ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TVZ4	Zn(2)-C6 fungal-type domain-containing protein	Medium	10	1	31-67	DEGPDSRAPRRKRVSRACDRCRSKKDKCDGLRPACSA	nucl(16),plas(8),mito_nucl(8)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U2T4	Uncharacterized protein	Medium	12.8	1	156-177	AYDRAVKEKEIKRRNQEREAAA	nucl(19.5),cyto_nucl(14.5),cyto(6.5)	VKEKEIKRRNQEREAAAK (161-178, prob:0.757)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U514	Uncharacterized protein	Medium	12.6	1	35-67	GNAEGPSNKKRKNGKSKLKKGGKDKKDKPQLDA	nucl(17.5),cyto_nucl(13),cyto(7.5)	GPSNKKRKNGKSKLKKGGKDKKDK (39-62, prob:0.996)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U9B7	Enhancer of polycomb-like protein	Medium	13.2	1	220-240	PYVCFRRREVRQIRKTRGRDA	nucl(14),mito(10),cyto(3)	KTR (234-236, prob:0.609)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UA72	5'-3' exoribonuclease 1	Medium	12.6	1	87-106	GVAPRAKMNQQRARRFRTAL	cyto(14.5),cyto_nucl(12.5),nucl(9.5)	GRGRGR (1334-1339, prob:0.651),RGGRGGRGNPRGSHRGR (1384-1400, prob:0.764)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBS9	Uncharacterized protein	Medium	13.6	2	334-354, 857-876	SRSSLGSKKKRRQQSGPAASP, FSQRYTGKLRPKYKNVAEIV	nucl(14),cyto_nucl(11.5),cyto(7),mito(3),pero(3)	GSKKKRR (339-345, prob:0.769)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UM38	Uncharacterized protein	Medium	10.5	1	196-223	GSNGETGRKKNRKRKGKTKSGRNYERSS	cyto(13),cyto_nucl(12.833),nucl(11.5),cyto_mito(7.833)	GRKKNRKRKGKTKSGR (202-217, prob:0.988)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UME9	Uncharacterized protein	Medium	11	2	418-442, 1126-1147	SGDVPQRNLRHKKRFEPRRTPLVRI, WWHQHRTCPTCKKRLKANDFYQ	nucl(14.5),cyto_nucl(10.5),cyto(5.5),mito(3),pero(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URX5	CCHC-type domain-containing protein	Medium	11.5	1	54-75	RVNTHRRHYRPPPRRGHGREPP	nucl(14.5),cyto_nucl(11.833),cyto(6),mito(5),cyto_pero(3.999)	HRRHYRPPPRRGHGREPPEHDR (58-79, prob:0.874)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUA4	Uncharacterized protein	Medium	10.3	1	311-333	FYFEEEKEKKKERKSEQKRGGRV	cyto_nucl(8),nucl(7.5),cyto(7.5),cysk(6),pero(3)	KEKKKERKSEQKRGGRV (317-333, prob:0.937)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUM1	Uncharacterized protein	Medium	11.2	1	995-1015	TAPVDDPRPVRKQRRVPDPYA	nucl(23),cyto_nucl(14)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U1T3	DUF4139 domain-containing protein	Medium	12.3	1	145-174	AALKEVRRAREKRVRERQERRAQQKRDIKE	nucl(16.5),cyto_nucl(11),cyto(4.5),mito(3),pero(3)	GIKRKRERLESAHTKAKQAALKEVRRAREKRVRERQERRAQQKRDIKEKK (127-176, prob:0.993)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UC04	Nucleolar protein 58	Medium	14.4	2	483-525, 529-578	SEEESSKKKSKKSKDADLEKMAEKAGLSLKRYKRKLERGEIEF, GNPSSISKKDLKKAKKEAKKADKGEEKKRKRSDDNEDNEKKQKKKKKKDE	cyto_nucl(13.666),nucl(13),cyto(13),cyto_mito(7.666),mito_nucl(7.666)	KKKSKKSKDADLEKMAEKAGLSLKRYKRKLE (489-519, prob:0.877),SKKDLKKAKKEAKKADKGEEKKRKRSDDNEDNEKKQKKKKKKDE (535-578, prob:0.997)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDS1	Zn(2)-C6 fungal-type domain-containing protein	Medium	10	1	1-22	MAKKPKKCTRVRTGCYTCKIRH	nucl(13),mito(5),cyto(4),plas(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UI06	Uncharacterized protein	Medium	13.7	2	1-22, 65-86	MARKRKSSPPSRRSPIRWTAQE, GRTNRDCRKRWFKIDRRWSQGP	mito(14),nucl(12.5),cyto_nucl(7)	RK (5-6, prob:0.604)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJM0	Utp12 domain-containing protein	Medium	11.5	1	421-441	QPPPKKTKLGSGGKGKNKARK	nucl(17),cyto_nucl(13.333),mito_nucl(9.833),cyto(8.5)	PPKKTKLGSGGKGKNKARK (423-441, prob:0.975)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMM2	Transcription activator of gluconeogenesis acuK	Medium	14.3	1	45-76	AETGQKPNPKDPSRPRRKKARRACFACQRAHL	nucl(23.5),cyto_nucl(14)	KPNPKDPSRPRRKKARR (50-66, prob:0.959)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPN1	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.8	1	26-54	LSCTACRSRKLKCCRTYPCTNCKKRGEAL	nucl(21),mito(3),cyto(1),plas(1),vacu(1)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUE3	Sec39 domain-containing protein	Medium	10.3	2	221-244, 820-842	GPWMYGSNRSKRRRLNKAAEANSI, DAYETKKQHARRARAHNDRLNAE	extr(11),nucl(9),mito(4),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U1H6	Uncharacterized protein	Medium	12.1	1	199-221	ASDKSAKTSKRKAVDRNHEKGGR	nucl(14.5),cyto_nucl(11),cyto(6.5),pero(3)	KSAKTSKRKAVDRNHEKGGRRKTSKKK (202-228, prob:0.993)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6V2	Protein kinase domain-containing protein	Medium	14.4	2	700-721, 926-947	EESNRKKEKRYSGSSKHTKRSS, RTGPSRPAAPPKPKSLRVRGSE	nucl(14),mito(9),cyto_nucl(9)	KKEK (705-708, prob:0.613)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U9I0	Uncharacterized protein	Medium	10.8	1	2-43	VDYERRHHGPKGGRKRRYREDDDYDRRQRRKYEEPLVAKVRR	nucl(9.5),cyto_nucl(9),cyto(7.5),mito(3),plas(3),pero(2)	RHHGPKGGRKRRY (7-19, prob:0.883)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCE5	Rieske domain-containing protein	Medium	11.7	2	868-891, 1062-1094	FCEWTETIRNPKRRKYFQQFANTD, EAPDPFQKCDKKYKGTRGKKAGDRPSPTKQSKT	cyto(13),cyto_nucl(10.5),nucl(6),E.R.(4),mito(2)	KYKGTRGKKAGDR (1073-1085, prob:0.768)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UFG6	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.2	1	1-44	MPRACEFCRRRKIRCDASRPVCSTCRKSKRSCVYHNAPPKQRPS	nucl(13),mito(8),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UM88	DNA-directed RNA polymerase subunit beta	Medium	10.8	1	75-105	ETPEQKKARQAEGRKAPKRNKLHVRIKEVFL	cyto(11.5),cyto_nucl(11.5),nucl(10.5),pero(4)	KKARQAEGRKAPKRNKLHV (80-98, prob:0.911)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQM6	Poly(A) polymerase	Medium	10.2	1	544-570	VFQPGETRPQRPKKKIIKKSGAGGQKR	cyto(12.5),cyto_nucl(10.5),nucl(7.5),pero(4)	PQRPKKKIIKKSGAGGQKR (552-570, prob:0.94)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U563	IFRD domain-containing protein	Medium	12.3	2	340-361, 448-472	ATVHNKRISKKDKKNLHSNFVS, ADRGAAKKTVKSRNSRRWAVHEQSD	nucl(20),cyto_nucl(12.5),cyto(3),pero(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UFE8	Uncharacterized protein	Medium	13.2	1	3-33	ASKPKSVGSIDKKRARDRRAQQKLRADRLNH	nucl(13),mito(8),cyto(4)	KKRARDRRA (14-22, prob:0.745)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJB0	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.9	2	18-44, 59-86	TDDPQNSSAKRKWRRNRIACDACHARR, SEIQCEFTRERRKRGRIARSKQTNTNGG	plas(19),nucl(5),cyto(2)	RRKRGRIAR (69-77, prob:0.759)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UK35	Uncharacterized protein	Medium	10.5	1	185-207	APPTEEKPTKKDKSKQSRLVYSD	nucl(20),cyto_nucl(13.5),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKE9	Uncharacterized protein	Medium	12.5	1	105-130	DEGDDDSYSRRRRRRRGTGPFSGRFG	nucl(16.5),cyto_nucl(11.5),cyto(5.5),pero(3)	RRRRRRRGTGPFSGRFGARGGKGIKRGPRKP (114-144, prob:0.988)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKK8	Uncharacterized protein	Medium	14.2	2	1-21, 235-260	MCRVPSCRKPARFNNNILSKY, SLSRGICTKKRCERHKQWVKVQQQEI	nucl(18),mito(7)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULE6	F-box domain-containing protein	Medium	13.8	1	617-641	MDSAKREELRNRRRELRMREREYSS	nucl(23),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMH8	ATP-dependent RNA helicase dbp3	Medium	12.8	1	7-40	HNEGGDENKPRKKQKSEKQKKEKSAKSKSSAEQS	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(3)	KPRKKQKSEKQKKEKSAKSK (15-34, prob:0.975)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZM7	DNA helicase	Medium	11.8	1	1-21	MSSPASTRRRGRPSRAEASSP	nucl(17),mito(8)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U4K3	Uncharacterized protein	Medium	12.5	1	108-145	PTLTEQTATRKRKRQRSSTGPSFSKIRRHRRQRPEGPR	nucl(17),cyto_nucl(12),cyto(5),mito(2),pero(2)	KERGRKRAGRRNPTLTEQTATRKRKRQRSSTGPSFSKIRRHRRQRPEGPR (96-145, prob:0.982)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6C0	tRNA(Ile)-2-lysyl-cytidine synthase	Medium	13	1	489-511	VDERGGRSEKKKKKMDPALAGLL	nucl(13),mito(8),cyto(5)	GGRSEKKKKK (493-502, prob:0.836)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGP3	Uncharacterized protein	Medium	10	1	125-144	VVPKRRSRFPWSRHKESTKE	nucl(19.5),cyto_nucl(14),cyto(5.