 9.1 1 192-220 QYCGYGPEKPPNPRKRRRKPVITPVSQQS plas(15),nucl(3),cyto(3),cyto_nucl(3),E.R.(3) KPPNPRKRRRKP (200-211, prob:0.916) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTU5 Uncharacterized protein Low 7.7 1 249-273 WSAAQARAKRCRHCKHQKHTVSSGG nucl(10),cyto_nucl(10),cyto(8),mito(5),extr(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWE3 Uncharacterized protein Low 6.9 1 7-32 TLKSNQSRTFKPKKVQEGTKQWQLKQ mito(12.5),mito_nucl(11.333),nucl(9),cyto_nucl(7.833),cyto(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VBS3 Pribosyltran_N domain-containing protein Low 9.5 1 455-475 HWKFWRRAAWRGPRRRRYIPE plas(14),nucl(4),extr(3),cyto_nucl(3),cyto(2) KFWRRAAWRGPRRRR (457-471, prob:0.841) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VBZ3 Uncharacterized protein Low 8 1 186-220 HISGRKPSTDTKPKKKARPSAKKRKARAGGANASE mito(18.5),cyto_mito(12.5),cyto(5.5) KPSTDTKPKKKARPSAKKRKARAG (191-214, prob:0.995) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VF60 Uncharacterized protein Low 6.1 1 148-171 WSAHRASKRANEKKWPARGSRFET cyto(11.5),cyto_nucl(8),pero(5),mito(4),nucl(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VG85 Uncharacterized protein Low 9.9 1 42-69 RSPLDIRREKNRIKQRNLRLRRANQMAN nucl(17.5),cyto_nucl(11.5),mito(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGA3 AP complex subunit beta Low 6.5 1 11-32 EARGQRDKAFQRKKTTALKKIV cyto(13.5),cyto_nucl(10),mito(7),nucl(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGK8 Cation_ATPase_N domain-containing protein Low 5 1 82-101 QYGPNRLKPPKKPSLLKITA plas(24),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJ62 ATP-dependent DNA helicase Low 7.7 2 56-77, 1856-1876 PLPVATPRRRKQPSSTPRRETL, TPSPTVPPKRMSKRKSMDPEL mito(9),extr(7),plas(4),cyto(3),nucl(2),cyto_pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJB3 E3 ubiquitin-protein ligase Low 5.7 1 2049-2070 APALRRFRKRWYRQAALVHCRD plas(18),E.R.(3),nucl(2),pero(2),vacu(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQK4 Uncharacterized protein Low 9.6 1 144-170 VKIATYTPPKKPKRFSKKKEPEPSVCR mito(19),nucl(4),pero(2) PKKPKRFSKKK (152-162, prob:0.887) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VR17 Vacuolar ATP synthase subunit d Low 8 1 177-202 EEFFRLKKVQGKKKRDAEKANAERLK mito(20),cyto(5) KKVQGKKKRDA (183-193, prob:0.781) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VXI4 Uncharacterized protein Low 8.5 1 51-71 SSFWSDKKLPRLPKRKWVLGA nucl(9),mito(7),plas(5),cyto_mito(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VXM9 Lipase_3 domain-containing protein Low 5 1 262-287 KPTKQGTTKKPQQSEEDKKKDDKKEA cyto(20),pero(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WCH5 Uncharacterized protein Low 5 1 129-148 DIMRRILPRRARPLPRRLIN plas(11),mito(10.5),cyto_mito(7),cyto(2.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WXI6 Prib protein Low 7.4 1 5-29 SSPAESSRQHNQHRQRIPRPRTACT plas(7),nucl(6),cyto(6),cyto_nucl(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WY46 Uncharacterized protein Low 5 1 230-249 EYKVRGPTRRPSPKREDSVE plas(17),extr(3),E.R.(2),vacu(2),mito(1),cyto(1),pero(1),cyto_mito(1),cyto_pero(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VIS6 Nucleolar complex-associated protein 3 Low 8 1 180-235 LTHMRANKKDLKRKGKFDKRKGKGKDKEEGPKFKSEIRKKWQTKNQRKREKELKEV mito(19),cyto_mito(13.5),cyto(6) ANKKDLKRKGKFDKRKGKGKDKEEGPKFKSEIRKKWQTKNQRKREKE (185-231, prob:0.999) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VK96 Phosphatidylinositol 4-kinase Low 8.9 1 1601-1626 SISGKLKPYIKKTKPEKKAKIDEEMS plas(14),E.R.(5),cyto_nucl(3),nucl(2.5),cyto(2.5),vacu(2) IKKTKPEKKA (1610-1619, prob:0.747) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLC7 tRNA dihydrouridine synthase Low 9.5 1 567-617 CEAHEAKQAERSKRKKEKQERYQERQRQKRQRRRSRSRERERERRRSDAAE cyto(14),mito(6),nucl(4),pero(3) AERSKRKKEKQERYQERQRQKRQRRRSRSRERERERRR (575-612, prob:0.998) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLV0 Protein S-acyltransferase Low 5 1 125-150 GNAFGGRRRVRRCRKCNGPKPPVSYF plas(16),mito(9) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VPK2 Nucleus protein Low 9.4 1 42-72 AEAKRRKVLRACDVCRRKKIRCEGPMNSQSN nucl(12),mito(7),cyto(5),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRP5 Uncharacterized protein Low 9.1 1 699-723 SVSSKDSKDGKVKEKKKGFFKKRFG mito(17.5),cyto_mito(10.333),nucl(4.5),cyto_nucl(3.833),pero(3) KDGKVKEKKKGFFKKRFG (706-723, prob:0.937) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VSE9 Cytoplasm protein Low 8.3 1 1084-1103 GEFCRLPKTPKTPRSRELPM nucl(11.5),cyto_nucl(9.5),mito(7),cyto(6.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VSV4 Signal recognition particle binding protein Low 9.5 1 683-706 ISSQHTHPPKSSRPKPQDSQVSTT extr(8),mito(7),nucl(4),cyto(3),pero(2),E.R.(2) KGRMKGRKGGRGRNTA (187-202, prob:0.922) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VT75 tRNA (guanine-N(7)-)-methyltransferase Low 6.5 1 20-41 GGLLREPQKRFYRQRAHANVFV cyto(16.5),cyto_nucl(11.5),nucl(5.5),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VV49 Uncharacterized protein Low 8.2 1 169-194 MHRQSVEQKKEQRKKSHQNPVPNNSW nucl(10.5),cyto_nucl(7.5),mito(4),plas(4),cyto(3.5),golg(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VXG8 Uncharacterized protein Low 6.1 1 638-660 PELSAEQRKEKKRHLAEDRFGLP mito(17.5),cyto_mito(11),nucl(4),cyto(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VY75 NADH dehydrogenase Low 5 1 55-80 QYSQQPQQQHEQPKHKGRFRRILGNV mito(18),cyto(5),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VZ74 Class II aldolase/adducin domain-containing protein Low 5 1 14-33 DPASRPKVGKFRKPVPPTFD mito(9),cyto(9),cyto_mito(9) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W3K3 Vacuolar membrane protein Low 5 1 63-82 VAWRYWKNGRRRSHEYRPVP plas(22),E.R.(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W730 Dipeptidase Low 5 1 14-35 ILPANTQRPAPRRKRWVITILA plas(15),mito(5),cyto(3),mito_nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WWL6 Multidrug resistance protein 1 Low 8 1 126-152 VATKKPKGLKALFKKKKGEEKDTNDMV plas(23),E.R.(2),golg(2) KKPKGLKALFKKKKG (129-143, prob:0.891) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9Z7 Endopolyphosphatase Low 8.3 1 512-558 DEDGYLKKKKGKKGGKKDDCKKPENEDKPHCVFKRKPRYSSPQSPSR extr(9),E.R.(5),golg(5),vacu(4),cyto_mito(1),cyto_nucl(1),plas(1),cyto(1),mito(1),nucl(1),mito_nucl(1) KKKKGKKGGKKD (518-529, prob:0.974) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VCQ7 Endothelin-converting enzyme 1 Low 5.5 1 863-884 FHKAFQCKKGTRMNPEKQCKLW mito(9),cyto(6.5),cyto_nucl(4.5),plas(3),E.R.(3),vacu(2),nucl(1.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VER1 MHYT domain-containing protein Low 5 1 831-854 NTIPGESKKWKNSRMSKLSRGLHV plas(20),E.R.(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VG74 50S ribosomal protein L22 Low 9.1 1 7-28 FDFALPKSWRRNSQKKEETTPA mito(20.5),cyto_mito(12),nucl(4) AERRKKELNKIKSAGVVREDGKIRR (178-202, prob:0.838) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VH52 Ribosomal protein S2 Low 9.5 1 7-34 GFGRGRGGPRGRRGRRGPKRDEDKEWVP cyto(9),mito(7),plas(6),nucl(4) FGRGRGGPRGRRGRRGPKRD (8-27, prob:0.992) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VPU5 54S ribosomal protein L31, mitochondrial Low 7 2 21-41, 77-97 YRLSSTRKANLRKRLRRVDDV, DPKYRGWRKGIHKVPKWTRIT mito(21.5),mito_nucl(11.5),cyto(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWG5 SH3 domain-containing protein Low 9.2 1 75-95 SFSLRNLRRGRDNPKRNRVVA nucl(11),extr(8),cyto(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VXB9 Uncharacterized protein Low 5 1 3-24 ISKPPSPTRPTRTPSRTQRYLA mito(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VXG4 F-box domain-containing protein Low 5 1 22-42 LSDKVVWKRKPSNGRLPRSLP mito(18),cyto(4),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WED2 Uncharacterized protein Low 9.9 1 1-25 MPKKKHYKRPKRPERSQEPQPEPES mito(15),nucl(6.5),cyto_nucl(6.5),cyto(5.5) KKKHYKRPKRPE (3-14, prob:0.891) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WQB9 C6 transcription factor Low 8.6 1 671-698 SEEFQQQQQQHSRHRRERNNHERDPQGP nucl(11.5),cyto_nucl(8),plas(6),cyto(3.5),mito(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WUJ6 Ribosomal protein S18 Low 9.9 1 160-180 DLERLKKIRSHRGLRHHWGLR cyto(12.5),cyto_pero(9),nucl(7),pero(4.5),mito_nucl(4.5) LKKIRSHRGLRHHWGLRVRGQHTKTTGRRVGARTIATKGKK (164-204, prob:0.839) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHK6 DUF2263 domain-containing protein Low 9.9 1 15-42 NARADRNDHKAKPRNPSPQRPPEKLAKD mito(11),cyto_nucl(7.5),cyto(7),nucl(6) ARADRNDHKAKPRNPSPQRPPEKLAKDSPRRA (16-47, prob:0.905) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHX5 Histidinol-phosphatase Low 9.2 1 307-328 GEKVGKRGRVKAKPLRGWERAE cyto(11),cyto_nucl(8.5),pero(5),nucl(4),mito(4) GKRGRVKAKPLR (311-322, prob:0.793) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJB9 Vps54 domain-containing protein Low 8.2 1 96-115 AHPTKKANPLRASRKPLPPV nucl(11.5),mito_nucl(10.5),mito(8.5),cyto(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKQ1 Oxysterol binding protein Low 6.8 1 1-23 MGLLKQKHNRQQHDHAHHHDHPN cyto(8),cyto_nucl(8),pero(7),nucl(6),mito(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VNA5 Uncharacterized protein Low 6.4 1 105-124 DVHRWKHDSRGSRCRGKRNA mito(12),cyto(8.5),cyto_nucl(7),nucl(4.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VPJ5 Exocyst complex component Sec10 Low 7.8 1 1-25 MDAPETPPRRPGRRQQASPQAKDPV mito(14),nucl(9),cyto_mito(9) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VW77 Uncharacterized protein Low 8.9 1 76-117 MEYQPSQRKRKNKHGFLSRLRTRLGRKTLARRRAKGKRNLSH mito(19.5),mito_nucl(12),nucl(3.5),cyto(3) RKRKNKHGFLSRLRTRLGRKTLARRRAKGKRNL (83-115, prob:0.992) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VX20 Trafficking protein particle complex subunit Low 9.8 1 11-30 FDDRRAQRHQHPPREQSHVM nucl(12),cyto(6),mito(4),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VY33 Chitin synthase Low 5 1 1780-1805 DEKSDAGYSRRTRRTRNTASNLAPSI plas(21),pero(2),vacu(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V577 Uncharacterized protein Low 5 1 319-338 LVLWCFLKRRKQPKDTHAVS extr(21),mito(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VIQ7 Uncharacterized protein Low 8 1 714-737 GRAGHMPTKPRHRPYARRMRRAAA extr(13),mito(6),plas(4),E.R.(2) AGHMPTKPRHRPYARRMRR (716-734, prob:0.8) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRT1 Uncharacterized protein Low 8.8 1 333-352 RGYYNNPRTRTRRNEPQEAG plas(20),nucl(2),mito(2),mito_nucl(2) RRTRRRGP (314-321, prob:0.702) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VVJ5 26S proteasome regulatory subunit RPN1 Low 6 1 21-44 EEDLTPKHDKGKQRQDDKEEPEIS plas(15),cyto_nucl(3.5),nucl(3),golg(3),cyto(2),mito(1),pero(1),E.R.(1),cysk(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWU5 MFS domain-containing protein Low 8 1 550-569 GSPVSSRKPRRPPNPWILYR plas(24),E.R.(3) KRVAKKLPGGSPVSSRKPRRP (541-561, prob:0.818) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W0Z2 Histone acetyltransferase Low 7.3 1 3370-3396 LFRIMNCVLRKRKESRRRNLQFHLPTA mito(8),cyto(8),cyto_mito(8),nucl(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W9R0 Uncharacterized protein Low 9.7 1 112-135 SDECAPGRRERRKRWERAVPTPRQ cyto(9.5),mito(9),cyto_nucl(8),nucl(5.5) RRERRKR (119-125, prob:0.735) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V371 AB hydrolase-1 domain-containing protein Low 5 1 433-452 GDKRSQQMVHRPPRARNERW mito(18),cyto(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V966 Uncharacterized protein Low 5.8 1 27-49 ACRNVDSRWRKRADQRLQQHMML cyto(8.5),mito(6),cyto_nucl(6),cysk(4),pero(3),nucl(2.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGB7 Uncharacterized protein Low 7.2 1 5-31 ASGQRQEAVKRRTWRRVCKQINLTFLH mito(14),cyto(7),nucl(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKW0 Ipi1_N domain-containing protein Low 9.7 1 1-22 MPKATKKKKEKVEDFKLKLGKG plas(8),mito(6),nucl(5),cyto(5),cyto_nucl(5) ATKKKKEKVEDFKLKLGKGKK (4-24, prob:0.886) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTG9 Uncharacterized protein Low 7.7 1 291-313 STVADRRIQRDRRIIRNVRKALQ nucl(9.5),cyto_nucl(9),mito(8),cyto(5.5),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWI2 Uncharacterized protein Low 7 2 379-400, 948-970 ALLFVHRRHRKKQTEHNHDAQP, AFLFNRCRRRLTRRPQSPFEVDP plas(16),extr(7),mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWP4 Drug transporter Low 8 1 259-281 SGLILRRRARKLRKERGMRDGAR plas(23),mito(2),E.R.(2) RRRARKLRKERGM (264-276, prob:0.921) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VY65 Uncharacterized protein Low 7.7 1 257-278 SPPARPPRSPNRPQGLRRQPTE mito(10.5),nucl(9),cyto_mito(8.5),cyto(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W7S3 Nuclear envelope-endoplasmic reticulum network protein Low 9.6 1 64-92 NATVRRRFPTTSRRRRRRHPTSSSIKVPP mito(9),nucl(4.5),cyto_nucl(4.5),plas(4),cyto(3.5),extr(3) TTSRRRRRRH (73-82, prob:0.852) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W833 Uncharacterized protein Low 7.6 1 1-20 MFKRFRKFVKRVFNRLEERP mito(17),nucl(8),cyto_nucl(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WDA7 Golgi apparatus membrane protein TVP38 Low 8.8 1 214-234 SWAKPNPRRGHARRDSRRSLS plas(19),E.R.(4),nucl(2) RRGH (221-224, prob:0.613) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WQ66 Uncharacterized protein Low 9.4 1 143-162 EWGGWRVRRRRSSPEPAQDL nucl(12),mito(11),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WSN2 Uncharacterized protein Low 6.5 1 139-160 AASRQHRRRLCRRHYPHSQLTS mito(9),cyto(5.5),cyto_nucl(5.5),nucl(4.5),plas(3),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V1F4 Sodium/hydrogen exchanger Low 8 1 527-551 FSNSVTARRHHAKKARKGRASSGAY plas(18),E.R.(5),mito(3) RRHHAKKARKGR (534-545, prob:0.876) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V1I8 Nod factor export ATP-binding protein I Low 5.4 1 1151-1172 NKESGDERPRPRKWYKCGLRGR plas(21),E.R.(3),nucl(1),mito(1),pero(1),mito_nucl(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VG76 Uncharacterized protein Low 7.4 1 203-226 LTDAQKEEYKKKNREMREKYDAWK mito(15.5),cyto_mito(9.5),nucl(8) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJ13 Nucleus protein Low 8.2 1 12-36 PGPSEPLKRRRITRACDRCHRGGVK nucl(11.5),mito(10),cyto_nucl(9.5),cyto(4.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKI3 Cap3p Low 7.2 1 151-170 RDARRKWDTKLAKQSRTLRE mito(10),nucl(6),cyto_mito(6),plas(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLN0 BRCT domain-containing protein Low 8.9 1 49-68 RTWDHLRVTRPPPNNRRTSD nucl(15),cyto_nucl(12.5),cyto(8),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VNC6 Nuclear localization sequence binding protein Low 8 1 905-928 VNLLRAARRARERARQSRKSLGGV cysk(16),cyto(9.5),cyto_nucl(6) ARRARERARQSRK (911-923, prob:0.746) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WM36 Uncharacterized protein Low 6.2 1 423-442 SSSTRHPKPKSKNGLDSRCH plas(17),nucl(3),mito(2),cyto_nucl(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WTX0 Uncharacterized protein Low 6.7 1 428-453 LVLFFWCYRRRRKRMVQQSVRSRSPV plas(12),nucl(5.5),cyto_nucl(5.5),cyto(4.5),mito(1),extr(1),E.R.(1),golg(1),vacu(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V2B1 DEAD/DEAH box helicase involved in nucleotide-excision repair Low 9.3 1 365-385 SDDGLRKKLKRKKKVMAALYD mito(10),cyto(8.5),cyto_nucl(7),nucl(4.5),plas(1),pero(1),E.R.(1),vacu(1) RKKLKRKKK (370-378, prob:0.919) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V527 DNA repair-related protein Low 9.6 1 191-213 EDQWGTLNNRRKRRERDDEDEIE nucl(17.5),cyto_nucl(13),cyto(7.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V5K4 Uncharacterized protein Low 5.5 1 73-93 GRWACAARIKRVYRNRDKFDE cyto(12.5),mito(9),cyto_nucl(7.5),pero(2),nucl(1.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VAG7 TFIID_20kDa domain-containing protein Low 8.6 1 41-61 AETQSKRRNAAQQQQQQNQSG nucl(15),cyto_nucl(12.833),cyto(6.5),cyto_mito(5.332),mito(2.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VBG4 Malate permease Low 5.7 1 2-21 RLRPRPCIVSHRANRREKGE mito(14),plas(6),nucl(2),E.R.(2),cyto(1),extr(1),pero(1),cyto_pero(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFH5 Uncharacterized protein Low 8 1 103-122 EEDRRRMRRQSRHTNDPSRE mito(25.5),cyto_mito(14) GRGRRARETHRKAAHGEEDRRRMRRQ (87-112, prob:0.897) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHH5 Aldedh domain-containing protein Low 8 1 30-58 ITTSNDQEQPPRRGRRPRRGQDDHPHWSL extr(22),vacu(2),mito(1),cyto(1),plas(1),cyto_mito(1) RRGRRPRR (41-48, prob:0.745) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJQ8 Uncharacterized protein Low 8.7 1 9-33 SASAKGSFVRRNQRRIERQEKIGDD nucl(11.5),mito(8),cyto_nucl(7.5),cyto(2.5),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VR98 Aa_trans domain-containing protein Low 5 1 418-438 AYYRMNKKRLFKGPLKCFTTF plas(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VT36 Abhydrolase_3 domain-containing protein Low 5 1 119-138 LSNPPPKPAKKDDRVRAPGI mito(20),cyto(6.5),cyto_nucl(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUB9 Uncharacterized protein Low 9.5 1 17-39 ASSVTLCSPPRRRRKAMGPGTIR mito(13),cyto(10),nucl(4) R (29-29, prob:0.603) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VZY3 Peptidase A1 domain-containing protein Low 8.4 1 105-132 LQRRELWEWNERRRRRRRNNDEKEAEVG extr(16),cyto(4),vacu(1),golg(1),E.R.