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJV0	G-patch domain-containing protein	Medium	10.5	1	151-177	EDSSDEERKRRQKKKEARKQGSRSGTG	nucl(8.5),cyto_nucl(8),pero(7),cyto(6.5),mito(4)	RKRRQKKKEARKQGSRSGT (158-176, prob:0.984)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMI1	Uncharacterized protein	Medium	13.7	1	406-427	HSSNHGQPKSKKRKLGTQRDMG	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	KRDRKR (485-490, prob:0.655)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TWR6	Uncharacterized protein	Medium	12.3	1	411-440	SALIVEKTKKQKKPSKKNKKKTQRGFMGGF	nucl(13),cyto(7.5),cysk(5),cyto_mito(4.5)	KTKKQKKPSKKNKKKTQ (417-433, prob:0.988)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U1D4	Zn(2)-C6 fungal-type domain-containing protein	Medium	10	1	1-45	MTPQTKSYRPPRRRPAHLRTKTGCLTCRKRKKKCDETPGTCSNCA	nucl(18),mito(9),cyto_nucl(9)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U539	SMP-LTD domain-containing protein	Medium	10.8	2	302-323, 798-822	EEFVRKKITKKISRVNKPNFIS, QQPKGDGKRRVSKPPLPRRNPIFDS	plas(5),extr(5),golg(5),E.R.(4),cyto_nucl(3),cyto(2.5),nucl(2.5),mito(1),pero(1),vacu(1)	KGDGKRRVSKPPLPR (801-815, prob:0.788)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U600	Protein bcp1	Medium	14.2	1	198-223	KLDMEDSRPQKKKKKSGDKVEKFYFH	nucl(16),cyto(10)	QKKKKKS (207-213, prob:0.818)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U7T4	ANK_REP_REGION domain-containing protein	Medium	13.3	1	402-424	EETSKPSTPRPQQQKPKVSKEDE	nucl(12),cyto_nucl(11),cyto(8),mito(3),pero(2)	RKAAEEEEKNRRKAELHRLK (557-576, prob:0.772),MRLERERRARAAEERIKRMQGK (619-640, prob:0.838)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U7Z9	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.1	1	14-35	FACLVCRRRKVKCDGRWPTCVN	nucl(18.5),cyto_nucl(10.5),mito(7)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAN2	APH domain-containing protein	Medium	10.6	1	507-526	MYPTNEDEKRGRKRKINEAL	cyto(11.5),cyto_nucl(11),nucl(9.5),pero(4)	RGRKRK (516-521, prob:0.684)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2US18	CBF domain-containing protein	Medium	12.1	1	7-27	GATSSKKRKSVKESGVPSSKR	nucl(17),cyto_nucl(11.333),cyto_mito(4.666),mito(4.5),cyto(3.5)	KRK (13-15, prob:0.612)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U7S3	T5orf172 domain-containing protein	Medium	12.4	1	90-115	LDNSNRYRPFKTKKKTKRTLCCCFEI	nucl(20),mito(4),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDF3	Uncharacterized protein	Medium	11.1	1	102-128	NSSHSPNYSPRQCRRPKLPRCVLFPLL	nucl(23),cyto_nucl(14.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEB1	Uncharacterized protein	Medium	10.9	1	172-200	ATVDLVAPKKKKKRKTKSKAKHGKVVELI	nucl(14),cyto_nucl(11.833),mito_nucl(10.499),cyto(6.5),mito(5.5)	PKKKKKRKTKSKAKHGK (179-195, prob:0.997)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJU9	Vacuolar protein sorting-associated protein	Medium	11.1	2	312-340, 2937-2960	HYFIRHQEYKKFQPKCRPKEDPRAWFKFA, DKEFQDKRRMSKSRNRPKHALYGI	nucl(15.5),cyto_nucl(13),cyto(9.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULE8	Transcription initiation factor IIE subunit beta	Medium	10.7	1	245-281	ITPTNKNKVTKARPKIEHKKVKKPRRSGKTTNTHMMG	mito(16),nucl(7),cyto(3)	KNKVTKARPKIEHKKVKKPRRSGK (250-273, prob:0.987)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQ99	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.4	1	12-54	APDPEPQPEPRVRKRRRRTMACVQCRSRKLRCDRKLPMCSRCE	nucl(24.5),cyto_nucl(14)	RVRKRRRR (22-29, prob:0.783)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U0A3	DUF2156 domain-containing protein	Medium	12.3	1	16-44	QTSGGAKTKQPKASKKKPNPAKKDLLFRT	nucl(15.5),cyto_nucl(10),mito(7),cyto(3.5)	KTKQPKASKKKPNPAKK (22-38, prob:0.919)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U0A5	Uncharacterized protein	Medium	13.5	1	421-449	IDDQKRKRLIWEATSRKRSHSKQPSNDSH	nucl(23),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U0E6	Uncharacterized protein	Medium	12.8	1	103-127	CKAGMTGLKKRDRKKGKAKAKAAKA	nucl(16.5),cyto_nucl(10),mito(8)	LKKRDRKKGKAKAKAAKA (110-127, prob:0.995)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U589	Uncharacterized protein	Medium	14.3	2	29-53, 156-186	SKGLARATSKSKNRRKSIRLVNPAC, RTITKRVWERWQKRVNLRRKVCRDLWRRCLE	nucl(15),cyto_nucl(10.5),mito(5),cyto(4)	KNRR (40-43, prob:0.622)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U7U7	Uncharacterized protein	Medium	11.3	1	187-217	PASGKMPQDRKARSPKRPRRVPQQDQAETKG	nucl(10),mito(10),mito_nucl(10)	QPKPASGKMPQDRKARSPKRPRR (184-206, prob:0.948)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UC60	DNA replication licensing factor MCM2	Medium	14.7	2	146-170, 856-880	DQNIDLTRQPRRRRHHYDEDREDID, SRAFAKYILSRPKPQSRRKAGIAAP	nucl(20),mito(6)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEV5	Uncharacterized protein	Medium	11.1	1	253-277	DEPYCAPYSRRREQRMRGQRRGVSV	nucl(19),mito(4),cyto(4),cyto_mito(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UI18	Uncharacterized protein	Medium	14.9	2	119-139, 377-397	ASSTPAKNTKRTRTPPKTATT, DGERAKSAKRQKTTKSGRSLA	nucl(15),cyto(9.5),cyto_mito(6)	AKSAKRQKTTKSGRSLAKHSSR (381-402, prob:0.768)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UL56	Uncharacterized protein	Medium	14.1	1	28-55	LNANPLPGKADRRKKKKQQAAPAISTVR	nucl(17),cyto(5),pero(3),cyto_mito(3)	PAPKLNANPLPGKADRRKKKK (24-44, prob:0.955)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UP44	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.6	1	4-34	SFNSPLRRRPLACMRCRRRKVRCDGGTPACS	nucl(15),mito(5),cyto(3),plas(2),cyto_pero(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UR26	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.4	1	53-81	TRNRASYSCHTCRRRKVKCDKVHPICGNC	nucl(26),cyto_nucl(14.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UTL3	SMI1_KNR4 domain-containing protein	Medium	13	1	365-391	EILRWRTDQKYGRRPPRRKGPNGLGLN	nucl(13),mito(8),cyto(5)	GRRPPRRKGP (376-385, prob:0.804)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXI8	Exonuclease domain-containing protein	Medium	11.1	1	77-99	DAGQSKGQRKKGKGKWQKVSLSE	nucl(11),cyto_nucl(11),cyto(9),pero(4)	GQRKKGKGK (83-91, prob:0.8)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UG91	Uncharacterized protein	Medium	11.7	1	36-65	DSGSTRWSNKRHAVPKHKRSLKNNPYPLSG	nucl(18),extr(6),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGJ8	Uncharacterized protein	Medium	12.6	1	76-95	RATYNPSRRVQKRRHGFLAR	mito(14),nucl(12)	SRRVQKRRHGFLARVRSRGGRMIILRRRAKGRKS (82-115, prob:0.976)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKR7	Uncharacterized protein	Medium	10.6	2	105-130, 151-170	KSSPREQTPSKPKPLPQKASKSTPLP, QNELHNPRRKSKKLAVSFNP	mito(14),nucl(9),cyto(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKT8	Ubiquitin-like domain-containing protein	Medium	11.9	1	73-108	LRGGGKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKV	cyto_nucl(16.5),nucl(16),cyto(9)	LRGGGKKRKKKVYTTPKKIKHKRKKTK (73-99, prob:0.995)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDG9	YL1_C domain-containing protein	Medium	11.4	1	23-49	QVPRPFRNPHWKPSQRRNKNVKQLISE	nucl(23.5),cyto_nucl(13.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPP5	Uncharacterized protein	Medium	13.1	1	415-436	TEAHKSRPTKEKSVARKPQENP	mito(15),nucl(10),cyto_nucl(7)	HVKASKPARSPRPPATRDSPK (215-235, prob:0.801),SRVTRAPVRPVASKTEAHKSRPTKEKSVAR (401-430, prob:0.75)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQD8	Nucleolar protein 58	Medium	10.6	1	452-522	DAEAESKKEKKDKKEKKKEKKEKSEKKEKKEKGEKEEKKKKRKSDVGEGESEKKKRKHDSDAEPSKKKKKV	cyto(15.5),nucl(10.5),cyto_mito(8.833),mito_nucl(6.333)	KKEKKDKKEKKKEKKEKSEKKEKKEKGEKEEKKKKRKSDVGEGESEKKKRKHDSDAEPSKKKKKV (458-522, prob:1)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQI1	J domain-containing protein	Medium	13.1	2	56-81, 650-675	GDLIEAQKRKRLRKERRIKRIVTVVL, QMQALKTGQPPKKKAKKPEDDSSEDE	plas(8),cyto(6.5),cyto_nucl(5.5),E.R.(5),nucl(3.5),golg(2)	KRKRLRKERRIKR (63-75, prob:0.956),PKKKAKK (660-666, prob:0.757)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TW09	BZIP domain-containing protein	Medium	13.8	1	134-155	ILQRNRQAAKRCRQRKKLVVEE	nucl(20.5),cyto_nucl(12),mito(3)	NKDWKARRDKILQRNRQAAKRCRQRK (124-149, prob:0.795)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5A9	Histone H2B	Medium	13.5	1	36-55	AASGDKKKRGKTRKETYSSY	nucl(20.5),cyto_nucl(13.5),cyto(3.5)	AAEKKPSTGGKAPAGGKAPAEKKEAGKKTAAAASGDKKKRGKTRK (5-49, prob:0.992)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5C0	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.2	1	16-44	TGDRATAKERRRSCRFCRTRKLRCSGTSQ	nucl(16),mito(5),cyto(3),pero(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCF8	Fungal_trans domain-containing protein	Medium	13.3	1	1-30	MPPTERPKKKSRRACERCRSMKWRRLGSPL	nucl(18.5),cyto_nucl(10.5),mito(6)	PKKKSRR (7-13, prob:0.713)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCL1	Uncharacterized protein	Medium	10.2	1	72-95	NEPEEEKAKKRGRRKEKGSLDVDQ	mito(19),nucl(6.5),cyto_nucl(4)	KAKKRGRRKEK (78-88, prob:0.945)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UD93	Xylanolytic transcriptional activator xlnR	Medium	12.4	1	152-175	GLTCEYARERKKRGKASKKDLAAA	nucl(11),mito(7),cyto(4),plas(3)	ERKKRGKASKK (160-170, prob:0.901)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UF07	Uncharacterized protein	Medium	13.7	1	451-477	TKIGRPTSANGKRPKRSRDEDGRAETE	nucl(19.5),cyto_nucl(11),mito(4)	KRPKR (462-466, prob:0.674)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJR3	Uncharacterized protein	Medium	11.8	2	55-84, 1150-1178	KEEDARGEAKPHKPRKRPGKGKTRMVTDPT, SLAGSSKENKHTKKANRRSEQRQQRGMMQ	plas(18),nucl(5.5),cyto_nucl(4.5),cyto(2.5)	ARGEAKPHKPRKRPGKGKT (59-77, prob:0.988)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UK82	40S ribosomal protein S8	Medium	12.1	1	11-38	RSATGAKRATYRKKRAFEKGRQPSNTRI	nucl(15.5),cyto_nucl(10.5),mito(7),cyto(4.5)	RHKRSATGAKRATYRKKRAFEKGRQPSNTRIGTKRIHLVRTRGGNRKFR (8-56, prob:0.978)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKL8	Uncharacterized protein	Medium	13.5	2	1-22, 24-45	MPLSNRRRARRKEIQLQETSDA, APDSSPTRPSNKKRKDLVDMVI	nucl(25.5),cyto_nucl(13.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUM8	Uncharacterized protein	Medium	10.3	1	40-63	TPSSNRGHTKKKRLYQRSSMQRAV	nucl(19.5),cyto_nucl(12),cyto(3.5),vacu(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2PIT4	R3H-assoc domain-containing protein	Medium	13.4	1	105-124	SVSFRRREPLRRDSLKRREA	nucl(11.5),mito(9),cyto_nucl(8.5),cyto(4.5)	RRREPLRRDSLKRREALLKGKDGSRRRQ (109-136, prob:0.907),GTKGEKHRVPKDLRLKLKHARA (195-216, prob:0.796)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U1F5	Uncharacterized protein	Medium	10.1	1	1-25	MSSVEKKRLRDRRAQQNLRSKRSQQ	nucl(18.5),mito_nucl(11.5),mito(3.5),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5M4	PINc domain-containing protein	Medium	12	1	1-35	MGVQKKTRKFAQVKRAIKKHDDRAKKDNNAPKQDK	nucl(15.5),cyto_nucl(11.5),cyto(6.5),mito(5)	KTRKFAQVKRAIKKHDDRAKKDNNAPK (6-32, prob:0.876)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBV2	Uncharacterized protein	Medium	14.2	1	531-555	ADSQPGMHKPRKRRRGRLGDVTYLQ	mito(17),nucl(6),cyto(4)	REGRKPSRSFKRR (335-347, prob:0.736),GKPARGRPKGSKAR (420-433, prob:0.863),HKPRKRRRGR (538-547, prob:0.91)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGL1	Pyruvate carboxylase	Medium	10.4	1	972-995	FPEPLRSRALRDRRKLEKRPGLYL	cyto(12.5),cyto_nucl(11),nucl(8.5),pero(4)	DRRKL (983-987, prob:0.65)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUU4	1,3-beta-D-glucan-UDP glucosyltransferase	Medium	13	3	271-302, 317-336, 1805-1831	FSNMKLGKADRKTRKARKAAQKKAKENPENVE, AEYRWKTRMNRMSQHDRVRQ, QIRPPIYSLKQSKLRKRRVVRFAILYF	plas(27)	GKADRKTRKARKAAQKKAK (277-295, prob:0.972)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TYS2	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.1	1	6-57	IPQACDACRRRKVKCTSHRPCSPCRSMALVCRSTGSRRKKGRQGRSANVLYE	nucl(11),plas(6),mito(5),cyto(2),pero(1),golg(1),vacu(1)	RKKG (43-46, prob:0.655)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U544	PIPK domain-containing protein	Medium	13	1	208-233	RWAEAIKQRRASKRRRRDDDDDDRVI	nucl(20),cyto_nucl(14),cyto(6)	KQRRASKRRRR (214-224, prob:0.819)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAM3	Uncharacterized protein	Medium	12.1	1	101-123	SLQMSRDKKEHARRRKVWDQGFS	nucl(11),cyto(7),mito(5),pero(4)	HARRR (111-115, prob:0.647)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UFI1	Uncharacterized protein	Medium	13.5	2	274-304, 329-350	SQFSSKMPSNTQKKHKCKVCDKRFTRPSSLQ, VVSNLRRHKKVHKGEKEGASGD	nucl(26.5),cyto_nucl(14)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UK09	TPR_REGION domain-containing protein	Medium	10	1	1-22	MGKPRPHKKKASKSKSKSVLSA	mito(14.5),cyto_mito(9.5),nucl(7),cyto(3.5)	KPRPHKKKASKSKSK (3-17, prob:0.949)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URW4	Protein kinase domain-containing protein	Medium	12.9	1	54-82	NYQKCVIKVLKPVKKKKIKREIKILQNLA	nucl(17),cyto(9),mito_nucl(9)	KPVKKKKIKRE (64-74, prob:0.895)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUK0	Uncharacterized protein	Medium	12.6	1	446-466	AVSAKNKKHHGKRGAHNREIN	nucl(19.5),cyto_nucl(13.833),cyto(5),cyto_mito(4.499)	KKHHGKR (452-458, prob:0.681)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U604	Uncharacterized protein	Medium	13.2	1	10-36	RKATSATDQAPRKRRKRTVVTGAAEDC	nucl(13),plas(5),cyto(4),mito(3)	RKRRK (21-25, prob:0.698)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAE1	FHA domain-containing protein	Medium	13.1	1	533-579	QSSYDSSSRWRRYNRYDGRQSEVSEYTPEPRRRRRAVHRERVWDNWT	nucl(19.5),cyto_nucl(13),cyto(5.5)	RRR (564-566, prob:0.618)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCP8	Uncharacterized protein	Medium	11.4	1	598-622	TLRFETPTKLQKHKREAHRQTTPGG	nucl(26),cyto_nucl(14.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UN94	Tr-type G domain-containing protein	Medium	13.1	1	27-57	DEEEDDRRRRREERKRLKKEKARQKELESAS	mito(11),nucl(9),cyto_mito(9)	KRRDGRR (11-17, prob:0.631),RRRRREERKRLKKEKARQK (33-51, prob:0.992)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2USW6	Uncharacterized protein	Medium	14.5	1	98-123	EQVTRTRPKIRGTRKNKKSDTVREKA	nucl(17),mito(5),cyto(4)	TRPKIRGTRKNKKS (103-116, prob:0.854)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UTT6	Protein kinase domain-containing protein	Medium	12.8	1	572-600	YGSWAKKEPASPERRRRPFLEKGWRRDAV	nucl(13),cyto(7),mito_nucl(7)	EPASPERRRRPFLEK (579-593, prob:0.776)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	A7BJS7	Transcriptional activator of proteases prtT	Medium	10.7	1	37-69	DATRPKGRIRRSMTACNTCRKLKTRCDLDPRGH	nucl(21.5),cyto_nucl(12),mito(2),pero(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TX43	Uncharacterized protein	Medium	12.7	1	398-426	QSGVHERLRRRTRKMRKRRRQTQLGGQIA	nucl(20),cyto_nucl(13.833),cyto(5.5),cyto_mito(3.666)	HERLRRRTRKMRKRRR (402-417, prob:0.982)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXV3	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.5	1	44-78	SCDNERPCKRCHSKRINCVPRPKGRRLSRERLSYS	nucl(17),mito(3),cyto(2),pero(2),cyto_pero(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TYR5	Uncharacterized protein	Medium	11.2	1	31-50	VCPFCKKSFLKPEVARRHSK	nucl(16),plas(4),mito(2),cyto(2),cyto_mito(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U690	Uncharacterized protein	Medium	10.6	1	817-840	YTLDKAQRRAKRLMTRKCRHSECL	nucl(14),mito(8),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKM4	Probable E3 ubiquitin ligase complex SCF subunit sconB	Medium	11.4	1	8-28	TLPSRRRPSLSFRPRPRTATS	mito(12),nucl(11.5),cyto_nucl(7.5),cyto(2.5)	KKKR (296-299, prob:0.665)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMW9	Uncharacterized protein	Medium	11.3	1	13-37	