(1),pero(1),plas(1),mito(1),nucl(1),mito_nucl(1) RRRRRRR (116-122, prob:0.817) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W551 Cytosine-specific methyltransferase Low 7 2 91-111, 472-493 GCDSCHHRDLRRRQRQLIFLD, GPPRSRYAERLQRPDRRAREHL mito(22),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W9W5 Siderophore iron transporter, putative Low 5 1 344-364 SDKLKKRWREWAKQETLRRLT plas(23),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WF72 Uncharacterized protein Low 9.2 1 616-639 LEDVPEPKTQRRRPKTVHVQVAQP mito(15.5),cyto_mito(10.5),cyto(4.5),nucl(4) RKQRALERRRSKA (320-332, prob:0.766) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WQS7 Uncharacterized protein Low 8 1 461-484 APRTRSAPRGPRRPWSPRSRTGGA mito(14),extr(9),cyto(3) RPAPRTRSAPRGPRRPWSPRSRTGGARR (459-486, prob:0.955) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V4H0 Pantothenate kinase Low 8.7 1 131-155 RTSPPLKLLNKRKLRGRRRGSYADP cyto(16.5),cyto_nucl(10),cysk(4),nucl(2.5),mito(2) LNKRKLRGRRR (139-149, prob:0.863) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V5J7 Uncharacterized protein Low 7.9 1 17-39 RDRERGRDRDRDRDREHFRRTSP cyto_nucl(11),nucl(10.5),cyto(8.5),mito(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGM3 Alpha-aminoadipate reductase Low 7.4 1 37-64 SSPRVPRPAFRVKRVNERQERRESPTSE nucl(7.5),cyto_nucl(7),plas(6),cyto(5.5),mito(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKH4 Uncharacterized protein Low 8 1 542-566 SDEDEKPPKKSKPASKGKAPSSKAA cyto(10),mito(8),cyto_nucl(8) KPPKKSKPASKGKAPS (547-562, prob:0.922) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VNF0 Uncharacterized protein Low 7.9 1 285-305 DRIRLPPTRTRRRTVRAPARI cyto_nucl(13.333),nucl(13),cyto(11.5),cyto_mito(7.666) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQ46 AhpC-TSA domain-containing protein Low 9.2 1 35-54 ASTKKASKDSKEKEESKRSA mito(22),nucl(3.5),cyto_nucl(3) AGPKAASTKAANGKSASTKKASKDSKEKEESKRSARSSSSKAANGDAAEGAKEEKKKAATNSKGPL (20-85, prob:0.948) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VW12 Retrotransposable element Tf2 protein type 1-like protein Low 7.6 1 402-421 QDIHKRYYDRRRTSPPQFKE mito(13),nucl(7),cyto(4),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWH9 Uncharacterized protein Low 9.3 1 322-358 DTDAAESKSKKKSKKDKKKNKKAKKGVKEVKQEPDTV cyto(11.5),cyto_nucl(8.5),mito(7),nucl(4.5),pero(2) SKSKKKSKKDKKKNKKAKKGVK (328-349, prob:0.999) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWI6 Uncharacterized protein Low 9.5 1 48-67 QSNNTQQRAQRRRSRSLWGT nucl(17.5),cyto_nucl(11.5),mito(5),cyto(4.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VXL5 Vesicular-fusion protein SEC18 Low 6.4 1 67-93 RPTPPAPAPQSHRKPPPRQYNDYQDYP mito(12),cyto(8.5),cyto_nucl(7),nucl(4.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WRF0 Uncharacterized protein Low 8.4 1 424-447 TDPEYKYHSKQPLPRFNRHPSYEP nucl(13),cyto_nucl(12),cyto(9),mito(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WVT7 Acid phosphatase Low 8 1 96-119 SDNGNGKKKGKGKKDKAGHLKASG extr(23),mito(2) SRGGKGKNSDNGNGKKKGKGKKDKAGH (88-114, prob:0.99) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V6K5 Uncharacterized protein Low 6 1 90-110 ITSRFGPRKNERTKLPNRPLS cyto(8),mito(7),cyto_nucl(6.5),plas(4),nucl(3),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VDK0 Uncharacterized protein Low 7.4 1 42-63 SDCEEGKRRRRCSKSGSWKADD nucl(8.5),cyto_nucl(8),pero(7),cyto(6.5),mito(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VF19 Uncharacterized protein Low 5.4 1 338-360 IDSLLRRERKARKMPFKSSNQIE plas(22),E.R.(2),nucl(1),golg(1),vacu(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGS2 Uncharacterized protein Low 5 1 1003-1022 TSDVRRRDVRRPTPSIRAPE plas(21),mito(2),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGZ2 APC amino acid permease Low 5 1 520-543 ELNAMRAARRHKPWHARIYQTLFA plas(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VMR3 Ubiquitin conjugating enzyme Low 8.4 1 141-163 REDYPAYKKRVKRLARRSAEEAY nucl(11.5),mito(11),cyto_nucl(8),cyto(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUZ1 GTP--RNA guanylyltransferase Low 9.5 1 325-345 QQDKVKAAWKQREQRNRAAAA cysk(11),cyto_nucl(5),pero(5),nucl(4.5),cyto(4.5) AAAPPRPPNGYQKPPPPSAHGGHGGHGGGAPRPA (346-379, prob:0.661) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VVN3 Uncharacterized protein Low 9.2 1 266-292 GRGRRRVETFDRGRRRRARDGARPALG cyto(10),extr(8),mito(5),nucl(3) GRRGRGLRHLERGLGGQRGGRLRVSRRQGGRGRRRVETFDRGRRRRARDGAR (237-288, prob:0.993) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W541 Translation initiation factor Low 8 1 327-349 THVSKKFVPKDVSKKVRKNADAF cyto(25) KDGKKGGKK (130-138, prob:0.706) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WEA5 Uncharacterized protein Low 7.2 1 4-25 LSFTRKRKTSEHPGQSPPKRSF mito(13),nucl(7.5),cyto_nucl(7.5),cyto(6.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WWS5 DH domain-containing protein Low 9.7 2 1066-1088, 1152-1176 RAKSVPSSPKTPRRKPLEEVEHE, LPSTDAPRPMSRRRRSIRFLGLKGF mito(14),nucl(8.5),cyto_nucl(6),cyto(2.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V8S1 SEC63 domain-containing protein Low 8.5 1 226-249 VPILGKKSKGGKKARKERQAKIEE cyto(7.5),plas(5),cyto_nucl(5),pero(4),extr(3),mito(2),vacu(2),nucl(1.5) GKKSKGGKKARKERQAK (230-246, prob:0.973) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VA32 Glycogen [starch] synthase Low 5.8 1 533-559 TNQLCSFTMKSRRQRINQRNRTERLSE cyto(13),cyto_nucl(8.833),cyto_pero(8.833),cysk(4),nucl(3.5),pero(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGX5 Uncharacterized protein Low 9.9 1 611-635 GPRPTTPPARPTKRARPAPKGVWAV mito(10),cyto(7),nucl(5),extr(4) ARPTKRARPA (619-628, prob:0.724) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHE4 RRF domain-containing protein Low 8 1 49-69 ITLKKATKKDAKKAGDNKKGG mito(25.5),cyto_mito(14) KKATKKDAKKAGDNKKGGKKK (52-72, prob:0.973) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VSZ6 Poly [ADP-ribose] polymerase Low 8 1 31-55 TSAPTPSPPPQVKKNPFPLRGCRIA mito(19.5),cyto_mito(13.333),mito_nucl(11.666),cyto(5) KRAASPALPAPPAKKRSKK (166-184, prob:0.84) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VT38 PHB domain-containing protein Low 9 1 627-657 YEILTRTSASKKKKNKKKNKKKNAANGAAAA cyto(16.5),cyto_nucl(10.5),mito(6),nucl(3.5) SKKKKNKKKNKKKNA (636-650, prob:0.996) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VX23 AB hydrolase-1 domain-containing protein Low 9 1 8-31 HLPSAPKPRVPPRKPHLSKFHLDS mito(20),nucl(3),cyto(3),cyto_nucl(3) KPRVPPRK (14-21, prob:0.634) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VYL0 Uncharacterized protein Low 9.4 2 1-25, 43-62 MPRYNKKQKDRSAQRRQDPDYKPPI, GWQQRFLHSHREKRHIRQLV mito(9),cyto_nucl(9),nucl(8.5),cyto(8.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W7Q7 Aspartyl protease Low 9.5 1 519-545 ASGPSWKTDIRPRPRRKVPTPSDDSED extr(15),cyto(5),nucl(4),mito(2) KRTRSGQQASAKADKGGGSGSSTRKSARRAKKA (450-482, prob:0.891) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WPN8 Arylsulfatase Low 8 1 23-43 GKGNAKPGKPGKNGKGKPNIV extr(23),mito(2) KGNAKPGKPGKNGKGK (24-39, prob:0.859) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WTN8 Uncharacterized protein Low 6.2 1 25-47 GVWARRLAKTPLRRNPRHNLSTS mito(17),cyto(4),nucl(3),extr(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WXB7 ATP-dependent DNA helicase CHL1 Low 9.9 1 644-668 TSRHQLRRSTWPVRRHGRPAVPERL cyto(15),cyto_nucl(13.166),nucl(10),cyto_mito(8.666),mito_nucl(6.166) ERERRAR (150-156, prob:0.657) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFS5 Pyr_redox_2 domain-containing protein Low 8 1 433-453 VDVAGIERRRRRRRGFLGLAA cyto(12),mito(9),extr(4) RRRRRRR (440-446, prob:0.804) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VL62 Uncharacterized protein Low 6.6 1 169-188 RHAPPKPNPRSQLRNKWMRY plas(7),mito(6),nucl(4),cyto(4),cyto_nucl(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VP74 Serine/threonine-protein phosphatase Low 6.1 1 98-119 PDKWIERLRKCRHLPERQMKAL mito(19),nucl(3),cyto(2),pero(2),cyto_pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W9T5 Co-chaperone Low 8.4 1 420-444 ADERTIKKAFRKKAKENHPDKNGGS extr(11),cyto(9),mito(4),nucl(1),plas(1),pero(1) KKAFRKKAK (426-434, prob:0.77) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WDQ2 Phospho-2-dehydro-3-deoxyheptonate aldolase Low 6.9 1 472-491 ADYLKARRRGEKPRDLFNNQ cyto(10.5),cyto_nucl(10),nucl(6.5),mito(4),pero(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V789 Proteinase inhibitor I4 serpin Low 5 1 1-22 MTLTSRPTKRLRSSTRLSKAHT mito(12),plas(7),cyto_mito(7),mito_nucl(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VAV3 Uncharacterized protein Low 8.8 1 58-80 VWVGCCWNRRRMQKRERRLDAEM mito(16),cyto(4),nucl(2),pero(2),E.R.(2) RRERRLVPGGPRRLPR (274-289, prob:0.752) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VE40 Fungal_trans domain-containing protein Low 8.5 1 122-144 AQTLTTCRKGKRRCEPSPLVPPD nucl(12.5),cyto_nucl(9),plas(6),cyto(4.5),E.R.(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VF06 Uncharacterized protein Low 9.8 1 440-460 STTPRRLSKLSKSPHQHRSVA cyto(12.5),cyto_nucl(10),mito(8),nucl(6.5) VKRGRSRSRHGSRAASASGSRAPSRVHSRAPSRA (216-249, prob:0.902) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJH7 Calcium-transporting ATPase Low 7 2 1-21, 57-77 MDPSRRSGPVKRRSPPPSSRG, STTLRRQSSPHRSRRSLSRSR plas(16),mito(7),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKU3 NADPH--cytochrome P450 reductase Low 8 1 146-166 DAEICRRRARRDARRPGRAWE extr(10),cyto(6.5),cyto_nucl(4.5),E.R.(4),mito(2),pero(2) RRARRDARRPG (152-162, prob:0.737) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLR3 Uncharacterized protein Low 5 1 383-403 KPEPTVKRPSWPRPWRIADEP extr(10),cyto(8),mito(6),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VML0 Ribosomal L10 protein Low 8.3 1 1-31 MGRRPARCYRYCKNKPFPKSRYNRGVPDPKI nucl(9),cyto(9),cyto_nucl(9) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VP76 Uncharacterized protein Low 8.6 1 1-22 MWPFRKPKPDWKACPDWRDRYD nucl(13),cyto_nucl(11.5),cyto(8),mito(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VVA4 Vacuole transport-related protein Low 6.7 1 509-529 QSTPQAQQQQQQQPKKNDAFA mito(11.5),cyto_mito(8.833),nucl(6.5),cyto_nucl(6.333),cyto(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VVU4 Beta-1,3-1,4-glucanase Low 8.9 1 650-673 AETAEPVKRAQRHRRSWASGSRRH extr(20),cyto_nucl(3),nucl(2.5),cyto(2.5) RHRRS (661-665, prob:0.638) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VXX9 Uncharacterized protein Low 9.1 1 67-87 IPALRRIKPAAWRKNPRLELT nucl(16),cyto_nucl(14.5),cyto(9) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VXZ0 Uncharacterized protein Low 5 1 330-351 RELFIRRSKKSREQRNGPNADG cyto(11),cysk(7),cyto_pero(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W126 Uncharacterized protein Low 6.7 1 304-326 SVSGNRPHKPRDPSKPKTANESD cyto(10),cyto_nucl(9.333),cyto_pero(7.833),nucl(7.5),pero(4.5),mito(2),vacu(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W1A4 Uncharacterized protein Low 9.8 1 304-327 GLVTKRLKKLSLKKKNTTNYTKAS nucl(19.5),cyto_nucl(14),cyto(7.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WAV3 Uncharacterized protein Low 7.9 1 252-273 LLYAWLHARRRRRNEPTNVLDL nucl(8),mito(5),plas(4),cyto_mito(4),cyto(3),extr(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V467 Uncharacterized protein Low 7.9 1 1-21 MLVTHHQRRKPCPDNDGRGMG nucl(10),cyto(8.5),cyto_mito(8.5),mito(7.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V4M8 Phosphoinositide phospholipase C Low 9.1 1 456-477 TDTGKPEKRKTGKYNDHDHLKF nucl(14.5),cyto_nucl(10.5),cyto(5.5),pero(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V6V8 1,3-beta-glucan synthase Low 5 1 1721-1747 QQIRPPIYSLRVRKQRRKIVFKYSIVY plas(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VB21 VWFA domain-containing protein Low 5 1 4-28 VAVIVIKKMKKNKPQAIQNTPNPLV extr(14),mito(7),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VMK3 RNA helicase like protein Low 5 1 52-75 GAAPSRTGRKPWNNEKNQRGKGFA mito(22.5),cyto_mito(13.5),cyto(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VN25 Chitin synthase Low 8.8 1 912-941 WEDWERSRLRKLRREEKRRKQMERAHGQGF plas(24),nucl(2) RSRLRKLRREEKRRKQ (917-932, prob:0.936) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRB2 5-aminolevulinate synthase, mitochondrial Low 8 1 28-48 VYSSRRRHGGHGLRRLRKVRW cyto(21.5),cyto_nucl(12),mito(3) RRRHGGHGLRRLRKVR (32-47, prob:0.782) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWM7 Uncharacterized protein Low 7.9 1 15-43 AQASTATHRRTRPRTRRPTPPHWPRTFPC mito(10),nucl(9.5),cyto_nucl(8),cyto(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWT5 Uncharacterized protein Low 5 1 350-372 CLLVWCCLRRRKKQATNNNPVDM extr(19),cyto(2),pero(2),cyto_pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W525 DNA ligase Low 8.8 1 1-27 MPKRTAPEPSKPSKKAKGKGKAVQASL mito(21.5),cyto_mito(12.5),nucl(3) PEPSKPSKKAKGKGK (7-21, prob:0.927) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W668 Uncharacterized protein Low 5.7 1 71-99 QYYLPFPAPRPRPRPRRTCPRLWRDDEPY cyto(13.5),cyto_nucl(8.5),mito(5),nucl(2.5),extr(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WSB7 Threonyl-tRNA synthetase Low 9.2 1 20-50 VAAPADQVKQQNKKEKKEKKEKKGGISELSP cyto(16),pero(6),nucl(3) NKKEKKEKKEKKG (31-43, prob:0.949) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WTQ1 Uncharacterized protein Low 8 1 284-303 PTRMHRRPTAARPKPPKTAP mito(11),extr(9),cyto(5) RPKP (295-298, prob:0.621) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9M4 Uncharacterized protein Low 9.1 1 698-736 ESANRSGRPWDKQSNRRQDSEFPKRRTGDFQNRRRDDDR mito(20.5),cyto_mito(11.5),nucl(4) RDDRRPGGRRGSIR (102-115, prob:0.759) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRC4 Autophagy-related protein 1 Low 8.1 1 5-26 GSNARKDKGGGHRHQEHRERVG nucl(12),cyto_nucl(12),cyto(10),mito(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VSP9 Endopeptidase Low 8.2 1 804-823 QTFHRREKDCRPIPQAQFDH nucl(11),extr(9),cyto_nucl(9),cyto(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VW26 Fe2OG dioxygenase domain-containing protein Low 7 1 3-22 YYYGRPKKAKADPPVFKPEL cyto(12),cyto_nucl(10.5),nucl(7),pero(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWX0 Nuclear pore complex protein Nup85 Low 5.4 1 69-88 AAFSRKDKAKWKASGRTLFA mito(17),cyto(7),nucl(1),extr(1),pero(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VX88 Palmitoyltransferase Low 5 1 145-166 PEWCGRCSRTRPARTRHCRECG plas(17),extr(6),mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W3C2 Sphingolipid 4-desaturase Low 5 1 13-35 ATALPSPSKLKQRPRHSSPSDES plas(16),mito(4),E.R.(3),vacu(2),mito_nucl(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WB26 Pyruvate transporter Low 5.4 1 622-645 VLRTRIQMQKKPRQLPKPPVQPHI plas(23),nucl(1),mito(1),golg(1),vacu(1),mito_nucl(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V3K4 Uncharacterized protein Low 9.9 1 157-178 PSPGTLQAQNKSRKNKHRKSRK mito(15.5),cyto_mito(10),nucl(7),cyto(3.5) KSRKNKHRKSRK (167-178, prob:0.965) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V8R2 Uncharacterized protein Low 5.6 1 60-80 ALHEREAQRPRPKQNVRSPEE extr(10),mito(6),plas(3),nucl(2),cyto(2),cyto_nucl(2),pero(2),E.R.(2),cyto_pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VBY0 Cytoplasm protein Low 8 1 65-85 MACSACRSHIQSKKHREREAA plas(22),E.R.(3) PKARRR (405-410, prob:0.684) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHU2 Integral subunit of the pre-mRNA cleavage and polyadenylation factor (CPF) complex, Pfs2p Low 8.8 1 99-118 GDARANRKYKPRRTVDYMGG nucl(13.5),cyto_nucl(10),cyto(5.5),pero(4),mito(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJX5 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase bifunctional enzyme Low 6.7 1 560-581 VDTHRPKPAKFRKPESERVDHT cyto(16.5),cyto_nucl(13),nucl(6.5),mito(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLZ6 Phosphoprotein phosphatase Low 8.7 1 566-586 ISPRAKVSSRRSNPTPRSWTT nucl(13.5),cyto_nucl(9.5),mito(9),cyto(4.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUG7 Uncharacterized protein Low 9.5 1 50-89 LGPTGWLRHRSRPRPRGDVPVKPSRRQRQRQRLETKADES mito(14),cyto(5.5),cyto_nucl(5.5),nucl(4.5) RHRSRPRPRGDVPVKPSRRQRQR (57-79, prob:0.854) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W097 alpha-1,2-Mannosidase Low 7.7 1 16-41 ASKNDQPVKSQAKKHFIKKAPEPAKS nucl(9.5),cyto_nucl(9),cyto(7.5),pero(5),mito(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W9M9 RNA-dependent RNA polymerase Low 9.5 1 38-60 GSNGAPRSNKVRRGGRPPFPPGP cyto(8.5),cyto_nucl(7),mito(6),pero(5),nucl(4.5) KVRRGGRP (47-54, prob:0.668) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WAL9 Uncharacterized protein Low 5 1 56-79 AFPYEKCTWKKKNFDVQRPPETRP cyto(9.5),mito(8),pero(7),cyto_nucl(6.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WXE8 Histidine-tRNA ligase Low 8 1 45-64 DKKADAKKDKKAKKGGNANV cyto(22),cyto_nucl(12.5),pero(3) KKADAKKDKKAKKG (46-59, prob:0.915) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V3C8 MFS domain-containing protein Low 8 1 39-64 SDKEKPLDGKGKKEKKKERGLTAGDS plas(26) PLDGKGKKEKKKER (44-57, prob:0.935) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VAS4 Uncharacterized protein Low 8.1 2 23-46, 178-201 LAFVWWYRRRYRLHRPLPIHPDEV, LAFVWWYRRRYRLHRPLPIHPDEV extr(14),nucl(4),mito(4),cyto(4),cyto_nucl(4),cyto_mito(4),mito_nucl(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VCU0 Required for respiratory growth protein 9, mitochondrial Low 9.8 2 66-93, 151-170 YSDYSRRSYRDDRPRRPREERQGRWDND, EPSSSTPKRRWNPTKKLTHA mito(15),nucl(7),cyto(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VPS9 ATP dependent RNA helicase Low 8 1 221-241 IKEAGKKKKQMIEASKRRKEA cyto(26) KASKNLKRKLAKAPVKRKAVGGGGRDLIKEAGKKKKQMIEASKRRKEAAAKGKGEKEGKGGKKAE (194-258, prob:0.998) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W884 Uncharacterized protein Low 6.7 1 267-286 NDNFGKRCRKQPCEEYKRGE cyto(12),cyto_nucl(10),cysk(7),nucl(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VE09 Uncharacterized protein Low 5 1 41-62 AAQVCRAWRKKANRVLQRHVVA mito(10),extr(9),cyto(5),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VEE4 Uncharacterized protein Low 5 1 493-513 ASRPLFPKDSKRNQVERKTIV mito(23),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VMC2 Uncharacterized protein Low 5.3 1 61-84 NMLSPTTKVNKRWHRPVRCDWLDD plas(13),mito(6),E.R.(3),vacu(2),nucl(1),cyto(1),cyto_nucl(1),pero(1),cyto_pero(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VNH4 Uncharacterized protein Low 8.7 1 8-29 AIERLCPTRPRRRSARLVNLAS nucl(12.5),mito(8),cyto_nucl(8),pero(3),cyto(2.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VP91 OPT oligopeptide transporter Low 5 1 845-867 DKGCAAPNKCKRFQIPKDPGYFG plas(24),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTK5 Two-component-like hybrid sensor histidine kinase 2 Low 9.5 1 225-252 SEKSQTQSEKKPAQRPYPRPHQQNEYFD cysk(11),cyto(8.5),cyto_nucl(7),nucl(4.5) AERKGKGKSGKTAEKAEKAEDKEK (1895-1918, prob:0.92) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WBL6 Uncharacterized protein Low 8.9 1 1-22 MGKAQVKKKTDASRRHNPIRVP mito(13),cyto(4.5),cyto_nucl(4),pero(4),nucl(2.5) K (255-255, prob:0.6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1UZZ3 Uncharacterized protein Low 7.3 1 16-42 LGTLCPDRVRGRQRSRTKSKPGLSCDL cyto_nucl(10.5),cyto(9.5),nucl(8.5),mito(4),pero(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VDF3 Glutaredoxin domain-containing protein Low 6.7 1 35-54 TDEEAKKRWQRAKPLGQVIG cyto(12),cyto_nucl(10.833),mito_nucl(7.666),nucl(7.5),mito(6.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGW7 Putative WD repeat protein Low 7.4 1 1-20 MATQLPPPKRQKSNYAKSLL mito(14),nucl(6),cyto(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VNK3 Aquaporin transporter, putative Low 9.8 2 106-125, 448-468 PEKPDPRPTNRPPSQRPPSP, MPPATPSLVKKHRKDTKDRNA mito(11),nucl(7),cyto(4),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VP72 Cytoplasm protein Low 8.5 1 59-80 KTAPVAQKGRAKKKTKSGSATP cyto(10.5),mito(8),cyto_nucl(6.5),pero(3),extr(2),nucl(1.5) QKGRAKKKTK (65-74, prob:0.825) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRD2 Uncharacterized protein Low 8.7 1 122-145 QVTSRHFKKIKRRLKTQYRRMEEN mito(21),nucl(2),cyto(2),cyto_nucl(2) KIKRR (130-134, prob:0.632) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTN4 Cop9 signalosome complex subunit 1 Low 6.9 1 494-519 PPQAKESRKEWWREHRGDRSDRDRSS cyto(10.5),cyto_nucl(9),nucl(6.5),pero(4),cysk(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WK23 Uncharacterized protein Low 6 1 36-60 RSPLLGDRPRAPRRRWRPFVGWLVL plas(11),cyto(5),mito(4),cyto_nucl(4),nucl(3),cyto_pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WPL5 Uncharacterized protein Low 8 1 128-155 FPNAATEKRPWWKRKKAKGLRGRGQMNA mito(10.5),cyto_mito(8.833),cyto(6),cyto_nucl(4.333),plas(4),E.R.(3) KRPWWKRKKAKGLRGR (135-150, prob:0.953) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VAC9 Uncharacterized protein Low 8.6 2 11-31, 373-397 GYNVGRPCRPRPREPAFQHHA, AANANTQKGKTKKKNDKVPGTVSAW mito(16),cyto_nucl(5.5),nucl(5),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VEK1 SAP domain-containing protein Low 8.8 1 312-337 GYLDNKWSQKRKAEHKADADKKKEKN mito(16),cyto(6.5),cyto_nucl(5),nucl(2.5) KRKAEHKADADKKKEKN (321-337, prob:0.825) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VL85 Uncharacterized protein Low 5 1 674-693 RVSRRYQQFHHQRRTARLIL mito(14),extr(8),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLG8 Uncharacterized protein Low 8.4 1 393-417 PLLVYFIRRHRKRQRQRRLASHYSF extr(17),mito(5),pero(2),nucl(1),cyto(1),plas(1),cyto_nucl(1) RHRKRQRQR (401-409, prob:0.729) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VME7 Alkyl transferase Low 5 1 4-23 DTTVKRRETKVPLKRPAEPA mito(22),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WXM5 Uncharacterized protein Low 6.8 1 364-383 GTRRETRRPQGLPNDLRRER cysk(13),cyto_nucl(6),nucl(5.5),cyto(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VB32 Autophagy-related protein 9 Low 7 2 53-74, 775-797 SSSGPSPRRTPRPPPAIREPSG, HVPPERPLSRNRKGRRTFTDAKM plas(19),vacu(4),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VE16 Small GTPase Low 6.8 1 176-195 VLNPGRRSGKPKQRNGCVLM mito(10),cyto(8),nucl(5),cyto_pero(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJG0 Rab-GAP TBC domain-containing protein Low 9.6 1 348-371 GSRSASRSRSRSRRREKPPTPLGG cyto(12.5),cyto_nucl(9.5),mito(7),nucl(5.5) PAPPGSRPTRPSVRKPRGGSRSASRSRSRSRRREKPPTP (330-368, prob:0.992) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VK21 Translation machinery-associated protein 22 Low 9.2 1 100-119 IIKRSERTKRKQQTHIQNLE cyto(12.5),cyto_nucl(9.333),mito(8.5),mito_nucl(7.333),nucl(5) LEKKAEKKAEQEAAKKQATKIIIKRSERTKRK (79-110, prob:0.876) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKY6 Uncharacterized protein Low 8 1 1-28 MSTSSQRRDVRRPTPRRRTLSTQSQPNS plas(12),mito(6),cyto(4),E.R.(3) KEKRDEDKDKKK (308-319, prob:0.695) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLJ3 Uncharacterized protein Low 5 1 337-356 FFCLWRRKKRGDKVAHMNDG extr(24),mito(1),plas(1),pero(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VT20 UPF0029 domain-containing protein Low 7.1 1 7-32 PSSSTPPQSFKKRARVHTPPRNALSS mito(14),nucl(6.5),cyto_nucl(6),cyto(4.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VU18 Ketoreductase Low 8 1 334-357 DGMHKSIRARALRKKQREAGKKQE mito(9),cyto(9),cyto_mito(9) SIRARALRKKQREAGKKQ (339-356, prob:0.914) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VVC6 Uncharacterized protein Low 8.8 1 37-56 EDKLERLRPEQQRLRRKAVV nucl(14.5),cyto_nucl(11.5),cyto(7.5),mito(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VW54 Diphenol oxidase Low 5 1 77-105 ARDPSTWKLNRSKHRGHKTRRYNFNLSYT extr(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VXJ7 Diacylglycerol O-acyltransferase Low 8.7 1 87-113 HSQLSLKTKTKPRNRKHSKTQSLSSTK plas(20),nucl(2),E.R.(2),mito(1),cyto(1),golg(1),cyto_mito(1) PRNR (98-101, prob:0.612) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VXW7 Uncharacterized protein Low 5 1 534-554 LIYHGVRWGVKRHKKRQAIEV plas(11),extr(6),mito(3),E.R.(3),cyto(2),vacu(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W9U0 MFS sugar transporter, putative Low 5 1 128-150 TSGGKACCRLRRRRPLDDRAAVP plas(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WDT8 Uncharacterized protein Low 5.7 1 94-113 RTNNRFRSKRRSRAADAQTP mito(19),extr(4),nucl(2),cyto(2),cyto_nucl(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WEF7 Uncharacterized protein Low 7.2 1 85-104 RPTCECPDRNLRRSNRAPSP plas(12),nucl(6),extr(3),mito(2),cyto(2),cyto_mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WIQ3 Manganese resistance protein Low 7.3 1 245-270 DAPQTNFHRRRARKQAQNNPGRRQAK mito(9),cyto_nucl(8),nucl(7.5),cyto(7.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WQL0 Carboxylic ester hydrolase Low 5 1 68-89 AETAQRLRKPVRRKDPLVNWDA extr(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V2T0 Copper-exporting ATPase Low 8 1 97-125 RLVGKRREVRAEKREEARRRQHLEHCEQC plas(16),cyto(5),E.R.(3),pero(2) KRREVRAEKREEARR (101-115, prob:0.745) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VCV6 SAP domain-containing protein Low 7 1 88-107 KKVSAVRQKYENPRNRRYAM cyto(7.5),cyto_nucl(7.5),mito(7),nucl(6.5),plas(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VER5 Protein priA Low 5 1 188-210 VNPDCSCKPRRRCDCWDQWRCQC extr(22),plas(2),vacu(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHZ3 Uncharacterized protein Low 5.7 1 690-719 ATPRPTHTALPKPQGKKKNWKLEDVERWTM plas(17),mito(3),E.R.(3),nucl(2),vacu(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VIX5 Uncharacterized protein Low 9.6 1 78-102 QPCSPRSPYSPRRTPRTPRRRCSAM nucl(15.5),cyto_nucl(10),mito(8) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKA1 Dephospho-CoA kinase Low 9.7 1 222-251 ISLLRTYFRAKKVRRRSRGEVEQRRQRPEE cyto(11.5),cyto_nucl(9),nucl(5.5),mito(4),pero(3) AKKVRRRSRGEVEQRR (231-246, prob:0.85) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VM44 CAP-Gly domain-containing protein Low 7 1 1287-1315 SEGPVTPKPRTPKTPKSPLVKNANTRQAL cyto(11),cyto_nucl(11),nucl(7),mito(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VN04 Uncharacterized protein Low 9.9 1 713-740 AQPAKNEKKGKKQQQKEQREQQQQQREQ cyto_nucl(11.333),cyto(11),cyto_mito(8.999),nucl(8.5),mito(5.5) KKGK (720-723, prob:0.625) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VP73 SET domain-containing protein Low 5 1 1-25 MMPNESAKRNKAKQKQKAQLAKAVS mito(17),cyto(7),cyto_nucl(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VSJ8 Uncharacterized protein Low 9.9 1 64-88 WILSSPTRPKHPLRKRGKLNSDLHV pero(8),nucl(5),extr(5),plas(4),mito_nucl(4) HPLRKR (74-79, prob:0.644) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWI3 Spindle pole body component Low 7.3 1 757-776 EVMRRRLDKLRKRAHLNVHT mito(12.5),cyto_mito(9.5),nucl(8),cyto(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W421 MBOAT_2 domain-containing protein Low 8 1 226-249 NGKANGKTGKRKHRKIERTPYEVA plas(23),E.R.(3) KANGKTGKRKHRKI (228-241, prob:0.908) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WHC3 Uncharacterized protein Low 5 1 724-746 LTFFAQKKFPRQRWLRQLHPVMI plas(23),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V7I7 Monosaccharide transporter Low 5 1 1-22 MSAPTTPTRKRQHAPDREHLQP plas(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VDC6 Uncharacterized protein Low 9.2 1 600-627 PPQHKLEGGRSIRRRRRQKAAHRLDMDV mito(9),cyto(8),nucl(3),plas(3),pero(2) GGRSIRRRRRQKA (607-619, prob:0.886) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VG56 Uncharacterized protein Low 9.9 1 82-108 EVETRPSTPSKKDKKKRTPAAPTGPSI cyto(11),cysk(10),nucl(5) KKDKKKR (92-98, prob:0.782) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKX6 Uncharacterized protein Low 8 1 218-237 RTQAWRTQRKEKGAAKKAAK extr(11),mito(10),cyto(3),pero(2) QRKEKGAAKKAAKGKGEKLAK (225-245, prob:0.974) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTT9 Uncharacterized protein Low 5 1 48-68 PYSLAEEKRRARRRCGWAAER mito(16),cysk(5),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUL8 Uncharacterized protein Low 9.5 2 345-374, 3055-3080 HERQRKWSWDYLKERRDKRKQYVDLYIKKL, LDSEYQTKRRMTQKRNKPKHALYGVA cyto(11.5),cyto_nucl(10.5),nucl(8.5),mito(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W4Y8 Uncharacterized protein Low 5 1 1-26 MLIQNWRQRRAKQRAIQRMPPRPIQV mito(21),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W8G0 Trehalase Low 5 1 337-359 GGNDQGQRRKRQQQQQGQTQQQG extr(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WE89 F-box domain-containing protein Low 9.4 1 338-362 EQPSAGVKRRARKPYKLFDKTKIAD mito(10.5),cyto_mito(10.166),cyto(8.5),cyto_nucl(8.333),nucl(6) R (347-347, prob:0.602) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WFG6 Metal resistance protein ycf1 Low 5 1 204-223 FSPEKKWKALRAPWSPRKIE plas(22),E.R.(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WUV0 Uncharacterized protein Low 7.4 1 342-361 LFWCCCRVRRERRQAVKAGR extr(7),nucl(6),mito(3),cyto(3),golg(3),cyto_mito(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WUV7 Uncharacterized protein Low 8.2 1 61-85 INLEKLRKIRWKKLTEYDRNPPPPS nucl(11.5),cyto_nucl(11.5),cyto(10.5),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V982 Uncharacterized protein Low 7.8 1 27-51 AASREVCKGWRKRANRVLQRHLTVR nucl(9),cyto(7.5),cyto_pero(7),pero(5.5),mito(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VH01 Non-reducing end alpha-L-arabinofuranosidase Low 6 1 530-553 EYSAQEWKDRKHTVRKHSWQFIVV cyto(13.5),cyto_nucl(10.166),cyto_mito(10.166),cyto_pero(8.166),nucl(5.5),mito(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJP9 Aldehyde dehydrogenase Low 5 1 476-497 SVEHERRALERRRNRRTFYLGV plas(9),cyto(7),mito(5),cyto_nucl(5),cyto_pero(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKQ7 Ubiquitin thioesterase OTU1 Low 8.5 1 84-110 SNPNKLRSPSASPVRRRRPSVKELDAE mito(14),nucl(11.5),cyto_nucl(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VNP9 Uncharacterized protein Low 7 2 19-41, 1018-1038 MGQYMHGKRAERKKTQRFVGQVV, SDPKGRRRTFHRTPSQPLRTS plas(18),extr(4),E.R.(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQN9 Uncharacterized protein Low 9.6 1 239-261 EVAMQQRRAKRNKRGMARRHSGG mito(13),cyto(8),nucl(4) QRRAKRNKRGMARRHSG (244-260, prob:0.933) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWG9 Uncharacterized protein Low 9 1 5-24 SKLLPSTPKKRAPSPPPILS mito(15),nucl(10) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WHB8 Uncharacterized protein Low 7 1 484-508 PVGTAFVKRKWKDRIEKFQEEQEKK cyto(13.5),cyto_nucl(11),nucl(7.5),mito(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WQH6 Endo-1,3(4)-beta-glucanase Low 8 1 67-97 GGKEHQHKPSKTKTRPHWKPKPTGGHNHGGD extr(26) KPSKTKTRPHWKPK (74-87, prob:0.722) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WSN8 Longevity-assurance protein-like protein Low 5 1 85-104 MERHLKRVAAKKKEHNSVRF plas(19),E.R.(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WTE6 Uncharacterized protein Low 9.2 1 296-324 RNDERKRHEARPFRRKHGYCKVYKKCLKA mito(21),nucl(3.5),cyto_nucl(3.5) RKRHEARPFRRK (300-311, prob:0.702) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V3J3 Uncharacterized protein Low 8.8 1 149-173 FNTRDRLREKKIKFKDKADKLKVLA plas(16),cyto(4.5),cyto_nucl(4),E.R.(3),nucl(2.5) REKKIKFKDKA (156-166, prob:0.72) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V425 MFS domain-containing protein Low 5 1 83-104 SIHSHRRSRSSQHRGSRQSCQS plas(22),E.R.(2),cyto(1),golg(1),vacu(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VDY9 Uncharacterized protein Low 9.3 1 363-386 EPETPLCRTCRRRHQPENPCRETL nucl(18.5),cyto_nucl(12.833),cyto_mito(4.499),cyto(4),mito(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VI70 Ubiquitin-like domain-containing protein Low 9.9 1 10-32 LDIADTPSKRRRTDRKEDFGIMF nucl(17.5),cyto_nucl(10.5),mito(5),cyto(2.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VIJ1 MFS domain-containing protein Low 5 1 64-84 DEDHTLKKRSWHPRVTPWSDI plas(21),E.R.(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJQ2 DDE Tnp4 domain-containing protein Low 7.7 1 399-422 LEEPNTARPWRRERLRQQIHWLLE mito(11),nucl(7),cyto(5),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKE1 Uncharacterized protein Low 5.8 1 113-135 FPLPSRPCSIRKRPRPPCYPFTT plas(19),nucl(2),extr(2),vacu(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQJ9 Uncharacterized protein Low 6.7 1 1184-1212 PGKRGENLWFRKKHDQPKKDKDTDKSEAN cyto(15),cyto_nucl(11.5),nucl(6),mito(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRR6 Mitochondrial genome maintenance protein MGM101 Low 8 1 279-309 VEAMVEHQRDKKKRKLWRRKDAKFEYPYKEV mito(24),cyto(2) RDKKKRKLWRRKDA (287-300, prob:0.945) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VX95 Uncharacterized protein Low 9.9 1 191-211 FEEIDERKEKRRARLRKSPSS mito(18),nucl(5),cyto(3) RKEKRRARLRKSP (197-209, prob:0.905) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VXQ9 Uncharacterized protein Low 8.8 1 49-71 SAVPRPWRTKPCRHFQVGKCRMG nucl(14),cyto_nucl(10),mito(9),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WFA5 Uncharacterized protein Low 8.8 1 230-250 ALPPRRPRLDRRDTPRPPISP nucl(10),mito(7),extr(6),cyto(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WMA2 Uncharacterized protein Low 8.6 1 447-472 APQMPGPSTHPRRRQRTRHGHSSRED nucl(9),mito(6),cyto(4),plas(4),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V2J0 Ran1-like protein kinase Low 8.2 1 38-57 YLYGRPIKRAVKQLRRHGID nucl(12),cyto_nucl(12),cyto(8),mito(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V795 Uncharacterized protein Low 5 1 841-861 QIHHHHAMTARQRRRNKGRLM cyto(9.5),extr(7),cyto_nucl(6),plas(3),mito(2),pero(2),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VES8 Uncharacterized protein Low 8.6 1 46-69 VELSKRQVAPRQRRQQHGRRSAEL nucl(12.5),cyto_nucl(10),cyto(6.5),mito(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VF41 Uncharacterized protein Low 5 1 119-143 LAKLGPTPPRRPKRNWWHGRGDHAE mito(20.5),cyto_mito(13),cyto(4.