KKIKESLKSIFKRKKGDKNNAQAAE	nucl(13),mito(13),mito_nucl(13)	FKKIKESLKSIFKRKKG (12-28, prob:0.827)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UNV4	Uncharacterized protein	Medium	14.8	2	64-84, 300-319	EDKERENRGRGPRRNNAKFDP, GFRGRGRGRQNDNRDWRERR	cyto(14.5),cyto_nucl(14.5),nucl(11.5)	RGRGPR (71-76, prob:0.634),GRIKPSGHRPRGRGGFRGRGRGRQNDNRDWRERRAEDQKRGFNGDKKE (286-333, prob:0.984)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUE2	Uncharacterized protein	Medium	12.6	2	211-238, 715-734	ESGLSKRQLNQLKRKNKQSAKMGANKVR, SDATKKRGRKAEKKEVPPPS	cyto_nucl(12),cyto(11.5),nucl(9.5),mito(4)	KKRGRKAEKK (719-728, prob:0.853)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q5KU05	pH-response regulator protein palA/RIM20	Medium	12.2	1	567-588	VSRLENRRKRRAQALKDKARTD	nucl(11),mito(9),cyto(6)	RRKRRA (573-578, prob:0.683)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5X1	Uncharacterized protein	Medium	13.1	1	94-120	AGDKCITREPPPRRQPQRRNTLPWSDP	nucl(18.5),cyto_nucl(12.5),cyto(5.5)	SKRKEKLIASLRARRE (340-355, prob:0.742)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UF70	CAP-Gly domain-containing protein	Medium	13.8	2	1215-1234, 1255-1281	RASWRPSKTKLRYQVLQQRE, RLVNTKKERLARDRARRHAPKNSVFGG	nucl(15),cyto_nucl(12),cyto(7),mito(5)	LARDRARR (1264-1271, prob:0.657)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKT3	BZIP domain-containing protein	Medium	13.4	1	406-431	LERNRVAALKCRQRKKQWLANLQAKV	nucl(18.5),cyto_nucl(10.5),extr(5)	ATKGKKKNTATKTSGAANNRRKADDAPVKGSNKK (329-362, prob:0.82)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UM33	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.4	1	116-144	DQSARRKRSKISRACDECRRKKVRCDASS	nucl(23.5),cyto_nucl(13.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UN26	Uncharacterized protein	Medium	11.3	1	308-332	EGNPWQPEVKRRKTAPNKADTNKTD	cyto_nucl(13.5),nucl(12.5),cyto(11.5)	KDGKRKK (271-277, prob:0.714)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3W9	WW domain-containing protein	Medium	11.1	1	256-290	RAERSAKKLTKKELKMFKEKRREKKEEKRRAWLRD	nucl(11),cyto_nucl(10),cyto(7),pero(4),mito(3)	RAERSAKKLTKKELKMFKEKRREKKEEKRRAWL (256-288, prob:0.997)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5Y2	Kinesin motor domain-containing protein	Medium	10.4	1	1719-1738	LEERMNALNKKKKKSTLNCF	nucl(20),cyto_nucl(12),mito(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6H2	Methionine aminopeptidase 2	Medium	14.1	1	68-101	EQQPSSETTSKKKKRRKPKKKISALKQSSPPRVP	nucl(23),cyto_nucl(14.5)	KKKKRRKPKKKISA (78-91, prob:0.997)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U8L9	Uncharacterized protein	Medium	13.4	1	533-554	SDTPKEDTFRPRWPPNRRVEIG	nucl(20),cyto_nucl(12),mito(5)	ERRRELLRSKRRSRSATALRGL (221-242, prob:0.878)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBL9	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.6	2	1-25, 40-62	MLGCFTCRLRRKKCDETRPFCKNCS, ATNEQRRGQRERIKGRIRQTKVM	nucl(10),plas(7),mito_nucl(7),mito(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UE71	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.5	1	1-37	MPPSRKSKSRRTHTLGGCQTCRRRHVKCDQMRPTCLT	nucl(17),mito(9)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UHD2	Rab-GAP TBC domain-containing protein	Medium	12.5	2	13-44, 533-552	SSSRTSSSSRHSQKPRPVRTRSQKRQSAASSN, IYDQRRKKRQREASLLKNNN	nucl(21.5),cyto_nucl(14),cyto(3.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJ65	MINDY_DUB domain-containing protein	Medium	10.1	1	553-577	PAPARHRSTGHRPSHQPRRHSPSRD	nucl(21.5),cyto_nucl(15),cyto(5.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UM54	Calpain catalytic domain-containing protein	Medium	12.5	1	13-36	TPPLSTRSGGRKRRASQTPQETLR	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	TRKKLQK (612-618, prob:0.669)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPJ0	Uncharacterized protein	Medium	14.8	2	22-43, 157-177	EKEADKTAKKTHRRHSSQSEGV, TKNTTVPQTSSKKSKKKKEEA	nucl(12),cyto(11),pero(2)	KKSKKKKE (168-175, prob:0.834)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UV06	Uncharacterized protein	Medium	11.7	1	98-122	WDRLNRDRTFTRKRRFRNNYFLDEI	nucl(18),mito(3),cyto(3),cyto_mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U2X3	RNB domain-containing protein	Medium	12.9	2	491-514, 541-560	DEVWSQKREKEEKKKRKDITDARA, GSIRRRGSLRQRPTQKKNDD	nucl(11),cyto_nucl(10.5),mito(8),cyto(8)	KREKEEKKKRK (497-507, prob:0.826)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6A8	Uncharacterized protein	Medium	14.1	2	24-53, 57-76	VQPLTSNKTKVRKRRSLDPKHTPPKHDTYK, RTGLHTPRRTPPKEKNVPDD	nucl(11),cyto(5),mito(4),plas(2),pero(1),E.R.(1),golg(1),cysk(1),vacu(1)	RKRR (35-38, prob:0.668)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEL9	Uncharacterized protein	Medium	12.2	1	332-351	TTNPPPKKKARIPKPNNSDS	nucl(11),mito(7),cyto(6),pero(2)	KKKARI (338-343, prob:0.706)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UET1	Nucleolar GTP-binding protein 1	Medium	13.3	1	603-627	DTTARSKADRLKKLGQKKMNRMARA	cyto_nucl(13),nucl(12.5),cyto(12.5)	RALMRNEAKMRKSLKNRAQIPRSAK (500-524, prob:0.787),RLKKLGQKKMNR (612-623, prob:0.692)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UK43	Uncharacterized protein	Medium	12.9	2	279-298, 402-427	KENERRAQLRQKLRQKERQL, ASGSEQGHQHRKKKSKTLSRGVSPLT	plas(12),nucl(8),mito(2),cyto(2),E.R.(2),cyto_mito(2)	K (414-414, prob:0.602)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UN37	FK506-binding protein 4	Medium	12.9	1	297-318	EESLSKKQQKKLKKNNGDAAAV	cyto(22),nucl(2.5),mito_nucl(2.5)	NKRS (279-282, prob:0.627),KPAK (289-292, prob:0.617),SLSKKQQKKLKKNNGDAAAVEQKKEAKEGKEAKK (299-332, prob:0.867)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UNI3	Uncharacterized protein	Medium	11	1	83-106	MASALQQRRTRRRRGSLRKTALLG	plas(14),nucl(8),cyto(2),mito(1),pero(1),vacu(1)	RRTRRRRGSLRK (90-101, prob:0.816)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPY4	tRNA wybutosine-synthesizing protein 4	Medium	11.5	1	436-461	QALDELKKKNEGKKRKWDEIVHGKSE	cyto_nucl(14.5),nucl(14),cyto(11)	KKKNEGKKRK (442-451, prob:0.741)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U256	Peptidyl-prolyl cis-trans isomerase-like 4	Medium	12.1	1	378-461	FDKGDKAPRRRSYSRSPQRSSNRDRRASRSPRRDSYRDPYRRRPGDRSHSRSPARGEYRDKDRGRYNHRERRRDDERYRERRRR	nucl(17),cyto_nucl(14.5),cyto(10)	KAPRRRSYSRSPQRSSNRDRRASRSPRRDSYRDPYRRRPGDRSHSRSPARGEYRDKDRGRYNHRERRRDDERYRERRRR (383-461, prob:0.981)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U302	Ribosomal protein	Medium	12.2	1	90-109	LKKLNKNKKLIKKLARKYDA	nucl(13),mito(6),cyto(6),cyto_mito(6)	NKNKKLIKKLA (94-104, prob:0.73)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U7K9	Protein kinase domain-containing protein	Medium	11.2	2	1-25, 392-418	MPSERQSRMHKHRLRPHHLHQKGFL, GKPRLTVSSKGRRRRPSSKELRQVLKC	mito(19.5),mito_nucl(12.833),nucl(5),cyto_nucl(3.833)	SKGRRRRPS (400-408, prob:0.823)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U8W6	RRM domain-containing protein	Medium	13.9	1	149-172	ESGKQAAKPRARPQKQRGPPEDGI	nucl(13),cyto_nucl(9.5),mito(7),cyto(4)	GRRRTGGRGRGRGRGRGRGGRLGRGGR (83-109, prob:0.996),KPRARPQK (156-163, prob:0.669)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKG4	PDEase domain-containing protein	Medium	13	1	498-533	SSGGEQPSRKLLKRRSRLRLAFWKRKTHHSHHHELS	nucl(13),cyto(5),golg(4),mito(2),pero(2)	RKLLKRRSRLRLAFWKRK (506-523, prob:0.834)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UNG9	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.5	1	92-118	CVYGPEARKGRPKRKRTEDKCTLNPGI	nucl(15.5),cyto_nucl(9),mito(4),plas(3),extr(3)	RKGRPKRKR (99-107, prob:0.902)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UNN3	Carn_acyltransf domain-containing protein	Medium	11.6	1	780-799	NTDRERNGEKPERRRFVGKK	nucl(13.5),cyto_nucl(11.5),cyto(8.5),pero(4)	KPERRRFVG (789-797, prob:0.663)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UHA5	Uncharacterized protein	Medium	11.1	2	27-52, 95-120	EAWFKKMSERDRKKMQEKEKAKREAQ, SGVPEWTKNARKRQKKYMKSLKEAEA	mito(18.5),mito_nucl(12.666),cyto_mito(11.833),nucl(5.5)	MSERDRKKMQEKEKAKREAQGGKKAK (33-58, prob:0.962)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U4V5	Uncharacterized protein	Medium	10.2	1	214-235	LVPPRTPRSRRNSKDERPNFDI	nucl(21),cyto_nucl(13),mito(3),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U671	DUF1308 domain-containing protein	Medium	11.1	1	140-159	VEDEGKKRPNKDKRKSVFVD	nucl(14.5),cyto_nucl(13.333),cyto(10),mito_nucl(8.666)	KKRPNKDKR (145-153, prob:0.7)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6E1	Uncharacterized protein	Medium	10.4	1	205-241	FNSGNGRKISKVKKERKKERKKKDKKKEKIKAIRATW	mito(14),nucl(6),cyto(5)	GRKISKVKKERKKERKKKDKKKEKIKAIR (210-238, prob:1)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEH1	Protein-lysine N-methyltransferase EFM4	Medium	11.1	1	31-86	TYTTTACVSKQKRSKRWQKKVIQVTSHPANWEPKTKRKKERNKEKKLTTKTPPEEQ	cyto(11),cyto_nucl(8.5),mito(6),nucl(4),plas(2),pero(2),E.R.