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VF56 Uncharacterized protein Low 9.9 1 128-147 EEQPEERRRHKPWKEVQLSR nucl(19.5),cyto_nucl(13.5),cyto(6.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHV5 Transcription regulator Low 9.5 1 380-399 KSPQRRTPGQRRQQQQPRYN nucl(17.5),cyto_nucl(12),cyto(5.5),mito(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJ51 Endosome protein Low 6.5 1 430-449 PPGSSGSSRRHRRNPSQPVA cyto(7.5),mito(7),cyto_nucl(6.5),plas(5),nucl(4.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VMG2 Mitotic chromosome condensation-related protein Low 9.8 1 845-870 TSDSDATPVKPRPKRKPEPIQEESSV cyto(12.5),cyto_nucl(10),mito(8),nucl(6.5) RPKR (856-859, prob:0.64) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VNC9 GATA-type domain-containing protein Low 9.3 1 550-571 LKLARAVAKREGRQKPRKKDKT cyto(10.5),cyto_nucl(8),nucl(4.5),mito(4),pero(4),plas(3) RAVAKREGRQKPRKKDKT (554-571, prob:0.959) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQF3 Endoglucanase Low 5 1 568-590 IALWCFKKRDPYRWSRISQKFKH extr(26) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWD8 Nucleus protein Low 9.7 1 70-101 GVKRPRLRLAHACDRCRKRKIRCDTQQPCGPC nucl(17.5),cyto_nucl(10.5),mito(3),cyto(2.5),plas(1),extr(1),pero(1),vacu(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWG7 Uncharacterized protein Low 5 1 588-607 WLNDREKKEDEKERRRALHA extr(20),cyto(2),E.R.(2),mito(1),cyto_nucl(1),golg(1),vacu(1),cyto_pero(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VYF1 SLT domain-containing protein Low 8.7 1 44-75 LAGERNTTKARKRNLHRKRKCRPAPGSEAPAV extr(22),nucl(2),mito(2),mito_nucl(2) RRHHTKAKAARALAGERNTTKARKRNLHRKRKCR (32-65, prob:0.979) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W6V3 Uncharacterized protein Low 9.2 1 71-99 EVSETFAERRRRRWRRRRQRAAEERMAKY plas(15),cyto(4),nucl(3),E.R.(2),mito_nucl(2) RRRRRWRRRRQRA (79-91, prob:0.974) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WKN3 Uncharacterized protein Low 5 1 129-152 PALACFSKLKRDRRHVYRHAQPLV plas(21),E.R.(3),vacu(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V5H9 Pyruvate dehydrogenase (Acetyl-transferring) Low 5 1 899-927 VVEEKKLTGRKWRGSQRRMRSSRSNFHEL mito(22),cyto(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VEX4 Serine/threonine-protein kinase Low 7.4 1 310-329 WSPTTRKRSYHNHNHKQDVT nucl(8.5),cyto_nucl(8),cyto(6.5),mito(6),pero(2),plas(1),E.R.(1),golg(1),vacu(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VP81 Uncharacterized protein Low 9.4 1 217-241 AVFKGQSKKKEEKKEKAPKAEKPKA cyto(12),cyto_nucl(10.166),cyto_mito(10.166),nucl(6),mito(6) QSKKKEEKKEKAPKAEKPKAEKAPKAKK (222-249, prob:0.997) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VU15 Uncharacterized protein Low 9.8 1 341-362 RSSPGRARRTSRVRHHRSQSFD nucl(12),cyto(11),mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W6A9 SH3 domain-containing protein Low 5 1 1307-1328 AAYCMRRYERRHRPQEIYEKAP extr(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W6G2 G domain-containing protein Low 8 1 428-470 EEAGRNRSPTQVKKQERREKLEERRKKSEAKRQRQKAALASAR mito(17),cyto(8) VKKQERREKLEERRKKSEAKRQRQKAALASARR (439-471, prob:0.993) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W8K0 Iron-sulfur protein required for ribosome biogenesis and translation initiation, Rli1p Low 6.5 1 9-34 ALVSDDKPKKCRQECKRSCPVVRMGR cyto(12),cyto_nucl(9.5),mito(7),nucl(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WFS7 Uncharacterized protein Low 8 1 85-104 RAWQLFKREKREKRQRAIAA mito(25),cyto_mito(14) REKREKRQR (92-100, prob:0.726) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WIH5 Aa_trans domain-containing protein Low 5 1 410-430 HDNWRYASPERRRNWRLRAEL plas(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WQJ5 Structural constituent of ribosome Low 9.2 1 41-63 GSQLMPRRIKWKKSAKGRPALPT mito(23),nucl(3) PRRIKWKKSAKGRP (46-59, prob:0.875) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WU87 Uncharacterized protein Low 8.3 1 37-59 RHGPSPSPARGRRPQRPGRLLAA plas(21),E.R.(3),nucl(1),mito(1),cyto(1),cyto_nucl(1),cyto_mito(1),mito_nucl(1) RGRRP (46-50, prob:0.627) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9J3 MICOS complex subunit MIC10 Low 5.8 1 16-36 DAVARKYQKRHSRHGAACRPF cyto(10),mito(5),extr(4),E.R.(3),nucl(2),plas(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9P8 DUF1996 domain-containing protein Low 8 1 604-636 TSTSGPKFGKHGKKCRPKGHKGQGHRGNKRRLH extr(27) KFGKHGKKCRPKGHKGQGHRGNKRRLH (610-636, prob:0.983) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VBK6 Uncharacterized protein Low 8.8 1 182-203 LHSGPGRKRKTRNFKLQLLRYV mito(15),cyto(7),nucl(2),pero(2) RPVKGKGKPGKKA (126-138, prob:0.878) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VDF4 Uncharacterized protein Low 8.9 1 159-178 EKISTKMKQRLSMKQKRSKK mito(22.5),mito_nucl(13.5),nucl(3.5) KMKQRLSMKQKRSKK (164-178, prob:0.874) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFZ2 Negative regulation of gluconeogenesis-related protein Low 8.5 1 16-37 NDPTITQRPSRRPRHATSATHS nucl(12),mito(9),cyto_nucl(9),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VIY7 Uncharacterized protein Low 8 1 22-50 QSLRTPARVRAKLKREKRAKRKLLLEDES plas(19),E.R.(3),extr(2),vacu(2) ARVRAKLKREKRAKRK (28-43, prob:0.973) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VMX6 Uncharacterized protein Low 7.4 1 208-228 ADANSHKGKHKDKNGKWHDHA nucl(6),mito(5),plas(5),cyto_nucl(5),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQF0 Uncharacterized protein Low 7.6 1 298-319 RQQPPMQRPPPQQQQQQYRGPP nucl(9.5),mito(9),cyto_nucl(8.333),cyto(6),cyto_pero(4.333) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WIK3 AA_permease domain-containing protein Low 5 1 3-24 LSLTRSRSSTEKKEKDQEGRAD plas(26) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V4G7 Rpl39 Low 6.5 1 4-29 QKSFIVKQKLAKKARQNRPIPQWFRL mito(22),nucl(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VG37 Uncharacterized protein Low 6.9 1 4-26 TVTPRSGSPFRRRSRRLPPSLIF mito(20),nucl(5.5),cyto_nucl(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VG68 ABC transporter domain-containing protein Low 8 1 316-337 VTVWGLAKRRRARKQPAGSLVK plas(21),extr(3),E.R.(2) KRRRARK (323-329, prob:0.735) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGT0 MFS domain-containing protein Low 5 1 503-525 LPMYFFGKRIRRWTRNSSYHKED plas(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VH32 Glycerol-3-phosphate O-acyltransferase Low 8 1 647-667 VIDHRGGKSPRRRTRAGRSYS plas(21),mito(1),cyto(1),extr(1),pero(1),E.R.(1),vacu(1),cyto_mito(1),cyto_pero(1) KSPRRRTR (654-661, prob:0.701) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VNL2 Uncharacterized protein Low 5 1 193-216 ASVPVQTHDRRVRQRRDVPYPAHQ cyto(18),cyto_nucl(11),mito(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VNQ3 Uncharacterized protein Low 5 1 586-605 RSGKHNPRVKWQKNIFRAGT plas(15),mito(4),cyto(3),mito_nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VSN6 Uncharacterized protein Low 5.8 1 311-333 HAEEKERRRYQKEVERKKVDWEK mito(24),nucl(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VX76 RAB small monomeric GTPase Low 8 1 635-654 ALDRRICKVYRRRGQEHDEH mito(19.5),cyto_mito(13.5),cyto(6.5) RRAAAPPPRAGGRGGREGGHDGVPEPERDHPRGRVHGPCGGRADNRRRHAARRAPETARAPGLGVPPRARGA (531-602, prob:0.935) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VYU0 F-box domain-containing protein Low 9.5 1 491-510 TDEHHHRPEERRRRWADDEE nucl(14),mito(5.5),cyto_mito(5),cyto(3.5),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VEZ4 Uncharacterized protein Low 5 1 2-22 SSIIRSATRRMRVQRMRTTPL mito(26) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VK04 Uncharacterized protein Low 8.9 1 72-91 LLTIRRYRLRRRYWTATQLA mito(9),cyto(6.5),cyto_nucl(5),plas(3),extr(3),nucl(2.5) EPPPPPPPKVK (188-198, prob:0.656) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VND9 Aurora kinase Low 7.1 1 140-161 LEHPWIKRYEKRSRASRPDREQ cyto(9.5),cyto_nucl(9),nucl(7.5),mito(6),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRN9 SAP domain-containing protein Low 9.2 1 1419-1445 DALFSHERRKRFRRERRHQGRREGGWG cyto(14.5),cyto_nucl(10),nucl(4.5),mito(4),plas(1),extr(1),pero(1),E.R.(1) GEPPRRGALRPGRPETLRPDAAPVPGRRKAARPDALFSHERRKRFRRERRHQGRRE (1386-1441, prob:0.991) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRX5 Uncharacterized protein Low 5 1 331-350 GAVLLFRRRQRRQPLQGPIE extr(21),plas(3),cyto(1),E.R.(1),vacu(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VX08 Uncharacterized protein Low 5 1 566-588 AVAKTPRQVPRPRSRQPSRRLVE extr(24),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VYA7 Eukaryotic translation initiation factor 3 subunit B Low 6.9 1 651-679 LWRPRPKTLLSREQQKKIRRELKEYSRQF cyto(9.5),cyto_nucl(8.5),pero(7),nucl(6.5),mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W0J4 Ubiquitin carboxyl-terminal hydrolase Low 9.3 1 58-84 PLGVVIKRTRKEQKKRDNSEPPMKKLA cyto(11.5),cyto_mito(9.333),cyto_nucl(9.166),nucl(5.5),mito(5),cysk(3) KRTRKEQKKR (64-73, prob:0.747) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WA67 Uncharacterized protein Low 8.8 1 196-220 DTDASDKSKRGRRHRDHRPPLPFDP plas(16),extr(8),nucl(2) SKRGRRHRD (203-211, prob:0.758) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WAE0 MFS domain-containing protein Low 8 1 114-137 PGQSASFSRKKRRKSIGNGGENKL plas(27) RKKRRK (122-127, prob:0.758) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WIZ4 Calmodulin-dependent protein kinase I Low 8.3 1 9-31 DALLSQPKSFKKKKEYSLEELLG cyto_nucl(13),nucl(12.5),cyto(12.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WNZ1 USP domain-containing protein Low 8.5 1 279-306 AIPPASSGEKKKKKKKRTKSSSAPANGA extr(15),plas(4),mito(2),cyto_nucl(2),pero(2),nucl(1.5),cyto(1.5) GEKKKKKKKRTKS (286-298, prob:0.993) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WUP7 ATP-binding cassette (ABC) transporter Low 8 1 41-72 DALSLKEWRETRKQRREERRRRERETPLNTPA extr(11),mito(5),E.R.(4),plas(3),golg(3) TRKQRREERRRRER (51-64, prob:0.885) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V2F3 Uncharacterized protein Low 5 1 274-298 QDAVVRKPGRRRAFPPQGRRDFEED extr(17),E.R.(3),plas(2),golg(2),vacu(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V313 Non-specific serine/threonine protein kinase Low 5.7 1 723-749 NIPFSKRYLKYLTKKHLKKNSFENFLR mito(20),pero(3),nucl(2),cyto(2),cyto_nucl(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VEC1 LEM3 (Ligand-effect modulator 3)/CDC50 family transcription regulatory protein Low 5 1 19-45 TNNHDAPKEKVKWSKRPANTAFKQQRL plas(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGV0 Ste11 Low 9.5 1 628-648 GHHHILRRKRHCSDRPPPHAI plas(17),nucl(4),cyto(3),mito(1),golg(1),vacu(1) RIKAFKRRRQSG (300-311, prob:0.79) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VK51 Tyrosine--tRNA ligase Low 8 1 415-436 ASDPRFRRVHRKDLKGKPVTKL mito(22),cyto(4) GGKKTKGKQAAAVKKEE (259-275, prob:0.795) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRU8 SprT-like domain-containing protein Low 9.3 1 46-71 DDIRGRSSRTYARRKHHQPRTSATST nucl(15.5),cyto_nucl(10),mito(7),cyto(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUI1 Hemolysin Low 8 1 468-490 GDKSNGKGHNEPKRGRNKKKGKK mito(11),cyto(9),E.R.(3),plas(2) GKGHNEPKRGRNKKKGKK (473-490, prob:0.996) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VX54 Ser/Thr protein kinase Low 6.7 1 167-186 RERVILRKRRTKLRVDQFRI cyto(16.5),cyto_nucl(12),nucl(6.5),mito(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VXR2 Endopeptidase Low 6.9 1 2-23 VCPFARSSDRRRRAIRVDHTGR mito(7.5),cyto_mito(7),nucl(6),cyto(5.5),plas(3),E.R.(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W909 Leucyl aminopeptidase Low 5 1 470-489 MSSSWGRYAKRDNYNPPKLV extr(24),mito(1),cyto(1),pero(1),cyto_mito(1),cyto_pero(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WLG1 Uncharacterized protein Low 8.7 2 39-64, 149-176 NATGFRKILKKWDKRSKSNTKELYLE, AVAKWIKQMYKIRAKRNPKSHDRAMRIL cyto(10),cyto_nucl(9),pero(7),nucl(6),mito(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V421 Uncharacterized protein Low 5 1 96-120 QWKHATKVAKLRKLRRNNNEDQRGL plas(17),mito(5),E.R.(3),cyto_mito(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V586 Integrase catalytic domain-containing protein Low 9.3 1 526-555 YMHVRVRRYHSKKDAKQRRKKHTSRTIGVF cyto(11.5),cyto_nucl(8.5),pero(7),nucl(4.5),mito(2) RRYHSKKDAKQRRKKH (532-547, prob:0.892) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VF55 Uncharacterized protein Low 9.7 1 232-253 EEGSSKKKGRGAKKGKKAKGGD nucl(8),mito(8),cyto(8),cyto_nucl(8),cyto_mito(8),mito_nucl(8) GSSKKKGRGAKKGKKAKG (234-251, prob:0.995) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VG02 Uncharacterized protein Low 9.9 1 15-34 DEHGRTKRTKRDVPPGLSKR plas(15),nucl(5),cyto(4),pero(3) RTKRTKRDVPPGLSKRDAKALRKIRRRA (19-46, prob:0.941) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHK5 Glucose-6-phosphate 1-dehydrogenase Low 8.2 1 2-22 SSPPRDSERLRRKRGSIPSME cyto(9),nucl(8),cyto_mito(8) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHL6 Uncharacterized protein Low 7.8 1 9-29 SDAPHQSKKTRLGPQVKQPLD mito(16),nucl(7),cyto(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRY0 Mediator of RNA polymerase II transcription subunit 14 Low 9 1 724-743 QKLMERRRTKAHKRARDEDE mito(17),cyto_nucl(4),nucl(3),cyto(3),pero(3) RTKAHK (731-736, prob:0.623) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W4P3 Non-specific serine/threonine protein kinase Low 8 1 554-583 GTTPTPTPKKKSNRRRVRGRGRRGRRNSVG plas(12),extr(4),E.R.(4),vacu(3),cyto(2) PKKKSNRRRVRGRGRRGRRN (561-580, prob:0.995) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V538 Uncharacterized protein Low 5 1 526-548 GSYLPFQKWFNQRKNKHWRILFF plas(17),mito(3),E.R.(3),cyto(2),mito_nucl(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V975 Exo-beta-1,3-glucanase Low 5.7 1 137-162 KAPAWTSSTVQRKRNRKRWAWALLAL plas(13),extr(4),cyto(3),nucl(2),mito(2),golg(2),mito_nucl(2),cyto_pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKV7 DNA-directed RNA polymerase Low 8 1 1064-1085 AETKRPRGPRPGPKSQVKSRIA mito(25.5),cyto_mito(14) KRPRGPRPGPKSQ (1067-1079, prob:0.803) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VL50 Uncharacterized protein Low 8 1 170-194 GALVGKRSSIKRKAKQVKRFFCDLP mito(12),plas(11),extr(2) IKRKAK (179-184, prob:0.672) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLW9 60S ribosomal protein l37 Low 5.8 1 103-123 FDFHAERKRLRTQNRTNIRAA mito(21.5),cyto_mito(12.5),nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLY3 Penicillin-binding protein, 1A Low 8 1 81-116 GDKDNGDKDRPNKCKNRKKNRKGRKKWDHDYWTDPE extr(25) RPNKCKNRKKNRKGRKK (90-106, prob:0.98) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VR64 Uncharacterized protein Low 8.8 1 282-302 QARDAKKKDGIFKRIFRKKSP pero(8),cyto(7.5),mito(7),cyto_nucl(5.5),nucl(2.5) KKKDGIFKRIFRKKSP (287-302, prob:0.837) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VT63 Urea transporter Low 8 1 32-65 APKMGAKSFAKKKSPSKRQGPSPRVKVHRLKLTS plas(8),mito(7),E.R.(6),extr(3),cyto(2) GAKSFAKKKSPSKRQGPSPRVKVHR (36-60, prob:0.945) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VVP9 Uncharacterized protein Low 9.7 1 340-370 LSSAYPAERKERKERERRERRKSEPEIYVDR mito(20),nucl(5),cyto_nucl(4.5) RKERKERERRERRK (348-361, prob:0.95) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W6R2 Siderophore-iron transporter Low 7 2 72-91, 361-384 LPPQPKEPKVWEQRQRNIVW, LSRTRVRVRYRWQRRQWFKFRGLT plas(18),E.R.(5),vacu(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WDM8 ATP-dependent DNA helicase PIF1 Low 9.5 1 255-277 ADALCRRIKKNKKAVPRWLRTKV mito(17),cyto(5),nucl(4) KKNKK (263-267, prob:0.67) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WMX0 MUTL-like protein 1 Low 6.7 1 444-467 VLFPSFRRTQWPRRLKPSAKQVAN mito(13),cyto(7.5),cyto_nucl(7),nucl(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VAQ9 Ribosomal protein Low 8 1 414-446 GQEGRNARLRKEEKRKEQAKRDREWRREAYERY mito(20),cyto(5) NARLRKEEKRKEQAKRDREWR (419-439, prob:0.923) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VED8 Signal peptidase subunit 3 Low 5 1 125-150 DAFHDGRQKHRKTKTYKNAKIRLEGA extr(12),golg(7),mito(2),pero(2),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VEI2 Glyco_hydro_cc domain-containing protein Low 6.8 1 1-27 MPKLVTRSDGRKCKPRTKPADGQDSNS mito(10.5),cyto_mito(8.166),nucl(7),cyto_nucl(6.833),cyto(4.5),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFJ2 Uncharacterized protein Low 5 1 3-27 ASTPNSLRLRARKSRPSVLKTRAVT plas(20),mito(3),E.R.(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHQ6 Uncharacterized protein Low 5 1 102-127 PSKGKDDQSHRRHVPRNRWRPARWGD cyto(11),mito(7),cyto_pero(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQL5 Uncharacterized protein Low 7.4 1 445-468 SGSISFSPRARRRQRSLPIGPPRS extr(9),nucl(6),mito(5),cyto_nucl(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VZG6 Uncharacterized protein Low 6.2 1 748-767 IEKLCNRKARKYVSQGKRLF mito(13),nucl(3),cyto(3),plas(3),cyto_nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W744 Uncharacterized protein Low 9 1 86-111 DAYERREERREQRKLRKYYRLREALR extr(7),mito(5),cyto_nucl(4.5),cyto(4),plas(4),nucl(3),pero(2),E.R.(2) RREQRKLRKYYR (94-105, prob:0.73) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WWZ5 BTB domain-containing protein Low 8.5 1 227-246 GTGVKKKKSRVRFQDPNPKN cyto(9.5),extr(9),cyto_nucl(6),mito(5),nucl(1.5) KKKKS (231-235, prob:0.677) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V072 RNA-dependent RNA polymerase Low 5 1 89-111 ITTRRPARFYCKIKNKAIMRRAT mito(14),cyto(9),mito_nucl(9) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V099 Uncharacterized protein Low 9.2 1 303-322 FEPQRPGRRAKSSDRWDRHP nucl(13.5),cyto_nucl(8.5),mito(8),cyto(2.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V0R2 Uncharacterized protein Low 5 1 998-1018 QPPASPSTYFHRPNRRRTISG plas(22),E.R.(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V117 Ribonuclease H Low 7.7 1 383-402 QLASRRQKWEKSYREKGPEG cyto_nucl(11.5),cyto(11),nucl(10),mito(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VDH8 FAD-binding FR-type domain-containing protein Low 8 1 718-740 IQKEGKLRRAKTRRAMKARESIG plas(19),cyto(2),E.R.(2),vacu(2) KEGKLRRAKTRRAMKA (720-735, prob:0.872) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VE60 Threonine aldolase Low 5 1 459-482 VDPEDRPTKRQKLGEKDGRIRLQV mito(20.5),cyto_mito(13.5),cyto(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFV6 Uncharacterized protein Low 8 1 466-489 GKATARKWERQSKPPRPWPYKQGT nucl(10),cyto(9.5),cyto_mito(8),mito(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VIL5 Uncharacterized protein Low 8.1 1 415-439 STSSNHRRGFCRWRTKYRIFPQSLT mito(12),nucl(11),cyto_nucl(8.5),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKP8 Uncharacterized protein Low 8 1 214-240 VDTPPNAKGKQKEKPKQKTQADLDEEM cyto(16),cyto_nucl(9.5),mito(9) KKLAAKAKPAAPKKDDGKAPGLKLLSRLGKGGKAGEQQKQKLLLEKQRAALKKKGSPGDVLASRLGKSKPGAKSAAGKKAAAKAPAGGAAKVARAKKDKMDVDTPPNAKGKQKEKPKQ (113-230, prob:0.996) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VPD4 Fungal specific transcription factor domain-containing protein Low 8.6 1 59-85 RQATACTECNRRKQRCDGVQPCHHCAK nucl(10),plas(9),mito(3),cyto(3),cyto_mito(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VU67 Alpha-acetolactate decarboxylase Low 8 1 35-55 DHWKGNKGKGHHRHGRPWVKA extr(20),mito(3),cyto(2) GKGHHR (42-47, prob:0.628) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W0C4 Uncharacterized protein Low 9.4 1 209-230 LLFLFLRRKKRPQRVGRSLENE cyto(10.5),cyto_nucl(8),mito(5),nucl(4.5),extr(3),pero(2) RKKR (216-219, prob:0.648) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W6L5 Uncharacterized protein Low 5 1 36-55 SGHSRWSKIRHKKGAVDAAR mito(26) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WA58 Multiple drug resistance protein Low 5 1 34-56 PGEARKLTLHRRPWRRYVTPFEY plas(24),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WEB6 CinY protein Low 5 1 45-64 VQRARARTTDPPKKQIQKVH extr(23),mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V4I6 Uncharacterized protein Low 9.4 1 27-55 PISSRKICRPYERPQPNRPDTPRPPRWAS nucl(15.5),cyto_nucl(11.5),cyto(4.5),mito(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V7D4 Uncharacterized protein Low 9.6 1 1-24 METPNTRSTRRRKRPDDTPGSQGS nucl(18),cyto_nucl(12),mito(5),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V8V4 Uncharacterized protein Low 6.1 1 15-35 SPENLRRFARHYRTGRPQQAG pero(10),cyto(8),mito(6),nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VIV1 Dus domain-containing protein Low 8 1 12-39 ASLGSSPVSKKQKRDQRRDPGPETRVRE mito(24.5),cyto_mito(14) AEAAKAKK (438-445, prob:0.675) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VPZ6 64 kDa NADH dehydrogenase Low 5 1 73-101 IPSDPDKLTKQHKKHKWRYSKHGELDPDF mito(12),extr(5),cyto(4),plas(3),E.R.(2),cyto_pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VT58 Proteinase inhibitor I4 serpin Low 5 1 19-38 APELPFPPKQKKPADPLTKA cyto(18.5),cyto_nucl(10.5),pero(3),cysk(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VZN5 TPR_REGION domain-containing protein Low 8 1 374-393 LTSMVKKKKKPAAAPAPTAE cyto(16),cyto_mito(12.833),mito(7.5),mito_nucl(6.166) KKKKKPAAAPAPTAEKRKAEEQPEGTPEKKAKN (379-411, prob:0.954) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W9I0 F-box domain-containing protein Low 9.2 1 805-826 AKTELGGKKKRQSNKRGDKGEG mito(15),cyto(8),nucl(3) GKKKRQSNKRGDK (811-823, prob:0.833) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WB80 Fungal_trans domain-containing protein Low 7.9 1 23-48 VNKPQACQACQQRKRKETTRLLDLRQ mito(10.5),nucl(10),cyto_mito(8.5),cyto(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WGX2 Autophagy protein 5 Low 5.7 1 520-545 LAEGEQRRSWRRRDERRSQLSFVRQR mito(16),cyto(7),nucl(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WM71 Obg-like ATPase 1 Low 8 1 56-83 STSPAAYAKRNKKMPPKKKVVEDKKVIL mito(19),cyto_mito(13),cyto(5) KRNKKMPPKKKVV (64-76, prob:0.889) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V2T6 37S ribosomal protein S25, mitochondrial Low 8.8 1 66-93 FAQHHGRPHSKNHKQKHLKEIKPKPVQI mito(16.5),cyto_mito(11.5),cyto(5.5),nucl(3) KNHKQKHLKE (76-85, prob:0.66) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFC4 Uncharacterized protein Low 7.3 1 1-25 MWPSSKYSKRYQRRLTQWREKQGWV mito(12),nucl(6),cyto(5),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VNJ6 Ribonuclease Z Low 8.8 1 859-883 LTPAEKARANKQKQKEAQRELQAKK cyto(9.5),mito(9),cyto_nucl(6.5),pero(3),nucl(2.5) KAGKKGKKAAKMQQDLTPAEKARANKQKQKEAQRELQAKKRAEQAATAAAKK (844-895, prob:0.921) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VP23 VPS37 C-terminal domain-containing protein Low 8.2 1 155-174 NEFKAARKTYHKRNIWAERW nucl(14),cyto_nucl(10.833),cyto_mito(6.666),mito(6.5),cyto(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTI2 alpha-1,2-Mannosidase Low 9.9 1 652-671 VKYHRKWKGVPVGSKRRNGH cyto(9),pero(8),nucl(5),mito(4) KEGRPK (831-836, prob:0.624) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTV7 CNH domain-containing protein Low 8.8 1 123-150 VLRLHSSRQNRGWKLRHKQTVNPRRPIS nucl(10),cyto(9),cysk(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VVK5 Uncharacterized protein Low 9.9 1 30-54 SGNNKPFSLKKTRRNWKPNVHIMNM nucl(15),mito(9.5),cyto_mito(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WB43 Beta strand repeat-containing protein Low 5.8 1 37-59 SQQNKGKPPSRLQQHPKIWMRCP mito(10),extr(10),nucl(2),cyto(2),cyto_nucl(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WDN8 Uncharacterized protein Low 8 1 319-342 GAGLRKVRRLKRGRTCKPRPSSGS extr(22),mito(3),cyto(1.5),cyto_nucl(1.5) AGLRKVRRLKRGRT (320-333, prob:0.865) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V0A2 Uncharacterized protein Low 8.9 1 56-83 SSTPTTPATDRDRRKSRRQSTPFYTKGI nucl(13.5),cyto_nucl(10),cyto(5.5),mito(4),extr(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V5V5 Protein AF-9 homolog Low 9.1 1 284-308 EHPPTPLPARNRRPRDQREQHDMKT mito(13.5),cyto_mito(11),cyto(7.5),nucl(4) GNSKKKRA (309-316, prob:0.749) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9U9 Uncharacterized protein Low 5 1 878-899 GANYYTRRRHTRWWIKYNYVLG plas(24),E.R.(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VBC6 Uncharacterized protein Low 6 1 315-339 RVALFDRQLRRRDRRRDGHEPAHEC mito(17),extr(4),nucl(3),cyto(3),cyto_nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGL4 ANK_REP_REGION domain-containing protein Low 5 1 1167-1192 VLPDYPQRKVSRKQKFKTALGNLTRR mito(12),cyto(8),mito_nucl(8) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VI63 Lipase_3 domain-containing protein Low 9.4 1 897-918 MSQNAKRERKVKHPPISTKFVT nucl(11),mito(10),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLR4 60S ribosomal protein L20 Low 7.6 1 151-170 PLPHRRSKSKAWFAANRPST nucl(13),cyto_nucl(11.166),mito_nucl(11.166),mito(7),cyto(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VW70 Aa_trans domain-containing protein Low 5 1 440-459 GKYAKDPKPRDMKGFKKKFF plas(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W4R5 Uncharacterized protein Low 8 1 122-148 AIRKTDYDFTRPRRRHRHAGTAAKEEP plas(19),extr(2),E.R.(2),vacu(2) RR (135-136, prob:0.612) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W9B7 Phytase Low 6.9 1 38-61 SLPAHPKYTRSGPRRRRPFLWICI plas(11),nucl(5.5),cyto_nucl(4.5),mito(3),cyto(2.5),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WH77 mRNA export factor elf1 Low 8 1 1060-1097 EEDIKRLQKLALKPKKKKKKTRNEIKAQEERRRLRKLN cyto(18.5),cyto_nucl(11),mito(5) QKLALKPKKKKKKTRNEIKAQEERRRLRK (1067-1095, prob:0.998) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V409 Uncharacterized protein Low 9.2 1 485-508 PTSSCGCRGCRKPKPASAVPPPSV nucl(17),cyto_nucl(14),cyto(9) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V694 Uncharacterized protein Low 9.5 1 95-125 GGRWTWRSFRHARVRVHRRRSRAPNFHLSAY mito(14.5),cyto_mito(10.333),nucl(6.5),cyto_nucl(6.333),cyto(5) ARVRVHRRRSR (106-116, prob:0.728) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VDA4 Endoplasmic reticulum protein Low 8.3 1 88-118 LTTGSGKKRKKIGARVAKKVRQRSKYYVPVT plas(17),E.R.(3),cyto(2),vacu(2),nucl(1),mito(1),golg(1),mito_nucl(1),cyto_pero(1) GKKRKKIGARVAKKVRQR (93-110, prob:0.971) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGB0 Uncharacterized protein Low 6 1 481-503 PKTSTGKIQKHELRKRFPRIGVQ cyto(10),mito(8),cyto_nucl(7.5),nucl(3),extr(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKZ2 TPR_REGION domain-containing protein Low 7.7 1 137-159 AGNMTGKRRKHNPRLEENQNGKL nucl(9),mito(7.5),cyto_mito(7.5),cyto(6.5),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLX7 Chromatin remodeling-related protein Low 7.1 1 44-63 DAIRRLKHPRPPLPPPHILE cyto(12.5),cyto_nucl(10.5),nucl(7.5),pero(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VPC0 Uncharacterized protein Low 6.5 1 1-21 MGCLGREKQKKEKVLPKSKFG mito(12),nucl(4),plas(4),cyto(2),E.R.(2),extr(1),pero(1),vacu(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W091 Uncharacterized protein Low 9.5 1 13-35 RQWAERSKWLKRNQKVTPQPLKP nucl(16.5),cyto_nucl(10.5),mito(6),cyto(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WAP9 Siderophore-iron transporter Low 5 1 43-67 FVLWSLPKRWRPKWLYKPSQPLIGW plas(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WH07 Uncharacterized protein Low 8 1 357-386 SARGRETQRGKSRSRSRRRHRAERERARAE plas(23),mito(2) RGRETQRGKSRSRSRRRHRAERERARAE (359-386, prob:0.992) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQV8 Uncharacterized protein Low 7.7 1 161-183 DEEGNPRTRRRRIEEKRYPEPCY cyto_nucl(12.5),cyto(11.5),nucl(10.5),pero(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W5P3 Uncharacterized protein Low 9.1 1 439-461 EGEGGDRKREKKHNLHWKYEDPA mito(18),cyto(4),nucl(3),cyto_pero(3) KR (446-447, prob:0.602) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W8Q9 Uncharacterized protein Low 7 1 168-189 EVENMRKPRLTRKQRRVEGVSE mito(16),nucl(5),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WYF4 Uncharacterized protein Low 5 1 31-52 LSRANRSFRREARWRLRPLEHF cysk(14),cyto(5),mito(3),cyto_nucl(3),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V600 Prefoldin subunit 3 Low 9.1 1 203-229 VNFARVHNWDVKRRREQKKHESVMGHK nucl(13),cyto(8.5),cyto_mito(6.5),mito(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VAG0 Host-pathogen interaction-related protein Low 5 1 23-45 AVRACARKSRGKQAQTQERKHVI mito(10),cyto(6.5),cyto_nucl(4.5),extr(3),pero(3),cysk(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHI1 Zn(2)-C6 fungal-type domain-containing protein Low 6.2 1 26-50 DVTPEGCGHCRRRRKQCSLQAIVGA mito(11.5),cyto_mito(9.5),cyto(6.5),nucl(4),plas(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VIJ4 Pseudouridylate synthase 4 Low 8 1 43-69 FVDPNQTRPKERNKRKKNATHMGLKIG cyto(13),mito(12) PKERNKRKK (51-59, prob:0.795) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRS0 Glycerophosphocholine acyltransferase 1 Low 8 1 21-42 LDLWERKLKESSKKLRQKAGSM plas(19),cyto(3.5),cyto_nucl(2.5),pero(2) SKKLRQK (32-38, prob:0.661) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUV7 Threonine ammonia-lyase Low 5 1 359-381 SPVSADKQKRARSPNPLARSRSR mito(23),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VYF6 Uncharacterized protein Low 8.9 1 345-372 LSEKELKKLEEKERKREIRKIQKRGGMG cyto(10.5),cyto_mito(10),mito(8.5),nucl(3),cysk(3) KRLAKKKAARAGLSEKELKKLEEKERKREIRKIQKRGGMGGGMGGGR (333-379, prob:0.995) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W9L6 Uncharacterized protein Low 8 1 179-198 AEPASKKVKRERRDTSPAPE cyto(10),mito(8),cyto_nucl(8) SKKVKRER (183-190, prob:0.707) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WGE4 Calcium ion transporter Low 9.2 1 818-848 MSAVPGRVKNKAKRVRRRIRIPRRKAPTDVE plas(22),nucl(3) GRVKNKAKRVRRRIRIPRRKA (823-843, prob:0.991) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VAJ1 Coronin Low 8 1 2-21 SRFVRPSKYRHTYANRSKVN mito(23),cyto(2) AAKKEEPKPEPKKEEVKKPEEPKPAPKKEEPKPEPKK (368-404, prob:0.992) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFX1 USP domain-containing protein Low 9.6 1 938-959 TREIMRMRTRRHELKNHKPMSI nucl(19),cyto_nucl(14.5),cyto(8) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHN8 Uncharacterized protein Low 8.7 1 91-112 SAKARVLHGRHHRQQRRSSLTL cyto(18),cyto_nucl(11.333),cyto_mito(11.333),nucl(3.5),mito(3.5) AKGPVKRSPRSEAGGTGKRRK (236-256, prob:0.85) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VI80 Uncharacterized protein Low 5.7 1 758-781 GMISFTPKTKSKKRTPPPSQFISM mito(22),nucl(2),cyto(2),cyto_nucl(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VM59 DH domain-containing protein Low 8.1 1 813-833 GTPPPSKSPSIRKARRDDVYT mito(15),nucl(8),cyto(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQ80 Uncharacterized protein Low 5.8 1 321-340 MSLWSRSRFHRTKRNPRLNS mito(9),cyto(7.5),cyto_nucl(5.5),plas(4),nucl(2.5),extr(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VU78 Uncharacterized protein Low 5.7 1 24-47 ISYVGGSLRRTRRRRPLVVLLLCG plas(9),vacu(4),mito(3),E.R.(3),golg(3),nucl(2),cyto(2),cyto_nucl(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VV15 Ubiquitin Low 9.2 1 131-167 KQICRKCYARLPPRATNCRKKKCGHTSQLRPKKKLKN mito(6),extr(6),nucl(4),cyto_mito(4),vacu(2),E.R.(2),pero(2),plas(2),cyto(2),cyto_pero(2) RPKKKLKN (160-167, prob:0.762) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W1T7 RF_PROK_I domain-containing protein Low 9.6 1 204-228 AAEKERRKEFKMKAKAKKGARRGDF mito(21),nucl(4) EKERRKEFKMKAKAKKGARRG (206-226, prob:0.988) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W9F5 Type II HSP40 co-chaperone, Sis1p Low 9.8 1 22-64 IKKAYRKESLKWHPDKNPGDKRALAEEKFKKDRRPGDRGNAHT cyto(14.5),cyto_nucl(11),nucl(6.5),mito(4) RKESLKWHPDKNPGDKRALAEEKFKKDRRPG (27-57, prob:0.821) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WKA7 Reverse transcriptase Low 9.7 1 1737-1763 AWPTLRDSYKPQRGKRESRARSQWLGW nucl(17.5),cyto_nucl(11.5),cyto(4.5),pero(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9P6 Uncharacterized protein Low 8.8 1 511-536 ISSRWQYSKLQESKRRRDVRAGPVPP cyto(8.5),mito(7),cyto_nucl(6),extr(4),nucl(2.5),plas(2) KRRRDVRAGPVPPGRDGPGIARERRH (524-549, prob:0.768) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VEI4 Protein kinase domain-containing protein Low 8.2 1 376-396 DYFSRRPQSARKRTPNDRFAS nucl(8),plas(6),cyto(5),mito(3),cyto_pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFY1 Uncharacterized protein Low 9.7 1 305-324 LVGRSRPDMLPPRPKRWRNE nucl(18),cyto_nucl(13.5),cyto(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHV7 RING-type domain-containing protein Low 9.3 2 86-106, 557-580 ESWLVYRHSRRYRPQPWLLAN, AELRRTMSRRRSQRSIRTIRSDRS plas(11),nucl(6),cyto(3),mito(2),extr(2),cyto_pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VM43 Uncharacterized protein Low 8.5 1 710-729 AALLRTFSRRGRRWWRNIVE nucl(13),cyto_nucl(10),mito(9),cyto(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VMC3 Uncharacterized protein Low 8.5 1 188-210 ADTNTPRIFRRRRRDSISIREFV nucl(12.5),cyto_nucl(12),cyto(8.5),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQU9 Phosphoribosylamidoimidazole-succinocarboxamide synthase Low 8 1 177-203 AGAAPTKKEPKAKKPQKSNKPPTEEEL mito(15.5),cyto_mito(12.666),mito_nucl(10.499),cyto(7.5),cyto_nucl(6.499) TKKEPKAKKPQKSNK (182-196, prob:0.906) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VS57 Uncharacterized protein Low 6.8 1 161-190 KSPLTRTTLSKRRKGYKKTIENKQGWTRLR mito(16),cyto_nucl(6.5),nucl(6),cyto(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTM4 Uncharacterized protein Low 8 1 59-86 VPKRKVTHSRKSMRSANKHPKNKTKHTT mito(12),extr(8),plas(3),E.R.