(2)	KRSKRWQKK (42-50, prob:0.685),EPKTKRKKERNKEKK (62-76, prob:0.972)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJ28	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.9	2	9-38, 41-68	QTGWRISKACQECRKRKIKCNGSSPCKTCH, NTPCIYRDVIRQRKRKHQTNRDSDSFES	nucl(22),mito(2),cyto(2),cyto_mito(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UM19	mRNA cap guanine-N7 methyltransferase	Medium	13.9	2	18-43, 68-87	KSSSMRLQERHQQLRKRGRTPPSAYA, APPRSPSPDAQARKRKRPGG	nucl(13.5),cyto_nucl(11),cyto(7.5),mito(3)	AQARKRKRPGGGAR (77-90, prob:0.916)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMH5	Ubiquitin carboxyl-terminal hydrolase	Medium	11.2	1	66-91	HPLALNIKRIRKKVQRDEPPHKISKL	nucl(10),cyto(9.5),cyto_mito(6.5),pero(5)	KRIRKK (73-78, prob:0.693)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMK3	TPR_REGION domain-containing protein	Medium	10.9	1	114-140	REVDEKMDKRRKARREIRERQEREDYE	nucl(11.5),mito_nucl(8.833),cyto(7.5),cyto_mito(6.833),mito(5)	KRRKARREIRER (122-133, prob:0.877)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URL0	Rab-GAP TBC domain-containing protein	Medium	14.5	2	78-97, 234-255	LDSPLRLRTHRRARSNSDAS, DAKNKNKARKPRLSTSRRREME	nucl(18),cyto_nucl(14),cyto(8)	KNKNKARKPRLSTSR (236-250, prob:0.85)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U1Q0	FHA domain-containing protein	Medium	13.3	2	533-554, 556-579	QSSYDSSSRWRRYNRYDGRQSE, SEYTPEPRRCRRAVHRERVWDNWT	nucl(17),cyto(7),mito(1),extr(1),pero(1)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3K2	WD_REPEATS_REGION domain-containing protein	Medium	12.5	1	23-52	AQDKLIRTERERVKRRRTSRDKDEIKQSLR	nucl(17.5),cyto_nucl(12.5),cyto(4.5),mito(4)	RERVKRRRTSRDK (32-44, prob:0.808)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5B2	Uncharacterized protein	Medium	12.9	1	474-503	SQTSPPKVGKAKQKRAKKAQRAMNQLQHIK	nucl(18.5),cyto_nucl(13),cyto(6.5)	KVGKAKQKRAKKA (480-492, prob:0.899)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UG40	Uncharacterized protein	Medium	11.3	1	18-52	NSRKVESRVDRKKLEKAERKIRAKQEKKQMKMVQY	nucl(10),cyto(10),cyto_nucl(10)	RVDRKKLEKAERKIRAKQEKK (25-45, prob:0.944)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKK9	PHD domain-containing protein	Medium	13.9	2	406-426, 456-487	AKKGTAKKSTAKKRKITEEDT, AGSPAPESRTKRKKGAKKRKAPKKAAAKEEEH	cyto(11),cyto_nucl(10),nucl(7),mito(3),golg(2),pero(1),E.R.(1),cysk(1),vacu(1)	NSVKAASGRKSTPGGAKKGTAKKSTAKKRK (391-420, prob:0.979),APESRTKRKKGAKKRKAPKKAAAK (460-483, prob:0.999)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULS8	Uncharacterized protein	Medium	11.1	1	17-42	IATKHIMKKREGKKKKSPLLLSNNLS	mito(11),nucl(10),cyto_nucl(6.5),plas(5)	IMKKREGKKKKS (22-33, prob:0.922)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U1R2	Uncharacterized protein	Medium	10.1	1	150-170	NPPVRQRKKLTRERSERIRNL	nucl(20),cyto_nucl(12.5),cyto(3),mito(1),plas(1),pero(1),cysk(1)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5A1	SMC_N domain-containing protein	Medium	12.4	2	25-47, 1008-1028	SSSSSACHLRKRIRTSKSPASYE, IETLKHRKKRWVIFRSHISSR	nucl(21.5),cyto_nucl(13.5),cyto(4.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U7U1	DUF4203 domain-containing protein	Medium	11	2	159-184, 557-576	ISQLRLWKVIRQRRQKENEVREKELK, GSSPKTKKPAPVKQRSSKSG	plas(10),mito(4),nucl(3),extr(3),cyto_mito(3),cyto(2),pero(2),E.R.(2),cyto_pero(2)	KGSSPKTKKPAPVKQRSSKSGSETKTKPRKESP (556-588, prob:0.937)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAQ0	Protein kinase domain-containing protein	Medium	12.2	1	378-402	APERSPSTRRSYRKRRSSGVKQPLG	nucl(15.5),cyto_nucl(12.5),cyto(8.5)	RSPSTRRSYRKRR (381-393, prob:0.741)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCV5	Uncharacterized protein	Medium	14.8	2	34-57, 91-112	NMAIASKQKRQNKLPTQAKKNAIY, ALNPTVRHKGRKRSRLPSDESE	nucl(16.5),cyto_nucl(10.5),mito(4),cyto(3.5)	RK (101-102, prob:0.612)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJP6	Uncharacterized protein	Medium	11.9	1	944-971	LNESPSSAKRTPRSRKRRPVPIDMNVDT	nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(4)	AKRTPRSRKRR (951-961, prob:0.843)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPG7	Type 1 phosphatases regulator ypi1	Medium	14.2	1	140-170	RGRLTCCPNHGHRKLKRRRPSPNAYEKMPKT	nucl(23),cyto_nucl(14)	HRKLKRRRPSPNAYEKMPKTTKGR (151-174, prob:0.925)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URB6	SWIB domain-containing protein	Medium	14.4	1	148-171	ARKVQPAKKKTTKAKTSKKVKAED	nucl(24.5),cyto_nucl(13.5)	ARPTRGASARKVQPAKKKTTKAKTSKKVK (140-168, prob:0.967)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U0T8	Uncharacterized protein	Medium	13.5	2	142-164, 391-416	PTLVGLQGKKKRRTRQINPGMGT, EKKEYHNRLIRRAKAKKKGKDGVTPG	cyto(15.5),cyto_nucl(12.333),cyto_mito(10.666),nucl(7)	KKR (151-153, prob:0.621),RLIRRAKAKKKGK (398-410, prob:0.94)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U235	Clr5 domain-containing protein	Medium	14.2	1	46-75	QLRSRLKKWRVTKPSRQTRKKSQDNQQDVN	nucl(23),cyto_nucl(14)	KKWRVTKPSRQTR (52-64, prob:0.658)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAI3	Splicing factor YJU2	Medium	14.3	1	244-265	APPSFARVKKAKKPLPNSLGIK	nucl(23.5),cyto_nucl(14)	ARVKKAKKPLPNSLGIKKKAKP (249-270, prob:0.933)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UD58	Uncharacterized protein	Medium	13.4	1	133-156	LRANNRRSWFKRHQKEFRRAWKDW	nucl(21),mito(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDW1	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.7	2	12-33, 37-62	DLCYTRRIKCDGQKPRCSNCIN, DCTHTALSRKSKPRAQRRSELKKADE	nucl(18.5),cyto_nucl(13),cyto(4.5),mito(3)	KSKPRAQRRS (46-55, prob:0.712)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UFI8	Methyltransf_11 domain-containing protein	Medium	13.2	1	135-154	RQPVRGKPRNVLRRKAPTIG	nucl(20),cyto_nucl(13.5),cyto(5)	GKPRN (140-144, prob:0.626)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJH7	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.6	1	17-50	ESTPEKPPKQACDNCRRRKIKCSRELPCDKCQRL	nucl(14),cyto(6),plas(3),mito(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TX38	NACHT domain-containing protein	Medium	10.2	1	573-593	IEKGTHPKKRPQKVLEFQATT	nucl(13),plas(8),mito(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U0B8	Uncharacterized protein	Medium	10.7	1	224-244	GKVERARKKERGVKERKVVVG	cyto(10),cyto_nucl(6.833),cyto_mito(6.333),plas(5),extr(5),nucl(2.5),E.R.