(3) KRKVTHSRKSMRSANKHPKNKTK (61-83, prob:0.836) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VZN0 Signal recognition particle subunit SRP68 Low 7 1 26-45 GDNERYRHHCANKLHRLRQS mito(17),nucl(6.5),cyto_nucl(5.5),cyto(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W6H4 Uncharacterized protein Low 5 1 822-849 DYAREVRQMRAREKHRRMRDSTDDREDS plas(20),E.R.(3),vacu(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WD01 WD_REPEATS_REGION domain-containing protein Low 5.9 1 1009-1029 LWMSCRKCKHGGHQRCMRLYY mito(18),cyto(3.5),cyto_nucl(3.5),nucl(2.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WF37 Pyridoxal kinase Low 9.4 1 294-321 AVPLNPADPKRKAKRMRIREMRVVPERR cyto(16),nucl(4),mito(4),mito_nucl(4) PKRKAKRMRIR (302-312, prob:0.839) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WQC8 Actin Low 5 1 343-365 IPSTSRARPPRNVVERRQRHARA cysk(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V4N3 Long-chain-fatty-acid--CoA ligase Low 5.7 1 158-178 MIRGCKIKTWKRAPVHFRQFF mito(11),plas(5),E.R.(4),cyto(3),nucl(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFG1 Histone-lysine N-methyltransferase, H3 lysine-79 specific Low 9.8 1 72-99 AVSKSKTASPAPRKRRQSPQRVLPPSDS mito(18),nucl(5.5),cyto_nucl(4.5),cyto(2.5) APRKRR (82-87, prob:0.68) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VM41 F-box domain-containing protein Low 9.7 1 513-542 VKPTGPTKTTRNQPQKKRKHPKVVITELLE cyto(15.5),cyto_nucl(11.5),nucl(6.5),mito(4) KKRKH (528-532, prob:0.692) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VU19 Uncharacterized protein Low 9.4 1 18-50 SKTDSWAKSKVRSKAKRKARKRGKSVSASSERL mito(13),cyto(8.5),cyto_nucl(7),nucl(4.5) KSKVRSKAKRKARKRGK (25-41, prob:0.994) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W9J2 Retention-related protein Low 6.3 1 15-37 ETIRLPAQTRTHRKNPARASTRN cyto(9.5),cyto_nucl(8.333),cysk(8),cyto_mito(6.166),nucl(5),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WCR3 Beta-hexosaminidase Low 5 1 58-79 ERATERLKKLKHRYLSPTRGSE extr(21),mito(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WD88 PARP catalytic domain-containing protein Low 9.1 1 1-24 MSDSQPPAKRSKRSHQRNLTLDSS nucl(14.5),cyto_nucl(10.5),cyto(5.5),mito(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WKF9 WD_REPEATS_REGION domain-containing protein Low 9.6 1 465-489 SADMHDAPRQKKNKKNPMGDFGRSA cyto(10.5),cyto_nucl(9.833),cyto_pero(7.666),nucl(7),mito(4),pero(3.5) RSDRKGKEDRRAGGRGKR (130-147, prob:0.905) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WKY3 Beta strand repeat-containing protein Low 5 1 23-42 APSYRRTHPRFGKIIRPRAG extr(15),mito(8),cyto(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WLH2 Uncharacterized protein Low 5 1 621-645 DHPIRAKATQRRRDRKYRTARENLA mito(21),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WTZ1 Tubulin binding protein Low 9.7 1 154-174 TQSPNTLTRRQRNAQQNRALD cyto_nucl(11.166),nucl(10),mito_nucl(9.832),cyto_mito(9.332),cyto(9),mito(8) RGRRG (487-491, prob:0.647) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V2S0 ArAE_2 domain-containing protein Low 5 1 737-758 RSYVNPWRRRHQKQNFIYKQFL plas(20),mito(3),E.R.(2),cyto_mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V435 Ribosomal protein L1 Low 5.8 1 239-263 DMTSRKKTNCEYARRQRAKRDAAEH mito(23),nucl(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V707 PHD domain-containing protein Low 9.3 1 2-24 CPEGKKHKCTLNPPEKQPQPPNE nucl(16),cyto_nucl(13),cyto(8) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VIY6 Holocytochrome c-type synthase Low 6.9 1 495-514 VSFTNPKATNRPKQVPPFET pero(9),cyto_nucl(8),nucl(6.5),cyto(6.5),mito(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VL26 Uncharacterized protein Low 5.9 1 65-86 MRLPVSKSQHQRHEIRRRQLHN mito(10.5),cyto_mito(9),cyto(6.5),pero(4),nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQ01 Uncharacterized protein Low 5 1 120-139 TGSVRPSRTGSKRPHRTDSD extr(23),mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VYX9 Aldehyde reductase I (Alcohol dehydrogenase) Low 5 1 479-498 PNYPKWQKSRRLRVIVPLLF plas(21),mito(2),cyto(2),E.R.(2),cyto_mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W4Z5 Fungal_trans domain-containing protein Low 8.8 1 20-43 SGQATPAKRKFNWKNGPPSCKECV nucl(13.5),cyto_nucl(10),cyto(5.5),pero(4),mito(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WCP4 Ariadne-1 protein-like protein Low 9.2 1 43-71 SPTASPPPPTSKRPRKPDNTPPPIAKRTK mito(18),mito_nucl(12.333),cyto_mito(10.333),nucl(5.5) KRPRKP (54-59, prob:0.678) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WEW4 Uncharacterized protein Low 5 1 624-643 VMIQQKRREQRASRISRATR plas(13),extr(11),E.R.(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WGZ0 Uncharacterized protein Low 6.1 1 1-23 MPAVRKTKKTPKAAKPYVKTEQG mito(11.5),cyto_mito(10),cyto(7.5),nucl(4),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WND4 Uncharacterized protein Low 5 1 1-21 MSQSTFKRKAHKGFFTRCLQA mito(17),extr(4),E.R.(3),plas(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V1I0 Uncharacterized protein Low 7.4 2 29-54, 351-373 STESGARKRSSNRRSYKTQKLARSFG, DERSPSPERHTTRQRRLASRETG extr(18),plas(6),nucl(1),mito(1),pero(1),mito_nucl(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VBM2 F-box domain-containing protein Low 9.5 1 412-446 RVEKLKTKAKWKAIAKKPKTKTAKQKVKSAKASTT cyto(11.5),cyto_mito(9),mito(5.5),nucl(5),pero(3) KLKTKAKWKAIAKKPKTKTAKQKVKSAK (415-442, prob:0.987) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQ12 Phosphoglycerate mutase family protein Low 9.5 1 144-165 DKSPDRWKKFTRHIKKLNEEAD cyto(5.5),cyto_nucl(5.5),plas(5),nucl(4.5),mito(4),pero(2),golg(2),vacu(2) HGKKGKKDK (95-103, prob:0.769) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRM7 Uncharacterized protein Low 5 1 189-209 TTLQCNPKKKRHEPCGAPKEC extr(22),golg(2),mito(1),plas(1),vacu(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VS73 Uncharacterized protein Low 6.1 1 696-720 FHPHRSQRYHSRRIKFVRKVKAEKT mito(7),extr(6),cyto(5.5),cyto_nucl(5),nucl(3.5),plas(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUF9 Uncharacterized protein Low 9.1 1 173-197 ELGKGGLKPKRKHKLRWNRFKWILF plas(21),nucl(3),cyto(2),mito_nucl(2) KGGLKPKRKHKLRW (176-189, prob:0.915) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VY11 Pirin Low 8 1 334-359 AKGKGGKGGKGKKAKRGRRGDDSDDD cyto(12.5),cyto_nucl(8),mito(5),cysk(4),pero(3) GAKGKGGKGGKGKKAKRGRR (333-352, prob:0.997) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W3M9 Ubiquitin activating enzyme Low 7.4 2 19-41, 89-111 TTGLPKPKPKVRSSLPRPRTSST, AAGTSTPKTRPGKHVRQRSSLSA mito(9),cyto(7),pero(6),plas(2),nucl(1),cysk(1),vacu(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W8T9 Uncharacterized protein Low 9.4 1 232-271 SSGSSPEKSERRRRREKEEKDRQRLERRRRRAARAAKSEA plas(18),nucl(4),E.R.(2),mito(1),cyto(1),vacu(1),cyto_mito(1) EKSERRRRREKEEKDRQRLERRRRRAARAAK (238-268, prob:0.995) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WR56 ATP-dependent DNA helicase II subunit 2 Low 8.6 2 163-186, 609-633 EDNVDKSKPKPKRLSEKFWRVFIR, KDALDIKKVTRVQRKKRQIDIDELF cyto(15),cyto_nucl(12.166),cyto_mito(8.666),nucl(8),mito_nucl(5.166) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VCZ9 Polysaccharide lyase family 14 protein Low 8.7 1 40-75 RSYEHPHAAEPRRRRRHTKRKTTCKPKNNSSQAPAS extr(21),nucl(2),mito(2),mito_nucl(2) EPRRRRRHTKRK (49-60, prob:0.939) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFJ6 Uncharacterized protein Low 9.1 1 1022-1043 PPKLTLPKAKQMRKPSPQSGGK plas(21),nucl(3),cyto(1),E.R.(1),golg(1) SPKDRKEPLPK (954-964, prob:0.673) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VI02 Zn(2)-C6 fungal-type domain-containing protein Low 6.4 1 9-29 ALSQRRPGKSRLKSCNECVQA mito(16),nucl(4),cyto(2),plas(2),pero(2),cyto_pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQL3 GTP-binding protein Low 9.7 1 675-703 LETGVKVRNNGKKHFKEKRGKQRSGRGYD mito(16),cyto_nucl(6),nucl(5.5),cyto(5.5) RNNGKKHFKEKRGKQRSGR (682-700, prob:0.927) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VZH5 Defect at low temperature protein 1 Low 9.5 1 229-276 GGPPPPTNEEKKKSKKKRPAAEAADDGEKKPAKKKKAAPKKHLAEQRQ plas(13),mito(6),nucl(4),cyto(3) GGGPPPPTNEEKKKSKKKRPAAEAADDGEKKPAKKKKAAPKKH (228-270, prob:0.997) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W4X6 Alpha-1,4 glucan phosphorylase Low 6.1 1 35-55 LLHVQRSQRHRPLVQRRCCSD cyto(12.5),cyto_mito(9),pero(5),mito(4.5),nucl(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W7D6 TPR_REGION domain-containing protein Low 5 1 1-21 MVKVKKGKTKRSAPTNSAPES mito(24),cyto_nucl(2.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W7W7 DNA recombination and repair protein Rad54B Low 6.1 1 768-791 CDSHDTYKCKRCRDGKQFVKAPAM mito(17.5),cyto_mito(11.333),cyto_nucl(4.833),nucl(4.5),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGP7 ATP-binding cassette (ABC) transporter Low 9.5 1 262-287 ERAEREERERREKRDREERERKANGD cyto(12.5),cyto_nucl(9.5),nucl(5.5),mito(3),pero(2),E.R.(1),golg(1),cysk(1),vacu(1) REERERREKRDREERERKANGDAKPGKDKKK (266-296, prob:0.988) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTE9 Hexose transporter Low 5 1 9-31 SLPNNTHRHWWRDKSLRQNVLHC plas(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTS3 Cyclohydrolase Low 9.1 1 35-54 DGPNPNKKKGLPRRDQPLDS nucl(11),cyto(9),mito(4),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUA3 Dynactin subunit 6 Low 7.7 2 4-29, 217-239 ASSRAQSLSPRKRPTRASKTHLTQAG, LREIMPKQQKRDTRPPPPASTPQ mito(23),nucl(2),cyto(2),cyto_nucl(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W0P3 Adenosine kinase Low 8 1 29-54 NFYYNRERRTWIRRPKRDPHIVDRGW nucl(11.5),cyto_nucl(11.5),cyto(10.5),pero(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W2T0 Cytosolic small ribosomal subunit protein Low 7.4 1 155-178 DFYTSQPAKTPKKKNNEPQPLWAN nucl(8),cyto(8),cyto_nucl(8),mito(5),cyto_pero(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W6M2 Xylosylphosphotransferase Low 6.2 1 744-765 SMVNQWFHKKWPRPAIWERAWS mito(7),extr(6),nucl(3),cyto(3),plas(3),cyto_nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W9E0 Uncharacterized protein Low 8.8 1 547-566 DEDRQARRANPRRDRGAVRV cyto(13),nucl(10),cysk(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V351 Homogentisate 1,2-dioxygenase Low 7.2 1 66-86 FTAPRAKNKRSWLYRVRPSVV cyto_nucl(9.833),nucl(9),cyto(8.5),cyto_pero(6.666),mito(4),pero(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V8X0 Regulation of translational elongation-related protein Low 6.3 1 218-244 IEARQSPNPRKAWRVRHKVNIRVWRVL plas(11),cyto(9),cyto_nucl(7.5),nucl(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUA8 Uncharacterized protein Low 8.8 1 203-222 IVNARPCIKQHKRQPHCPDT nucl(14.5),cyto_nucl(12),cyto(6.5),mito(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VVB1 Uncharacterized protein Low 8 1 1606-1625 PYELLRKKGRFYKLCKATGK plas(22),E.R.(5) ERRKNAKK (1640-1647, prob:0.784) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VZL7 Hemerythrin domain-containing protein Low 5 1 46-65 SSASSRPRTRPERHRSLYAR extr(9),cyto(3.5),mito(3),cyto_nucl(3),pero(3),E.R.(3),plas(2),golg(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VZS9 DUF1996 domain-containing protein Low 8 1 684-716 SASAAPQKTGKKGKKCRAGAKKHRRSRLRLASH extr(27) KTGKKGKKCRAGAKKHRRSRLRL (691-713, prob:0.988) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W1C5 Uncharacterized protein Low 9.2 1 216-247 LDLLLTRKSPKRKTRRHKTKKHHSHSHSSTSS plas(16),E.R.(4),nucl(3),vacu(2) RKSPKRKTRRHKTKKH (222-237, prob:0.98) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W3C6 Uncharacterized protein Low 8.8 1 828-852 RIASRKSLAPQRKLQKRPSLPVARM nucl(12),cyto(8),extr(6),mito_nucl(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WS44 Chloride channel protein Low 5 1 415-434 KESTRVRRLRTRARRSLRGA plas(23),mito(2),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V5K7 Uncharacterized protein Low 6.9 1 205-229 LILGCCWWRNRKQKQRTRGHTQNIS extr(11),nucl(5),mito(4),cyto_nucl(4),cyto(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9B6 Fungal_trans domain-containing protein Low 6 1 9-41 SVSCAECKRSKLRCERDRDKKDWPCKHLCPEGI mito(11),plas(9),nucl(3),cyto(3),cyto_nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRU2 Glutamate decarboxylase Low 6.6 1 543-568 SQATKSPPHATRPRRTENHKDHEKIS cyto(11.5),cysk(8),cyto_pero(7.5),nucl(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VSY8 Uncharacterized protein Low 8.7 1 174-196 REENLDQKRRQRRQLTHKAEQAE mito(14),nucl(10),cyto(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VT51 Uncharacterized protein Low 5 1 32-55 GVWHRLSARRPKRANIPSRQPLDR extr(20),mito(2),golg(2),plas(1),pero(1),E.R.(1),cyto_mito(1),mito_nucl(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VZN7 Uncharacterized protein Low 5.7 1 137-161 QLARTRLELKRRQERERRERERMLP mito(20),nucl(2),E.R.(2),cyto(1),extr(1),pero(1),cyto_pero(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W638 Uncharacterized protein Low 5 1 109-129 HHYVLKRLRRRLPPLSSRRKL plas(23),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WID8 Uncharacterized protein Low 9.9 1 98-119 SLPKSRCGRGRRQRHGPRAPQL nucl(17.5),cyto_nucl(10),mito(8) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V0D0 Uncharacterized protein Low 6 1 37-63 RNSAEFRKGLKKQQKKVKQQQEAAAKH mito(12),cyto_mito(10.333),mito_nucl(8.833),cyto(7.5),nucl(4.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VEB5 Uncharacterized protein Low 6.8 1 106-125 VDEERKKRYRGRHTERVQVP cyto(13.5),cyto_nucl(10.5),nucl(6.5),pero(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VN01 Uncharacterized protein Low 9.5 1 196-215 FSNWTVRKRNSMRKRSADDF nucl(16.5),cyto_nucl(10.5),mito(6),cyto(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W112 Pex24p domain-containing protein Low 5 1 472-498 TVLPVVSKRTTRQRRWWRRVYFDPVEA plas(19),E.R.(3),mito(2),cyto(2),cyto_mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VEH4 UDP-N-acetylglucosamine transferase subunit ALG14 Low 8 1 16-44 LAVRLYQVLPRRNRPRRKDSDKRPTRSLA extr(13),plas(10),E.R.(2),vacu(2) RRNRPRRKDSDKR (26-38, prob:0.807) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKJ8 Streptomycin biosynthesis protein StrI Low 5.8 1 39-58 ADPREARRKIFQRQHHLEDD cyto(21),cyto_nucl(13),nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VMN2 Uncharacterized protein Low 5.7 1 466-491 KASGGLGKFTRRRRWQRRAVCTETVH plas(17),E.R.(3),nucl(2),mito(2),extr(2),mito_nucl(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUD4 Uncharacterized protein Low 5 1 185-204 FWIWRLRKRLRANRRNSYAN extr(15),plas(3),mito(2),cyto(2),pero(2),golg(2),cyto_mito(2),cyto_pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUV9 Urease Low 5 1 98-120 LPLPSKDKFPKVKPQAERDRPGA cyto(23),cyto_nucl(13.833),cyto_pero(12.333) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VW47 F-box domain-containing protein Low 7.2 1 455-481 NPTERISLRHKRSTMKRTKPNKYTWNH mito(9),cyto(8.5),cyto_nucl(8.5),nucl(7.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WAP3 Uncharacterized protein Low 5 1 185-204 QPLGKCRQPSVRRAHRPWLY plas(18),extr(6),mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WDY0 HMG box domain-containing protein Low 6.5 1 270-295 LTDAQKEEYKKKNREMREKYDAWKKE mito(17),nucl(4.5),cyto_nucl(4.5),cyto(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WRJ5 Uncharacterized protein Low 9.4 1 103-126 SSLATNRGKRARRLRFRVERTTTP cyto(17.5),cyto_nucl(12),nucl(5.5),mito(3) RAR (112-114, prob:0.606) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VBW8 Uncharacterized protein Low 6.1 1 100-119 QTMTKQTRARQKQQSKSQPP mito(18),nucl(3),cyto(3),cyto_nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VF63 SH3 domain-containing protein Low 6.5 1 240-260 ATSFLRRRSRQRRTLNAQSMF extr(10),mito(5),nucl(4.5),cyto_nucl(4.5),cyto(3.5),plas(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFJ0 Protein required for pre-rRNA processing and 40S ribosomal subunit synthesis, Enp1p Low 6.8 1 22-44 DESLRKFGRAKNRKSKVEQEEVE cyto(13.5),cyto_nucl(11.5),nucl(6.5),mito(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJA4 Origin recognition complex subunit 4 Low 6.9 1 18-42 SASKSPLKTPKDKTPSKRLNPLGAA mito(11),nucl(5),cyto(4),plas(4),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VM00 Uncharacterized protein Low 5 1 450-470 VEAIVKRRWRSVRKTLPLPET plas(18),E.R.(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VSB4 2'-phosphotransferase Low 9.6 1 75-100 VWGYDPSPPKPKKRSQPKKTKTAAIA cyto(10.5),cyto_nucl(9.333),mito(8.5),mito_nucl(8.333),nucl(7) PKPKKRSQPKKTK (83-95, prob:0.891) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUF1 XPG_I_2 domain-containing protein Low 9.5 1 659-693 DLPSAPAETKKSRKKNKNRNKKAAEPKKGGKDNGP mito(17),cyto(5),nucl(4) KKSRKKNKNRNKKAAEPKKGGK (668-689, prob:0.995) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VY88 Uncharacterized protein Low 5 1 239-263 LHNFMSCKCLRRRKNKTPEDALPTS plas(21),E.R.(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W005 Uncharacterized protein Low 8.6 1 254-275 KAEKLERLERDKQKRWAPKILA nucl(12.5),cyto_nucl(10),cyto(6.5),mito(4),plas(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WJK3 Cellulase domain-containing protein Low 6.6 1 366-387 LYPPMWRAHKHLFRRVRNCLLG cyto(12.5),cyto_nucl(9.5),pero(6),nucl(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WNB7 FAD-binding FR-type domain-containing protein Low 8 1 825-849 AAEGRVRRARSRKMKQMQRNMQLQP plas(20),E.R.(5) GRVRRARSRKMK (828-839, prob:0.803) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V018 Uncharacterized protein Low 6.8 1 25-48 YLIGRRVSRSWKRRADHRLRTEEN cyto(10.5),cyto_pero(8),nucl(7),pero(4.5),cysk(4),mito_nucl(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VAJ9 Uncharacterized protein Low 8.9 1 207-236 GKDKSDQPDKKKDKKTKKDKAKHADKTDTA mito(16.5),cyto_mito(11.333),cyto(5),cyto_nucl(4.833),nucl(3.5) DKKKDKKTKKDKAKH (215-229, prob:0.963) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGN7 Nucleus protein Low 9.2 1 11-39 GPRQMRNCLPCKQRKIKCGPCALRKDVKS plas(18),nucl(3),mito(2),E.R.(2) SKKRRLSGH (607-615, prob:0.729) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VL53 Rho GTPase Low 5 1 224-243 ADRPAAGQQRKPKKKVCTIL mito(22),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRC8 RING-type domain-containing protein Low 8 1 439-466 ATSPPHRRTGKQRRKSKRYYSKDECAIC extr(11),mito(7),plas(5),cyto(2) HRRTGKQRRKSKR (444-456, prob:0.837) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VT02 BTB domain-containing protein Low 8.4 1 291-311 GMGVHVTRKPKRARQLWKVEG nucl(11.5),cyto_nucl(9),mito(8),cyto(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTC9 Uncharacterized protein Low 5 1 469-488 LSRLQKIIRNKVQKLRRQEE mito(23.5),cyto_mito(13.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTK0 MFS domain-containing protein Low 5 1 517-538 LYERRIPAWRWNKTRTKVEDQL plas(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTU2 Prolyl-tRNA synthetase Low 5 1 748-768 ENQKCVQCDKKAKRWALFGRS mito(14.5),cyto_mito(14),cyto(10.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W0A7 Uncharacterized protein Low 8.7 1 409-436 AEHYFPAPRRRLTKRQRHRRRSSLCILM mito(22),nucl(2),cyto(2),cyto_nucl(2) PRRRLTKRQRHRRR (416-429, prob:0.867) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WCN4 Uncharacterized protein Low 8.7 1 528-550 SGEAVVRPTKRRRPSGPRRVGAS plas(12),extr(9),nucl(2),cyto(2),cyto_nucl(2) RPTKRRRPSGPRR (534-546, prob:0.84) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WRZ2 Uncharacterized protein Low 8.5 1 126-150 RYQFRFESPKNRHRRRPSLIHPDAR nucl(12),mito(11),cyto_nucl(8.5),cyto(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VEZ9 Pre-mRNA-splicing factor CLF1 Low 7.7 1 609-633 DRARVAELKPQTRKRWRTEENGELG nucl(11.5),cyto_nucl(9.333),mito(8.5),cyto_mito(7.833),cyto(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VM29 Vacuolar membrane protein Low 5 1 44-67 IGSLVVKRHLEKRKRPWRVWALDV plas(23),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VMB1 Uncharacterized protein Low 6.3 1 11-34 QPLNLKPVSPPPRRPKPALQGWKS mito(15),cyto(7),nucl(4),cyto_pero(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VVQ6 Eukaryotic translation initiation factor 2C 2 Low 9.5 1 743-762 EHLRTFQKHNRDPPKRIIFF cyto(11),cyto_nucl(9.333),cyto_pero(8.333),nucl(6.5),pero(4.5),mito(4) GGGGGRGGRGGPRGGRGGRGGGRGGP (309-334, prob:0.971) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VYI0 Nucleus protein Low 5.9 1 12-40 VIKISCVECRRLKRKCKRYDKTCVFPEAE cyto(9.5),cysk(8),cyto_mito(7),mito(3.5),nucl(3),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VZW6 Uncharacterized protein Low 5.7 1 234-257 VPKEDTKSTKKSKKPLGQPTTKTE mito(17),cyto(3),extr(3),nucl(2),cyto_pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W6C2 Uncharacterized protein Low 5.9 1 14-33 SAERRTPSKLHKPDTPCRCE cyto(10),cyto_nucl(7.5),extr(6),mito(4),nucl(3),pero(2),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W9A2 Peroxidase Low 5 1 274-297 LDKGQKWHFKKWKGPQQFENNDKQ mito(25.5),cyto_mito(14) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WEF1 Uncharacterized protein Low 9.5 1 25-54 MPASRLRTTKHRLRGTKNRRPRKDNAAVVF mito(17),nucl(4.5),cyto_nucl(4.5),cyto(3.5) TKHRLRGTKNRRPRK (33-47, prob:0.863) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WSK0 Integral membrane protein Low 8.7 1 1104-1135 EEARRKKKILGIFPRRKKKTKRRGSDDSGSTM plas(17),mito(4),nucl(2),cyto(1),E.R.(1),golg(1),vacu(1) RRKKKILGIFPRRKKKTKRRG (1107-1127, prob:0.995) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V7B5 Mediator complex subunit 12 Low 9.5 1 15-35 HPTHSSKTTTRRRSNGAHTTD mito(16),cyto(6),nucl(4) PRTAAAAGKTTRASTADKAPRKAAPAKKAPAKAPAKAPAKTTAAKSKTTATAKRRRSGG (1593-1651, prob:0.996) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFK6 Chitin synthase Low 5 1 210-232 YGPLPTRQIRRNKTQKRVQLFKG plas(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRJ6 Post-GPI attachment to proteins factor 3 Low 5 1 277-296 GPNWNPHKSKRPKGAFTPAI plas(23),mito(2),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUS5 Fe2OG dioxygenase domain-containing protein Low 8.8 1 1-22 MGKRAEQAKKRKRQNVAASVAP mito(19),cyto(5),nucl(2) AKKRKR (8-13, prob:0.761) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W7Q9 CnHHK4 Low 8.9 1 8-38 ESSTNNHRPRPQPTPHQHRARRRHEEEDEED nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W8R0 Uncharacterized protein Low 9.2 1 30-49 TSEPRHKKIKVAKQQKEVVD mito(14),cyto(9),nucl(3) R (467-467, prob:0.6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WSU2 AB hydrolase-1 domain-containing protein Low 8 1 4-34 AFREHHPHPHKSPSPKPKERPSSPRIKPWLL mito(18),cyto(5.5),cyto_nucl(3.5),extr(1),pero(1),E.R.(1) PHKSPSPKPKERPSSPR (12-28, prob:0.808) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V2X3 Uncharacterized protein Low 6.4 1 432-454 ASNDARTDWRPPRWIRKRLNLDQ mito(9),plas(7),nucl(4),cyto(2),extr(2),pero(2),cyto_pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V472 Uncharacterized protein Low 5 1 271-290 VGIWLCTRRRQRVKEEKEDF plas(10),mito(6),extr(5),E.R.(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VD88 Aa_trans domain-containing protein Low 5 1 547-569 DSWRDLSRWKRGFKKYWYAKIFL plas(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VDE2 Septin ring protein Low 6.2 1 1-21 MPISLRRRTRRPSPEPAPAPS mito(19),cyto(4),nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGQ5 Uncharacterized protein Low 8.7 1 157-178 DTPTSLKAERQQRKQANQPAEH nucl(14),cyto_nucl(10.5),mito(8),cyto(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VNL3 Protein phosphatase Low 8.4 1 132-156 LISPPSRRGRRTPSRRTRFPPQLTN mito(22),pero(2),nucl(1),cyto(1),plas(1),cyto_nucl(1) RPKIRLISPPSRRGRRTPSRRT (127-148, prob:0.89) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VVG0 Uncharacterized protein Low 9.9 1 390-409 DFQVPKHTRYHPRNNPHPGS nucl(16.5),cyto_nucl(10.5),mito(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VX80 Uncharacterized protein Low 5.7 1 36-57 VLWRGPNRRLWWWKKNDPDMPE extr(17),plas(4),nucl(2),mito(2),mito_nucl(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W8N5 CBF domain-containing protein Low 8 1 231-255 ANPSSAKKAKSKKGKKGKKEVDALP cyto(12.5),mito(8),cyto_nucl(7),pero(3) SSAKKAKSKKGKKGKK (234-249, prob:0.993) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WAV8 Rho GTPase activator Low 9.8 1 1083-1107 RKNQWWNKIFKNNGKKDQKKKGIFG nucl(13),mito(6),cyto(5),plas(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WE99 Uncharacterized protein Low 8 1 682-708 GRARDAFEKDRREKRSKRLEGIDVPKG mito(23),cyto(2),extr(2) KDRREKRSKR (690-699, prob:0.759) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WF98 Aa_trans domain-containing protein Low 5 1 528-552 RTDTWKQASRWKRGFRKYWYVKIAL plas(21),E.R.(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WWY1 Lipid particle protein Low 5 1 431-452 WTDANWLKRRKTKMFRFTPTQV plas(12),mito(5),cyto(5),cyto_mito(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V1B8 Aspartate transaminase Low 9.9 1 202-224 RTYYEDGKLKRRRNRTVLSCTEC nucl(18.5),cyto_nucl(13),cyto(6.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V1G0 RNA polymerase I transcription factor Low 7.5 1 758-780 LPEGRLRIKTKARQMPKENSSWH mito(13),nucl(7.5),cyto_nucl(6),cyto(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V4B9 ARF GTPase activator Low 7.2 1 381-406 ASGQTKKEAAKQAKDEKKKDNWDDDD cyto_nucl(9.833),nucl(9),cyto(8.5),cyto_mito(7.666),mito(5.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VAL3 Uncharacterized protein Low 8 1 687-714 QAKQDRAGRKEKKEKAKKARKGDKSGAT plas(25) DRAGRKEKKEKAKKARKGDKSGATTPAPAKTPKK (691-724, prob:0.997) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VIF5 Chitin synthase Low 8 1 10-31 VSFEEKPPTPRRQSNRTGAPPP plas(24),cyto(1),golg(1),vacu(1) IRRKASRAA (156-164, prob:0.695) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJL2 DNA-(apurinic or apyrimidinic site) endonuclease Low 8.1 2 572-596, 615-635 SEIFAKKVPPKCKVHGRPCKDFIVK, GYDMGRSKRPREQVNPEYRCD mito(15.5),cyto_mito(11),cyto(5.5),nucl(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VMD9 Cellular response to glucose starvation-related protein Low 9.2 1 350-371 IPQEEGRRSRRTRERERELEEA nucl(15.5),cyto_nucl(13),cyto(5.5),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WD31 Uncharacterized protein Low 6.7 1 551-574 AKQSTLRRDQSIKRRKPVPSFEPL cyto(9.5),cyto_nucl(8),nucl(5.5),mito(5),plas(3),extr(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WK66 Eukaryotic translation initiation factor 3 subunit G Low 8.1 1 37-61 LNDAGKKVKVTRRVRRKLQTQVVSH nucl(10.5),cyto_nucl(9),cyto(6.5),pero(6),mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WRQ3 Transcriptional adapter 2 Low 8 1 529-551 LRENERRKGLLKRRDARKMMKID mito(14),cyto_mito(13),cyto(10) RRKGLLKRRDARK (534-546, prob:0.783) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WWA7 Uncharacterized protein Low 5 1 384-403 LLLWCCCRRRQKSRPSSIVT extr(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V182 60s ribosomal protein l21-a Low 8.6 1 4-26 SFGTRARTRHMFKRQFRQHGAPS mito(10),nucl(9),cyto(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGV2 PCI domain-containing protein Low 7.2 1 413-434 QGPITNTRPRRRQEQPAQTENN cyto(17.5),cyto_nucl(13.5),nucl(8.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKI5 Calcium-transporting ATPase 3 Low 8 1 937-962 ASEAYKWAKRKFMRRHPKRDAEEGAA plas(18),E.R.(4),mito(3) KRKFMRRHPKR (945-955, prob:0.78) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VN67 S5A_REDUCTASE domain-containing protein Low 5.8 1 230-256 FMGTWAKGKYRRYKKEQDPKVFPGRRW cyto(18.5),cyto_pero(11.5),pero(3.5),nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VSV1 Mitotic spindle checkpoint-related protein Low 9.8 1 126-145 MPGAPKIKPKKKTEKEVQGE cysk(9),cyto(6.5),cyto_mito(6.5),nucl(6),mito(5.5) KIKPKKK (131-137, prob:0.746) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTJ3 Fungal_trans domain-containing protein Low 9 1 3-38 STPDSQAAPVKKRKRTSQACRPCRAKKTKVSTSYLP nucl(10),plas(8),mito(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUY9 SIS domain-containing protein Low 5.4 1 20-43 LGGRGISRARRARQQKPLERVGPF cyto(15),mito(9),nucl(1),extr(1),E.R.(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VXA8 Serine/threonine-protein phosphatase Low 8 1 486-518 WQVVPQLGKREGRRRRKRMPRVRKAREVERAEG cyto(12),cysk(7),cyto_pero(7) GKREGRRRRKRMPRVRKAR (493-511, prob:0.996) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WH86 Uncharacterized protein Low 8.5 1 485-509 LVKEIRAWKARKKAKKAQTEPAAAS cyto(12.5),mito(9),cyto_nucl(7.5),pero(2),nucl(1.5) RAWKARKKAKK (490-500, prob:0.883) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WV87 Uncharacterized protein Low 8 1 295-316 SAVTGTSAAKKRKNKKKKAAAH plas(19),mito(4),E.R.(3) AKKRKNKKKKAAAH (303-316, prob:0.988) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9B4 MFS domain-containing protein Low 7 2 30-50, 142-162 EQYHIDPKKERKLLRKLDLAI, EQYHIDPKKERKLLRKLDLAI plas(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFT1 Mtf2 domain-containing protein Low 8 1 60-86 APPTPTQSSRRPPQKKFGRRSGPTHAE mito(20.5),cyto_mito(13),cyto(4.5) RPPQKKFGRRS (70-80, prob:0.703) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VR35 Uncharacterized protein Low 6.6 1 102-121 GTVDRGKSNRFRRNPSQSNP mito(17),cyto_nucl(6.5),nucl(5.5),cyto(4.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W5E6 RNA helicase Low 6.9 1 19-38 GTWPDHNRGRRQISRPYQVE mito(10),cyto(8),cyto_nucl(8),nucl(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W8Y6 Uncharacterized protein Low 8.8 1 32-51 EDPVEKLKPKNKARNFVIEA nucl(15),cyto_nucl(12),mito(7),cyto(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WEV0 Uncharacterized protein Low 5 1 1-22 MDAHRPLRRRPLRFPSFRIRFL extr(9),mito(8),plas(5),cyto(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WVH9 Mediator of RNA polymerase II transcription subunit 5 Low 6.5 1 888-912 IAYQSTRPVNQPKTKRMPKGLGPGA cyto(8.5),mito(7),cyto_nucl(7),nucl(4.5),extr(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V7C0 F-box domain-containing protein Low 9 1 349-373 RAGANVKSSKKSKRKSGEDENIWEG extr(8),cyto(7.5),cyto_mito(5.5),nucl(3),pero(3),mito(2.5) KKSKR (358-362, prob:0.658) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9C3 Uncharacterized protein Low 8.1 1 284-310 NEQYPPRVPCRPGKQRRGPFPNLVRHM nucl(11),cyto_nucl(9),mito(6),cyto(5),pero(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VC59 Uncharacterized protein Low 5 1 476-501 INLGCMQWYYKRQNKRRDKEFAESGM plas(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VD46 Uncharacterized protein Low 8.5 1 27-47 TLPPSPRPGRRTVRRKGTVSP nucl(12),mito(11),cyto_nucl(8.5),cyto(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VDG2 C2H2-type domain-containing protein Low 9.1 1 22-41 REGKRHTREHARPNSSSRRR nucl(15.5),cyto_nucl(13),cyto(9.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VDW5 F-box domain-containing protein Low 8.4 1 51-70 ASVCREWRNKLRPRLFNHVA nucl(12.5),cyto_nucl(12.5),cyto(9.5),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VE21 Uncharacterized protein Low 7.4 1 202-222 GQQGHGHPPTKSKKHKKCVVL mito(11),cyto(8),nucl(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VEB6 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Low 8 1 46-65 GKGGGFKKRTEQKARPQGEA cysk(11),cyto(7),mito(5),cyto_nucl(5) GAKRQKTGKGGGFKKRTEQKAR (39-60, prob:0.898) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFC0 Dihydroxy-acid dehydratase Low 8 1 711-738 LEEWRQAKVKGRGRKGTRPKRGYAQLYH mito(18),cyto(7) AKVKGRGRKGTRPKR (717-731, prob:0.934) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHS0 Uncharacterized protein Low 8 1 387-412 LEPPKPVPKGERRKPRAPPKLENVSK plas(13),mito(9),E.R.(3) KPGSPPFRPLEPPKPVPKGERRKPRAPPK (378-406, prob:0.978) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKR6 PPM-type phosphatase domain-containing protein Low 5 1 389-413 EDTTEPRREYRRRQARMYNGRMQRQ mito(23),cyto(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLN8 Uncharacterized protein Low 7.6 1 639-661 EPRSRNCTKFTRRTKHSGTQYSK cyto_nucl(10),nucl(9.5),cyto(9.5),extr(4),mito(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VM86 PseudoU_synth_2 domain-containing protein Low 8.8 1 416-440 GEESEKDKRKRAKIPHPSVNNNLKR mito(15.5),cyto_mito(11.5),cyto(6.5),nucl(3) DKRKRAKIP (422-430, prob:0.786) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTC8 J domain-containing protein Low 7.6 1 418-437 FYVLPKKQRDVKNRIKELRE cyto_nucl(9),nucl(8.5),cyto(8.5),pero(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W8H1 PH domain-containing protein Low 9.7 1 32-51 KSNVRDTPTRKPTRPPVPIP nucl(18.5),cyto_nucl(13),cyto(4.5),mito(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V2S7 Aurora kinase Low 9.2 1 452-474 VLEHPWIKRYEKRSRASRPDREQ mito(21),nucl(3.5),cyto_nucl(3.5) ERERERDGKEHKEHKEPKGDKGDKEKEREK (129-158, prob:0.943) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWA4 Uncharacterized protein Low 8 1 50-76 DDGERRGPNGKKCRPKKGKGSHGAHAG extr(27) RAAHRAFARRGDDGERRGPNGKKCRPKKGKGSH (39-71, prob:0.97) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWC9 LisH domain-containing protein Low 8.5 1 810-835 RPPDGRGSTPPDRKRQRRNSGSAAAS nucl(15),cyto_nucl(11.833),cyto(6.5),cyto_mito(5.666),mito(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VYQ9 Uncharacterized protein Low 9.2 1 42-70 VDVKAEPSPTKSRKRKRRDENDSKEPPPP mito(22),nucl(3) TKSRKRKRRDENDSKEPPPPKREARY (51-76, prob:0.972) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WML5 ANK_REP_REGION domain-containing protein Low 8 1 11-41 KSDKDKPKEVPAKPTKKSKTINKVARNGTAT plas(22),E.R.