(2)	RARKKERGVKERK (228-240, prob:0.847),RRRVRER (279-285, prob:0.648)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBR6	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.6	2	17-40, 95-118	ADCHTCTSRGQKCDRQRPHCTTCI, FRFVQGGKRDRKRRKVVQPRTTAH	mito(17),nucl(5),cyto(5),cyto_nucl(5)	QGGKRDRKRRK (99-109, prob:0.893)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDD2	RING-type domain-containing protein	Medium	14	1	239-266	IGPERKDIKTHPKPKPRRTQPGLRPTGW	nucl(15),cyto(6),mito(4)	IKTHPKPKPRR (246-256, prob:0.788)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UM02	ChSh domain-containing protein	Medium	13.7	1	19-63	YRAQGGRPEKPQRGKRKSMTGPKQTTEKSEPKRRRKSRAEAATET	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	GRPEKPQRGKRKSMTGPKQTTEKSEPKRRRKSR (24-56, prob:0.971)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2USI7	Uncharacterized protein	Medium	14.5	1	191-214	IAKVEKKDGKRVKKDPKQKSKEED	nucl(13),cyto_nucl(10.499),mito_nucl(9.999),cyto_mito(7.166),cyto(6.5),mito(5.5)	KRPIPISIAKVEKKDGKRVKKDPKQKSK (184-211, prob:0.955),AKNKKRKQSAEDEKLLEGTKKSKKPKAAD (324-352, prob:0.913),AAARKEKLQKQKAK (357-370, prob:0.74),TKAGKKKRKS (385-394, prob:0.894)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEE3	JAB_MPN domain-containing protein	Medium	13.4	3	35-63, 156-182, 473-495	PTVAKFAQKKNEWLRTQRNRFGEKRKGGF, TMWVCMRREKSDRRHFKRMRFPPFDDE, VLNELHKKKPKAQNKQNLLKTLK	nucl(10),cyto(5),mito(4),cyto_pero(4),plas(3),pero(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEH7	ABC-transporter-regulating transcription factor	Medium	14.2	2	59-92, 721-745	NNDAKRRRIARACDMCRKKKIKCDGKMPKCSHCI, LDKAEKESHSKKKRKAAPDEPQDLR	nucl(13),plas(4),mito(2),cyto(2),pero(2),E.R.(2),golg(2),cyto_mito(2),cyto_pero(2)	HSKKKRKA (729-736, prob:0.795)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UH43	Cation_ATPase_N domain-containing protein	Medium	10	2	249-273, 1024-1048	ALRASNSKKRPVKRGPNGETKKRWY, VEAWKWAKRVFFRRRARGQHSLAQA	plas(24),vacu(2)	SKKRPVKRGPNGETKK (255-270, prob:0.829)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UL84	Peroxin/Ferlin domain-containing protein	Medium	13.9	1	25-56	HPWFHSFVRRRRWVRLRVKKASERSRRGRSGF	nucl(17),cyto(6),mito(3),cyto_pero(3)	RRRRWVRLRVKKASERSRRGR (33-53, prob:0.932)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULF5	Uncharacterized protein	Medium	10.5	2	3-25, 173-192	SQVRKPSQRARLQQSQQNRRSRV, PPAIPSVQRRHSRRRTDSSE	nucl(12.5),cyto_nucl(11),cyto(6.5),mito(6)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UTI0	Uncharacterized protein	Medium	13.3	1	1-104	MSPLATLRRSRPRCRVNMCQRRRKRKRNKRQRRRSRRKPRRRMKRRRMKRRRLKAMSLSLKRSTRRRARRRTRRRARRRTRRRRKTTKKRRRRKPIMMMRMQVF	nucl(19.5),cyto_nucl(10.5),mito(7)	RRRKRKRNKRQRRRSRRKPRRRMKRRRMKRRRLKAMSLSLKRSTRRRARRRTRRRARRRTRRRRKTTKKRRRRKP (21-95, prob:1)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAI4	Non-specific serine/threonine protein kinase	Medium	14.8	3	3211-3231, 3460-3483, 3578-3599	MLNIKKQHDQKQEKLNRARQQ, YEYIQKLRRWRDKFEEKLDRRPQS, FNGLLGKRKESRRRNLYFHLPL	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDN2	Uncharacterized protein	Medium	13	1	37-69	QLTQTRKEKPSGRLKGKARKQAKSQKGPATPTY	nucl(13),cyto(10),pero(3)	RKEKPSGRLKGKARKQAKSQK (42-62, prob:0.958)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UN38	DNA repair protein REV1	Medium	14.8	2	34-54, 901-929	FGGHRDYMRRKKIKLQNLDAE, SGSLKLKKPTTPTKRKRGRPSTKAVGNLR	nucl(19),cyto_nucl(14),cyto(7)	KLKKPTTPTKRKRGRPS (905-921, prob:0.913)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQ52	Uncharacterized protein	Medium	14.2	2	116-137, 313-339	VDKYIKFTKKNGTRSQCRKALE, ASNLSPFPKKPKDSKEKDKDTKAKEQE	nucl(18),cyto(7)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URR2	Rab-GAP TBC domain-containing protein	Medium	12.1	1	119-142	NDAARRAARKREWRREDKWTKMAR	mito(11),cyto_nucl(8),nucl(7),cyto(7)	RRAARKREWRREDKWTKMARPTK (123-145, prob:0.902),RK (443-444, prob:0.605)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UT51	Uncharacterized protein	Medium	10.8	1	508-530	AMYMRSYEKRRPDQPEIRQTPTP	nucl(15),cyto(8),mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3G9	Pyruvate decarboxylase	Medium	10.3	1	442-471	PVNTALARNTRRKRRRWPRVGRRSGIRCQA	cyto(12.5),cyto_nucl(12),nucl(8.5),pero(4)	TRRKRRRWPRVGRRS (451-465, prob:0.963)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5J6	GH16 domain-containing protein	Medium	10.1	1	208-232	RKPEDKHWGKGRRRKVRHNIVPKGA	mito(8),extr(7),mito_nucl(7),nucl(6)	PPSPRKPEDKHWGKGRRRKVRH (204-225, prob:0.97)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5X0	Uncharacterized protein	Medium	13.3	1	225-249	GKRGYLTRTARRRRREARAKEEAKA	nucl(18.5),cyto_nucl(10.5),mito(6)	RTARRRRREARAKEE (232-246, prob:0.91)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UF29	Glyco_hydro_63 domain-containing protein	Medium	11.6	1	912-938	DDIFSRSRPRGSRRPSVRRSSTSRSIG	nucl(13.5),cyto_nucl(12),cyto(9.5),mito(2)	RR (924-925, prob:0.608)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URI1	Uncharacterized protein	Medium	13.2	1	715-746	SRGRGRHGGTPDKKQRSKSRTRSLFHRKKSTA	nucl(21),cyto_nucl(14),cyto(5)	RGRGRHGGTPDKKQRSKSRTRSLFHRKK (716-743, prob:0.934)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U206	Histidine kinase domain-containing protein	Medium	14.4	2	291-317, 324-346	GEAPRGKAREQKKHRHKSPVRKFENHQ, EDEADNKKSKRQRPRLSPTTSQL	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(4)	PRGKAREQKKHRHKSPVRK (294-312, prob:0.931)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCW1	Uncharacterized protein	Medium	14	1	19-44	DEARTPTGSPPKKRLRVTRNQKQALI	nucl(23),cyto_nucl(15.5)	RR (101-102, prob:0.605)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKP2	Ubiquitin carboxyl-terminal hydrolase	Medium	14.2	1	550-577	AETSTGPTSRLRRRRKANDRWWRISDEK	nucl(16),mito(6),cyto(4)	RRRRK (561-565, prob:0.672)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UN73	Uncharacterized protein	Medium	10.3	1	2-26	EADLNKKKQAPTRAHRSRKAPPGTV	cyto(8.5),cyto_nucl(8.5),mito(8),nucl(7.5)	KKQAPTRAHRSRK (8-20, prob:0.699)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UNM9	ACB domain-containing protein	Medium	10	2	248-267, 345-365	SGRGKKPPDVDSRRWRRRVE, VKTRLSKLKGLRRVSKVHKCP	mito(9),cyto(9),cyto_mito(9)	KK (252-253, prob:0.601)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URL2	UDENN domain-containing protein	Medium	13.9	2	58-80, 143-166	AAPPAFRPRKCKSQYPRDSSERH, DDDSVGAKKKKKKSKASHGGDGTG	nucl(14.5),cyto_nucl(10),cyto(4.5),mito(4),plas(1),pero(1),golg(1),vacu(1)	AKKKKKKSKA (149-158, prob:0.952)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZK6	BRCT domain-containing protein	Medium	13.2	2	564-590, 608-627	SDANAEEQSRQKRKRNPNPHRRVDIII, TFERDLRRYAKKSRGWKFDS	cyto(12.5),cyto_nucl(12.5),nucl(11.5)	RKR (576-578, prob:0.628)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U7T8	Uncharacterized protein	Medium	13.5	1	78-110	MPSVRSRWQKDPKPSPKPSRGVNKRKRDRSEVI	nucl(19.5),cyto_nucl(11),mito(5)	RSRWQKDPKPSPKPSRGVNKRKRD (82-105, prob:0.937)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U9C2	FCP1 homology domain-containing protein	Medium	13.1	1	393-428	TEPTAVAQARKERRKRRKEQRKARKQEQKLETKTET	nucl(19.5),cyto_nucl(13),cyto(5.5)	RKERRKRRKEQRKARKQEQKL (402-422, prob:0.997)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UC01	Ubiquitin-like modifier HUB1	Medium	13.6	1	168-194	GDERDGRDKKKKEKKEKKNAVPQSSEP	nucl(21),cyto_nucl(12.5),mito(4)	SRSRSPGRRLDRERSDRERPRKNGGGGGGGGGFRWKDKRRDGDSRHDTDERRLNRGYRDREERARSPRRDRDTYRPEDRNKDSDRDRKRPEGDERDGRDKKKKEKKEKK (77-185, prob:0.997)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULA7	Uncharacterized protein	Medium	13.7	1	134-153	QKESERKKRKDDIVRWRERT	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	KRERLLQQKESERKKRKD (127-144, prob:0.849)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQ83	Uncharacterized protein	Medium	10.6	1	85-113	ESTTSTSTPQRHRTPCKRRRNNRARCGRS	nucl(22),cyto_nucl(14.5),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U2Q1	Homeobox domain-containing protein	Medium	14.5	1	110-133	ANWFQNRRAKAKQQKRQEEFERMQ	nucl(26.5),cyto_nucl(14)	RRKRPR (403-408, prob:0.725)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U376	NACHT domain-containing protein	Medium	11.8	1	6-25	LRKLVRKKSSLENNNHRVYT	nucl(19),mito(3),cyto(3),cyto_mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U4K1	Uncharacterized protein	Medium	14.7	2	280-301, 452-474	KEPLSPKTRGRSRKNLRKWTEE, IPEPHFTMKSRRRSRRPFTVAED	nucl(19.5),cyto_nucl(12.833),cyto(5),cyto_mito(3.833)	PKTRGRSRKN (285-294, prob:0.726)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBN7	FCP1 homology domain-containing protein	Medium	11.5	1	170-192	RTESRRRQGSTRKLRSHRSRDSI	mito(10),plas(5),nucl(4.5),cyto_nucl(4.5),cyto(3.5),extr(3)	VKRTESRRRQGSTRKLRSHRS (168-188, prob:0.82),KGLKGSSGNKSRSSKAK (204-220, prob:0.674)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UE85	Uncharacterized protein	Medium	10.7	1	247-273	TPNGGRKVASRKKSRLGRWKHNLNAWE	cysk(16),nucl(7),cyto(3)	GRKVASRKKSRLGRW (251-265, prob:0.854)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMS3	HTH CENPB-type domain-containing protein	Medium	13.1	1	463-492	DDLQQHLRYRKPQDRRKSQKRVKYHGPLTV	nucl(19.5),cyto_nucl(12),cyto(3.5),mito(3)	RRKSQK (477-482, prob:0.646)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U0D9	Uncharacterized protein	Medium	11.6	2	44-64, 553-572	EENLKREIKKLQRYRDQIKSW, ALKNQSWRFHKQYQTWFQRH	nucl(16.5),cyto_nucl(10.5),mito(5),cyto(3.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U262	Uncharacterized protein	Medium	10	1	121-142	SETTPKPRGKPGPKKKPRLDDG	mito(11.5),cyto_mito(9.333),nucl(8.5),cyto_nucl(7.833),cyto(6)	RRKGVPGPKPGAKRGVNQISETTPKPRGKPGPKKKPR (102-138, prob:0.984)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAG5	Uncharacterized protein	Medium	12.5	1	438-464	VAEPDFQQKVKRKKSLRRIRQSTMESS	nucl(19),cyto_nucl(15.5),cyto(8)	KRKKSLRR (448-455, prob:0.72)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAH3	Uncharacterized protein	Medium	11.3	1	2-23	ALTPPFKGRKIRDRIAKLQERV	nucl(24),cyto_nucl(14)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGU3	Transcription elongation factor spt5	Medium	14.4	1	91-115	DEEGAVSRPKKRRRKGGVAHFFEEE	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(2),pero(2)	RPKKRRRKG (98-106, prob:0.923),RKRP (360-363, prob:0.635)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKG8	N-acetyltransferase domain-containing protein	Medium	10.2	1	142-161	AFDMRKPCSRDKNLQHVREN	nucl(15),mito(6),cyto(4.5),cyto_pero(3.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5R8	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.1	1	2-32	SGAQRRKTGCWTCRLRRKKCNEDGQPCSNCE	nucl(22),mito(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5W7	Enhancer of mRNA-decapping protein 3	Medium	12.2	1	64-93	QPASPQKYREREPNSRRRKKDRGSYAEDPS	nucl(11),mito(9),cyto(6)	REPNSRRRKKD (74-84, prob:0.806)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UD61	Methyltransf_11 domain-containing protein	Medium	11.8	2	6-26, 958-982	RSATARCPPPRQARGTRLNTI, WTCLSGWAMKPRQKKPNGSQKNRDS	nucl(13),mito(10),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZP6	Uncharacterized protein	Medium	10.9	1	220-240	QEIEKETRKRRHSRASRLGDP	nucl(16),mito(8),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZQ8	Uncharacterized protein	Medium	11.3	1	212-239	REVSAAFYSRKKKKKKKKQASALAPEAI	nucl(11),cyto(11),cyto_nucl(11)	RKKKKKKKKQ (221-230, prob:0.991)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6D0	Uncharacterized protein	Medium	13.6	1	18-47	DDDHRPQKPSHFWRSSKRWKLPRLRRIILG	nucl(15),cyto(6),mito(3),pero(3)	SKRWKLPR (33-40, prob:0.655)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCW5	Uncharacterized protein	Medium	11.3	1	1523-1545	EDPRTKQLFKNQRQRQSSRRLSQ	nucl(17),cyto(7),mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UF39	Uncharacterized protein	Medium	13.3	1	211-234	ENPAARKKEAKEKKKHMRSLSETI	nucl(22),cyto_nucl(14.5),cyto(5)	ARKKEAKEKKKHM (215-227, prob:0.913)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPR4	Spc7 domain-containing protein	Medium	13.1	1	168-191	MAAARERDEKNRRERERKAILEQR	nucl(17.5),cyto_nucl(11),mito(6)	DEKNRRERERKAILEQREARRKS (175-197, prob:0.863)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UTZ5	Uncharacterized protein	Medium	10.8	1	40-59	AARRRAQTRLNTRAYRKRKA	mito(12),nucl(7),cyto(6)	RKRK (55-58, prob:0.661)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TWR7	Uncharacterized protein	Medium	13	1	262-290	AAEPTEEPKKTTRKKRQNKISAEEKRRSM	nucl(20.5),cyto_nucl(14),cyto(6.5)	KKTTRKKRQNKISAEEKR (270-287, prob:0.85)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TX87	Zn(2)-C6 fungal-type domain-containing protein	Medium	12	1	491-516	VPNKHANKFPRGRKRKHLYEDFKGTG	nucl(14.5),cyto_nucl(10),cyto(4.5),mito(4),plas(3)	KFPRGRKRK (498-506, prob:0.781)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TYR2	Uncharacterized protein	Medium	10.5	1	213-235	DKESKEPKSSEKEVRRKLKESPK	mito(12),nucl(9),cyto_nucl(8.5),cyto(6)	EPKSSEKEVRRKLKESPK (218-235, prob:0.841)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U2L3	Nop domain-containing protein	Medium	12.8	1	306-325	DDKPARKRGGRRARKAKEAV	nucl(20),cyto_nucl(14.5),cyto(7)	KPARKRGGRRARKAK (308-322, prob:0.983)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAV3	Uncharacterized protein	Medium	14.8	4	129-155, 180-207, 470-491, 2741-2766	KTWRTLTKLKEQVKRLHRKIHWLKLVD, VDTRRKMVDRGKLFRRKKYDSGEQRPAE, LVQDRTSSPRGKKRNNHQLISR, ILGNKFSHHRPTKQQQKKYRDIANSA	cyto(6),nucl(5),cyto_mito(5),mito(4),plas(4),extr(4)	RLRAKSSHRTLRSERVSGESKRSKSADAKPRSSDADDSKRGRGRK (1057-1101, prob:0.825)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UF44	Uncharacterized protein	Medium	11.5	2	30-56, 581-606	VTQASWTRPPSKPKPKGPLVNFNRHPD, DTRGLGRKKSKLMKRRSQKMNTYGAL	plas(19),nucl(4),cyto(2),mito_nucl(2)	GRKKSKLMKRR (586-596, prob:0.815)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UFJ1	CBM21 domain-containing protein	Medium	13.3	1	162-181	LTNPTKKQPHPPLSKEARKI	nucl(22),cyto_nucl(14.5),cyto(5)	RKKSGELVRPALRPPSARRR (221-240, prob:0.722)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UM68	TPT domain-containing protein	Medium	12	2	5-25, 129-159	GSSGKGPKKSKIKLGDPNLCN, EETGLTAKQRRQRRRRRKQRRQLDARIAGVK	plas(25)	KK (12-13, prob:0.601),KQRRQRRRRRKQRR (136-149, prob:0.984)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URG0	Uncharacterized protein	Medium	12.4	1	28-64	AGSQYSKDAVKRKRKDQEKRQRKVHLTRRIAKEKIKR	nucl(16.5),cyto_nucl(11.5),cyto(5.5),pero(4)	DAVKRKRKDQEKRQRKVHLTRRIAKEKIKR (35-64, prob:0.985)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U0L0	Uncharacterized protein	Medium	12.4	1	707-738	APSIEQRDLKRSKKSKKGKTKKKSSRSDDWEL	nucl(16.5),cyto_nucl(13.5),cyto(7.5)	LKRSKKSKKGKTKKKSS (715-731, prob:0.993)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U610	Kinesin-like protein	Medium	13.5	1	623-642	ERFRATQKQGGQKRRRALGD	nucl(21.5),cyto_nucl(14),cyto(3.5)	GKRK (386-389, prob:0.627)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U900	Uncharacterized protein	Medium	12.2	1	1-25	MPSYSGKYQKKKRAIPKLSGRPYIM	nucl(11),cyto(9),mito(6)	KKR (11-13, prob:0.619)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U9S4	Uncharacterized protein	Medium	14.3	1	120-146	IPVEEKIKVKKKRKIKKEIKDEIKDKI	nucl(25),cyto_nucl(14.5)	KIKVKKKRKIKKEIKDEIKDKI (125-146, prob:0.989)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UB53	Uncharacterized protein	Medium	10.9	1	179-204	KNGDTSPVKKTDKKPKPGKQGTSGFG	nucl(15),cyto_nucl(13.666),cyto(9),mito_nucl(8.832),cyto_mito(5.832)	DKKPKP (190-195, prob:0.675)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDX5	Protein FYV4, mitochondrial	Medium	10	2	81-101, 221-243	IEPTRQRRYLLRKREKFRNGV, GGERRRAEVRAKKRSEERRKGTA	mito(21.5),mito_nucl(13.166),cyto_mito(12.333)	GERRRAEVRAKKRSEERRKGTA (222-243, prob:0.969)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URL7	Uncharacterized protein	Medium	10.1	1	495-517	CPFCPDQQHKYPRPDNLQRHVRV	nucl(6),extr(5),cyto_nucl(5),cyto(4),E.R.(4),mito_nucl(4)	RGRRRRI (542-548, prob:0.723)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U039	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.9	1	6-33	NSTACLPCKQAKRKCTGRPAPCKACQNT	nucl(18),mito(5),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U1H7	Uncharacterized protein	Medium	11.5	2	128-147, 487-524	RVSRTSSTRRRRPSVRIDAP, VNYPWERTQRSLRKSRIKWKRRLRMDRRRRGISEKVVR	plas(10),cyto(6.5),cyto_nucl(6),nucl(4.5),mito(4)	SLRKSRIKWKRRLRMDRRRRGISEKV (497-522, prob:0.99)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDH2	Lysophospholipase nte1	Medium	10.8	2	374-398, 784-804	QEPYPKPRSQPGKRRRKSVHPDIVA, SATNDTKRKRQSRKSLYLIKP	plas(18),E.R.