(3) KDKPKEVPAKPTKKSKTI (14-31, prob:0.819) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WVL8 Uncharacterized protein Low 6.9 1 231-252 TVPPSHTTYRQHRKDRRDGLAS mito(17),nucl(5),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V7J6 Nicotinamide mononucleotide permease Low 5 1 459-479 LTTLCFRQYLKRQNAKLDRGE plas(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V8N3 Apolipoprotein A1/A4/E Low 9.7 1 310-332 GRSAKGSKEKKEKKTKEVPKGGI mito(20),nucl(5),cyto_nucl(4.5) RSAKGSKEKKEKKTKEVPKG (311-330, prob:0.945) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VAJ0 Uncharacterized protein Low 8.5 1 7-28 GSSLFTRKPRSLNRDRKMDKLP nucl(11.5),mito(11),cyto_nucl(7.5),cyto(2.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VCE8 Fibronectin type-III domain-containing protein Low 8 1 405-428 CLRADPVRRQRRRGAHRPRPCVLP extr(27) RRQRRRGAHRP (412-422, prob:0.753) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFI2 Protein arginine N-methyltransferase Low 9.7 1 233-260 AADAARKPERQRRAKRHRSGRRAHRADD cyto(7.5),mito(7),cyto_nucl(7),nucl(5.5),plas(2),extr(2),pero(2) ARKPERQRRAKRHRSGRRAHR (237-257, prob:0.987) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VG95 Cellular response to glucose starvation-related protein Low 9.4 1 32-53 IPQGEGRRSRRTRERERELEEM nucl(17),cyto_nucl(11.5),mito(6),cyto(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VMF4 Uncharacterized protein Low 8 1 171-190 AESKKQAKLRARMERGDKRV mito(15),plas(9),E.R.(2) QAKLRARM (176-183, prob:0.645) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRP9 Uncharacterized protein Low 5 1 109-128 YTPSSRRRSRHQGGGKNCDR extr(8),mito(6),cyto(4.5),plas(4),cyto_nucl(3),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VV24 Retrograde transport Low 9.4 1 348-372 MVLPGQQKRPPPRRLDERKAAKLLA mito(17.5),cyto_mito(10.5),nucl(5),cyto(2.5) PPRR (358-361, prob:0.629) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W6Y6 Capsular associated protein Low 6.9 1 79-99 EEPYDKLRKKNRFVPGQKAWI mito(8),cyto(7.5),cyto_nucl(7.5),nucl(6.5),plas(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WCY1 Sodium-potassium ATPase Low 5 1 1293-1312 ELGVKFKKRPEEGRMRHIAF plas(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WNX6 Transcriptional regulatory protein Low 9.6 1 75-99 TPRDCPPLPPSSRRRRNARALTALA nucl(12),cyto(7),mito(5),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WQ80 ARF guanyl-nucleotide exchange factor Low 9.8 1 38-58 VTPTRKDQRRTATLSRQPQPA nucl(14),cyto(7),mito(4),cyto_pero(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VE61 Uncharacterized protein Low 8.3 1 53-73 GNALSERGRRRRQEREHLGTT nucl(11.5),cyto_nucl(9.5),pero(7),cyto(6.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VEG3 CTP synthase Low 7 1 530-549 INALRRVQRRQDKLRRNLST mito(8),nucl(6.5),cyto_nucl(6),cyto(4.5),plas(4),extr(1),pero(1),E.R.(1),vacu(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VG05 Rho small monomeric GTPase Low 5 1 366-390 GVGESKREREYKRREKEDRGVGKCC mito(20),cyto(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VM74 RING-type domain-containing protein Low 7 2 60-79, 225-244 AYTWKVRKVREQQRRWLQQL, GPESHVKRRLLRKQGPVTAP plas(13),extr(6),E.R.(4),mito(2),vacu(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VX63 ABC transporter Low 5 1 1829-1852 PASDERPTYRPKGRRPNVDHVVCV plas(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VYA2 Uncharacterized protein Low 8.7 1 9-31 EPYHSVAKCNRHWKTKREFVTKA nucl(12.5),cyto_nucl(9),mito(8),cyto(4.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WIM8 Uncharacterized protein Low 8.8 1 270-289 HTPLSAKGTQRKGRKRTSYS nucl(13.5),cyto_nucl(11),cyto(7.5),mito(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WU42 Uncharacterized protein Low 6.5 1 9-35 SVSCAECKRSKLKCERERDKSEASRRA plas(11),mito(9),nucl(4),cyto(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VCI8 ATP-dependent Zn protease Low 5 1 379-398 GLSNRPSRFDRKYQRRDYAV extr(6),plas(5),E.R.(4),golg(4),mito(3),cyto(2),mito_nucl(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VEU4 Translation factor GUF1, mitochondrial Low 9.3 1 8-29 AAAKTAKDKKDKEPAKKIDMSQ cyto(12.5),mito(9),cyto_nucl(9),nucl(4.5) RKLKHLNKQKEGKKRLKK (576-593, prob:0.926) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFJ5 DNA_LIGASE_A3 domain-containing protein Low 8.7 1 2-21 GDPPMSKRRDQKEKTISYTP nucl(12.5),cyto_nucl(9),mito(8),cyto(4.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VI32 Uncharacterized protein Low 9.7 1 164-186 EPMSMDRRNKKEQQREAREKADR nucl(17.5),cyto_nucl(12),mito(4),cyto(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VQC7 Leukotriene-A(4) hydrolase Low 9.8 1 1-20 MLALRKRGRGRKSRVPVEVW mito(17),nucl(5),cyto(2),pero(2),cyto_pero(2) RKRGRGRKS (5-13, prob:0.789) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VXF6 Uncharacterized protein Low 8.9 1 157-176 GDDKDKKRKKEIFKKIAHYV cyto(9.5),cyto_mito(8.5),extr(5),mito(4.5),nucl(3),vacu(3) KKRKKE (162-167, prob:0.755) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W0D6 ABC1 domain-containing protein Low 8.5 2 132-152, 255-278 EGCLLHSSYRHRPRLRKVIAA, MGRTSRRSLRCWRRRVHCGPRAEC cyto(14),mito(6),nucl(4),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WE12 Calcium-transporting ATPase Low 5 1 147-166 NDWQKERQFKKLNEKREDRT plas(13),cyto(5),E.R.(5),mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WSW0 Septin Low 5.9 1 1-20 MAYRASRGRKQAKKGVQLTI mito(23),nucl(2.5),cyto_nucl(2.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WV52 Phospholipid-transporting ATPase Low 7 2 156-176, 1265-1288 GPYAARHKRGRWQRIKEDYLT, EQFQKAIKKVRATQRMRRQRGFAF plas(22),E.R.(2),vacu(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V4U5 Uncharacterized protein Low 5 1 311-332 ITTYCRKFSRMRRRTARPAFLR plas(16),E.R.(5),mito(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9F0 Aminotransferase Low 8.5 2 980-1000, 1360-1382 SSARRSPLSVKYRKKNQNIMS, VKNHPPERTHARADRKRDRAPET mito(10),cyto(9),nucl(4),pero(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9V7 Uncharacterized protein Low 8 1 12-38 LAEIRRRVKIPRAPKNKKIPLAKPSTT plas(14),mito(4),cyto(3),pero(2),vacu(2),mito_nucl(2) RRRVKIPRAPKNKKIPL (16-32, prob:0.903) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VGB3 Chromo domain-containing protein Low 7.7 1 209-231 IGLRRDKYQKKGIHRKRNVYLVR cyto(12.5),cyto_nucl(12),nucl(10.5),mito(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VH56 Spindle pole body component Low 9.1 1 66-87 ILASSRRKGKEREREGREPGQY cyto(11),mito(5),cysk(5),nucl(3),pero(3) RRKGKERER (71-79, prob:0.721) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VK40 Acyl-coenzyme A oxidase Low 6.3 1 77-99 ESSLRRGKHLKALRKQHNWDDAS cyto(9),cyto_nucl(7.5),pero(6),mito(5),nucl(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VN09 60S ribosomal protein L41 Low 8.5 1 1-34 MVNIPKTRRTYCKHKTCKKHTPHKVTQYKKGKDS nucl(12.5),mito(10),cyto_nucl(9),cyto(4.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VSV8 Uncharacterized protein Low 7.7 1 225-247 WNLKDKLQDDRDRKRRLRMVNEA nucl(9.5),cyto_nucl(8),mito(6),cyto(5.5),pero(2),plas(1),golg(1),cysk(1),vacu(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTA6 Uncharacterized protein Low 5 1 497-516 EREQRERRFREEFRRREFRG plas(24),E.R.(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUR5 Non-structural maintenance of chromosomes element 4 Low 9.6 1 25-48 QRQTQTQDGSRRKRPRGSLREELF nucl(16.5),cyto_nucl(10.5),mito(5),cyto(3.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUT5 Uncharacterized protein Low 5.9 1 45-69 GVKPFWWRKDRTVWRKKKMPWGNDP cyto(10.5),cyto_pero(9),pero(6.5),mito(5),nucl(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W219 Uncharacterized protein Low 5 1 29-50 GTKAPYRSPRLERSRSRPRFTI cyto(16),cyto_mito(11.833),cyto_nucl(10.833),mito(6.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W4T4 Uncharacterized protein Low 5.7 1 13-37 LDSRNSGKPRFRLRRTQAYGPRNVK mito(21),cyto(3),nucl(2),cyto_pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJZ7 Uncharacterized protein Low 9.7 1 204-226 APGFSQPPKKRPRHASPPSNHPA nucl(15.5),cyto_nucl(9.5),mito(5),pero(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VNX0 MFS domain-containing protein Low 8.7 1 887-906 KPPKARTRPSRAKLRPTPNE plas(19),E.R.(4),nucl(2),cyto(2),cyto_nucl(2) AAKPPKARTRPSRAKLR (885-901, prob:0.873) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRH1 Monooxygenase Low 9.9 1 654-682 VPELRHRGRLPNHQKAKKGERKTLRESMG cyto(17),cyto_nucl(13),nucl(7) RGRLPNHQKAKKGERK (660-675, prob:0.802) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W7Q1 Uncharacterized protein Low 5.8 1 284-307 LIWWLMRRCKKKRSKPLDDNFWHM extr(11),mito(8),nucl(2),plas(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V9T4 Uncharacterized protein Low 9.1 1 50-72 DSSSSRSPRSRSPRARSRPVGSS mito(15),nucl(3),extr(3),plas(2),cyto_nucl(2),E.R.(2) R (63-63, prob:0.603) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHH6 GrfA protein Low 9.8 1 1143-1172 HSPLQPSQRKRVKHFLKKCKENPRHSQINL nucl(12),cyto(8),plas(3),mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VIB4 MFS domain-containing protein Low 5 1 571-598 PDEPLRRRLSWPPRKNTKPQVWNPTQET plas(26) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJ17 Uncharacterized protein Low 6.4 1 344-364 WVTRPDGARRLRPRQNPDAPA cyto(7.5),cyto_nucl(6.5),extr(6),mito(5),nucl(4.5),plas(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VL12 26S proteasome regulatory subunit Low 9.2 1 1-23 MTTEKKDPKLDPRDKKDGEKTAD nucl(15.5),cyto_nucl(12),cyto(5.5),mito(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VTV4 NADH-ubiquinone oxidoreductase Low 6.9 1 8-30 NQEHKALLRKPFPPRRCHKDGVI cyto_nucl(8.833),mito(8.5),cyto_mito(8.499),nucl(7.5),cyto(7) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VUE7 Uncharacterized protein Low 8.9 1 16-39 STSSTSKQNQHRDSRDHRQKQTIN nucl(15),cyto_nucl(14),cyto(9) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W0K4 Uncharacterized protein Low 7.7 2 31-50, 639-659 HDDLERSRRRWRPVPPSGAT, PPAPPRSRSRRSSYVRSHLFR mito(19),cyto(4),nucl(2),cyto_pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W8S4 AB hydrolase-1 domain-containing protein Low 6.1 1 40-64 FLPHPEKTAPPQPPRPKLKPLPEGW mito(12.5),cyto_mito(10),cyto(6.5),nucl(4),pero(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WHV7 Uncharacterized protein Low 8.4 1 486-511 ALGTWYFLLRRKRKGRKEKESHPGVE plas(19),E.R.(3),vacu(2),nucl(1),mito(1),golg(1),mito_nucl(1) RRKRKGRKEK (495-504, prob:0.931) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WPU3 Uncharacterized protein Low 6.5 1 7-30 IPNFFRRFGRSRKAPPTPPPPPPP mito(19),nucl(4),cyto(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WSC8 Transporter Low 5 1 244-263 SWCMVRTRLPRKKPTPWRAF plas(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VA71 Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase Low 7 2 1-22, 430-449 MPPKKAAKTQTKASPKKRATIE, APGRQQRQTQQQQTTLQKKV plas(20),E.R.(4),mito(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VDK1 Long-chain-fatty-acid--CoA ligase Low 5 1 13-35 LPHTHTPHPSIRRRPVPCPHHLA plas(8),extr(6),cyto(5),E.R.(4),cyto_mito(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWK0 2Fe-2S ferredoxin-type domain-containing protein Low 8 1 233-255 LKAQPSPRRPSRSTPKRWVNGHL plas(23),E.R.(2) RRGSAVRR (269-276, prob:0.635) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W6C6 Uncharacterized protein Low 9.8 1 194-220 NRDSVPSSPQPRRRRRVDYRSMWDQTA nucl(17),cyto_nucl(10.5),mito(8) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W839 Chitinase Low 5 1 2214-2240 TTSSAHRYNRIARRKSKHKDNGGDQVP extr(24),mito(1),cyto(1),E.R.(1),cyto_mito(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W8T0 Uncharacterized protein Low 5 1 484-505 LFFWCRRRKRDEKYQKEVAQRR extr(21),mito(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WCF7 Uncharacterized protein Low 8.7 1 197-217 AHERREKLRVGQTPKKVKKED nucl(14),cyto_nucl(12),cyto(8),mito(2),pero(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WGU9 Uncharacterized protein Low 9.3 1 291-316 SSNGTPEGGKKNKKKQRNGSSHAAAP cyto(14.5),cyto_nucl(11),extr(5),nucl(4.5) GKKNKKKQRN (299-308, prob:0.849) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1V7U5 Retrotransposon nucleocapsid protein Low 9.3 1 470-494 VTTCQSCQRNKTRRHKPYGKLQPLP nucl(16.5),cyto_nucl(13),cyto(8.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VBN8 Methyltransf_11 domain-containing protein Low 8 1 198-223 LSSEPGKKKDKAPKVKGRRKQGEEGA cyto_mito(9.166),mito(9),cyto(9),cyto_nucl(8) GKKKDKAPKVKGRRKQ (203-218, prob:0.971) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VE20 DNA-directed RNA polymerase subunit beta Low 8.2 1 369-388 ALPRKFVRTFRKLRRSGRTS nucl(11.5),cyto_nucl(10.5),cyto(8.5),mito(3),cysk(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VEY6 Transposase-like protein Low 5 1 26-45 IAARIKCSPRSVRRLFKRVD cysk(25) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VS36 Uncharacterized protein Low 9.9 1 58-80 VPAPLPKKPKEPKENGTKKEPKA cyto(9.5),cyto_nucl(9.5),nucl(6.5),mito(6),plas(2) LPKKPKEPKENGTKKEPKAEPK (62-83, prob:0.921) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VSW4 Uncharacterized protein Low 8.5 1 38-60 KSSSPCPECKSKKKAEEDNGFPD nucl(12),mito(11),cyto_nucl(8.5),cyto(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W8E2 Protein kinase domain-containing protein Low 7.8 1 272-295 RNDVRRRPNIHTRRPSRLCRRRVF cyto(11.5),cyto_nucl(11.5),nucl(10.5),pero(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VFB6 Uncharacterized protein Low 5 1 198-220 DSGERGGTRRRTRRERQEEEAAY extr(23),plas(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VHH0 Uncharacterized protein Low 7 2 475-496, 855-883 LLFFCCYRKRKNQKRVSFSSKA, SPLSAEKQRNTQRRVSSQRRPPAERTNST extr(27) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VJR9 Uncharacterized protein Low 8 1 18-42 KAEPYAPTRPPAKRKRTNPATAEAK mito(12),cyto(9),mito_nucl(9) TRPPAKRKRTNPATAEAKAPIKAEPAPR (25-52, prob:0.88) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VL06 Serine/threonine protein kinase Low 6.2 1 425-453 TANAKPIKLSQPPKKFKTRYEEREYHVPA extr(12),cyto(4.5),cyto_nucl(4.5),nucl(3.5),plas(3),E.R.(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VRT2 Lactamase_B domain-containing protein Low 9.6 1 378-401 VEVGDWKKKGRKEEVKKEWVYKPD cyto(16),cyto_nucl(12),nucl(6),pero(4) KKGRK (385-389, prob:0.664) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VU06 Uncharacterized protein Low 7.8 1 382-401 IPYRSGSPRRADRRRNIAFS mito(13),nucl(7),cyto(5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VVT2 Uncharacterized protein Low 8 1 765-795 DDEKEFKKSVKRDKRIRRKWSKDPDARKPVN plas(23),E.R.(3) KKSVKRDKRIRRKWSKDPDAR (771-791, prob:0.961) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VYR2 SUN domain-containing protein Low 5.8 1 96-120 LVNQQRSATSRRQPRRNKALEDEMA plas(11),cyto(5),mito(4),E.R.(4),nucl(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W642 Uncharacterized protein Low 9.8 1 28-51 ARTTSKEWLRRGNKRLRRHMLLQP nucl(17),cyto_nucl(11.5),cyto(4),cysk(3) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1WTJ7 Exonuclease 1 Low 9.1 1 606-629 VTPTQAEQKKSKRKRTVVVEDEQT cyto(13),nucl(11),mito(1),pero(1),cysk(1) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VKL7 Sulfite reductase Low 5.7 1 435-460 SEWMGYRHGKRGKQKNVCIYNKAKTR cyto(17.5),cyto_nucl(10.5),mito(4),nucl(2.5) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLH3 Uncharacterized protein Low 8.3 1 706-727 QTSSDRKDRKLKNATRERENKD nucl(9),cyto(6),pero(6),cyto_pero(6) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VLV5 Uncharacterized protein Low 8.7 1 305-331 GEDLIRRRLKERKRAKRERERRLAAEA plas(22),nucl(2),E.R.(1),golg(1),vacu(1),mito_nucl(1) RRRLKERKRAKRERERR (310-326, prob:0.988) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VWU3 GCFC domain-containing protein Low 8.8 1 33-61 EDSRAERRLFERRQRKRPRTGRSGKDSAW plas(20),nucl(2),cyto(2),cyto_nucl(2) RLFERRQRKRPRTGRSG (40-56, prob:0.907) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VYJ7 Uncharacterized protein Low 5.8 1 188-207 AMRFCRKDKRSTPGERSCPC mito(12),cyto(6),pero(4),nucl(2),cysk(2) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W0E5 CASPASE_P10 domain-containing protein Low 8 1 1381-1406 LRSWSFARPTFPKRRRPSTSPTRSMH mito(7),cyto(7),plas(7),cyto_mito(7) AEKKP (1518-1522, prob:0.629) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1W2P0 Uncharacterized protein Low 6.1 1 48-67 GQTCREWRKRVKAELYHLRD mito(16.5),cyto_mito(11),cyto(4.5),nucl(4) UP000006757 Trichosporon asahii var. asahii (strain CBS 8904) K1VH22 Uncharacterized protein Low 8.1 1 1-26 MKRALPLNTRDRPKRPRVWDWVEPAP mito(11),nucl(10.5),cyto_nucl(8),cyto(4.5)