(3),vacu(3),nucl(2)	KPRSQPGKRRRK (379-390, prob:0.845)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UFN5	Structural maintenance of chromosomes protein	Medium	10.5	1	369-396	ETSRRRLYAKQSRNSRFRNKSERDKWLQ	nucl(19.5),mito_nucl(12),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UHZ6	CCHC-type domain-containing protein	Medium	13.2	1	158-179	TQAAHERKRDWQKKEGRCFRCN	nucl(13),mito(7),cyto(5)	RKRADGGNQGPAGFNRGRKRPRENETPATRPRGSRSSPGQPPFKARR (107-153, prob:0.941)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKM9	Uncharacterized protein	Medium	11.9	1	186-208	VAAKIERRRQKMEKRRLKRASVD	nucl(16.5),cyto_nucl(15),cyto(10.5)	KIERRRQKMEKRRLKR (189-204, prob:0.9)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKZ0	L-ornithine N(5)-monooxygenase	Medium	11.3	2	61-83, 183-209	LVQARHGKQKKVKAEKWHGYTPR, SGCVGKELSKHKKKKKMRSKAVAIGEV	cyto(6),plas(6),nucl(4),extr(4),cyto_mito(4),golg(3),mito_nucl(3)	SKHKKKKKMRSK (191-202, prob:0.961)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UNA6	Uncharacterized protein	Medium	12.7	1	82-109	PTRGRVSAIPRKRRIGRPPKNRPPDWDL	mito(16),nucl(7),cyto(3)	RVSAIPRKRRIGRPPKNRP (86-104, prob:0.949),KRRRGRPAASGGRWARN (126-142, prob:0.876)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPJ8	Uncharacterized protein	Medium	10.6	1	19-38	DLKIQRDKLRQYRKRITDLT	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UA42	Structure-specific endonuclease subunit slx1	Medium	12.6	1	303-324	LQAILRKKKRGDCRVKDVPEKD	nucl(17.5),cyto_nucl(13),cyto(7.5)	KGKTRPRGPAR (111-121, prob:0.728)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UP68	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.4	1	13-59	IDRVLQLKRKQREAKACYPCRQRKVKCDSGHPCRTCQKRGHPHICAY	nucl(23.5),cyto_nucl(13)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URQ9	Uncharacterized protein	Medium	13.5	1	199-224	TESTRSGPYRSLRRPRPRARSFSTIS	nucl(22),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UTR1	Uncharacterized protein	Medium	11.5	1	1-31	MRAKWRKKRVRRLKRKRRKMRARSDQYVLFN	mito(20),nucl(4),cyto(3)	AKWRKKRVRRLKRKRRKMRAR (3-23, prob:0.999),KGGKAEANARRVARLRVPVEFPKVSRGGKR (465-494, prob:0.749)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UV85	Uncharacterized protein	Medium	14.6	5	1-36, 361-381, 1084-1106, 1334-1362, 1392-1411	MARRGRPPRYANRDERNAERRRRRREQGASQIPPPP, GDSGRWRRDRRPVHRIPHLPL, GDCNRTHWEKKPYRTYMRQCFDT, SDSENIRNKRTRAEKKHCRYEKDLRDTHR, QELVKKHKVVHERANQIRKK	mito(14),cyto(7.5),cyto_nucl(7),nucl(5.5)	RRGRPPRYANRDERNAERRRRRR (3-25, prob:0.92)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UC20	PH domain-containing protein	Medium	11.8	2	29-58, 843-865	PIPKGWLQNHRKSWYKTRLKFKNYSSKTVT, NMSGQLFRKPRRHSTFKRCNVIL	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCX4	Exonuclease domain-containing protein	Medium	12.6	1	65-88	GDMPAQRPSKKKRVDGEKTKYPVL	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(3)	KKK (74-76, prob:0.619)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDZ2	Uncharacterized protein	Medium	11.5	1	135-154	QTCQSRFRRLHDLKRHTKLH	nucl(26.5),cyto_nucl(14)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UL58	EAF domain-containing protein	Medium	13.5	1	219-243	TIKPTPSPKPSPKPRPKTQSNPLRL	nucl(22),cyto_nucl(14),cyto(4)	PSPKPSPKPRPKTQSNPLRLPKPAKPAKN (224-252, prob:0.915)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULC5	HET domain-containing protein	Medium	11	1	23-52	PAVPPVLERLRPRRRSRAPVPQKRSHTTFP	nucl(10.5),cyto_nucl(9),cyto(6.5),mito(6),pero(3)	RPRRRSRAP (33-41, prob:0.766)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUT5	Uncharacterized protein	Medium	12.1	2	18-40, 1236-1258	LYSRPVERRSSKKSSSRDRHGMV, LVPTTSRRRARDREHAQQQSREE	nucl(18.5),cyto_nucl(12.5),cyto(5.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAR7	IPPc domain-containing protein	Medium	14.3	1	309-330	LGLPERPQPRRPSPRPTRDTKP	nucl(15),cyto_nucl(11),cyto(5),mito(4)	RAEKPK (225-230, prob:0.64),PPASPRPVPPPVRRSFDERRPHPNALGLPERPQPRRPSPR (284-323, prob:0.748)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEW9	Uncharacterized protein	Medium	10.1	1	637-669	KTITKEERRAESKEKRKQKRRRLAIARAREEEG	mito(12),nucl(7),cyto(7),cyto_nucl(7)	FRPGPRKTITKEERRAESKEKRKQKRRRLAIAR (631-663, prob:0.996)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UI39	Uncharacterized protein	Medium	13.2	1	80-109	DSASTRSDGPPKKKKKKKPLAKSKLSFGDD	nucl(20.5),cyto_nucl(13.5),cyto(5.5)	PPKKKKKKKPLAKSK (89-103, prob:0.993)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UK45	Uncharacterized protein	Medium	12.1	1	93-118	ASCLIRSPRRLTARRRKRAITTLSRT	nucl(11),mito(8),cyto_nucl(8)	RLTARRRKR (102-110, prob:0.723)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKP0	Uncharacterized protein	Medium	13.4	1	149-174	ATNGGKPKASRSKKTKDDVKKVIPTD	nucl(20.5),cyto_nucl(13),cyto(4.5)	GKPKASRSKKTKD (153-165, prob:0.809)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URK0	Carrier domain-containing protein	Medium	11.6	1	1710-1733	VVEIIHKIRRRRRVKRELLDYEFS	nucl(13.5),cyto_nucl(11.5),cyto(8.5),mito(2),pero(2)	KIRRRRRVKR (1716-1725, prob:0.808)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2US47	Protein kinase domain-containing protein	Medium	11.3	1	803-824	RDGEKHIRRKARHQERKENGAY	nucl(12.5),cyto_nucl(11),mito(8),cyto(6.5)	RRKAR (810-814, prob:0.66)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZY9	C2H2-type domain-containing protein	Medium	14.9	2	11-34, 64-90	NQSAPVKKFKCLRCKKDTFKSAIG, DHQRSSHDRRRVPRKKKKAVPNLVTPA	nucl(16.5),cyto_nucl(10.5),mito(7)	HDRRRVPRKKKKA (70-82, prob:0.954)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U0C3	Sterol 3-beta-glucosyltransferase	Medium	12.1	1	285-309	VTIRSGYLHKRGRKNPKYNRYWFSL	nucl(15.5),cyto_nucl(12),cyto(7.5),mito(3)	GRGRRHRRSI (131-140, prob:0.76)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5N8	Uncharacterized protein	Medium	11.3	1	27-58	FDFNSKKPGGPLHRRKKEQKWIRERRLGRGTF	nucl(11),cyto(11),cyto_nucl(11)	KKPGGPLHRRKKEQKWIRERRLG (32-54, prob:0.954)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCR9	Uncharacterized protein	Medium	10.3	1	10-35	LRPAHTITPKKETKKKSRSPTEALES	nucl(7.5),mito(6),cyto_nucl(6),plas(5),pero(4),cyto(3.5)	KKETKKK (19-25, prob:0.674)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UL00	Uncharacterized protein	Medium	10.4	1	337-356	GDKVIIRKPKPKPQSVLGST	nucl(14),cyto(6),cysk(6)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UL89	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	Medium	10.6	1	96-121	GAQGQEAGKKKKKKPTGQNTNRTFGS	cyto(10.5),cyto_nucl(10.5),nucl(9.5),pero(6)	GKKKKKKP (103-110, prob:0.904)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMV8	Protein kinase domain-containing protein	Medium	10.8	1	443-465	MLAFLSRKKGRDRSPKPQEPGVL	nucl(12.5),cyto_nucl(11.333),cyto_mito(7.499),cyto(7),mito(6.5)	KKGRDRSP (450-457, prob:0.678)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UU22	Uncharacterized protein	Medium	13.4	1	478-497	APQTNQQSGNQRQCRKRGRA	nucl(21),mito(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TYJ7	ANK_REP_REGION domain-containing protein	Medium	11.3	1	175-195	DDNPGRIRRRHSRAKDPPPLY	cyto(12),nucl(9),extr(3),pero(3)	RR (183-184, prob:0.606)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TYX3	Uncharacterized protein	Medium	12.1	1	172-192	GTGKRLSKKERERDEEIRKKL	mito(12),nucl(11),cyto(4)	RLSKKERERDEEIRK (176-190, prob:0.694)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U4Z3	Uncharacterized protein	Medium	10	1	169-191	TCAMRRTLVSRKARKRRIAENAE	plas(12),extr(12),E.R.(3)	KARKR (180-184, prob:0.673),PAPPGFVPRGRGAYPARGGYGRGGPYGGPRGPPPGGRGSPMGSMRGGRG (329-377, prob:0.845)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U510	Uncharacterized protein	Medium	12.8	2	58-89, 109-133	IPPITGKRRGGSRKACNECKQQKRITPPKSDV, ECKVEPSFKRISKRRRNAEMEKEIA	nucl(9.5),cyto_nucl(8.5),cyto(6.5),mito(6),plas(3)	R (122-122, prob:0.602)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U575	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.5	1	15-43	SDSNVRKRVCKACDRCRLKKSKCDGGNPC	nucl(25.5),cyto_nucl(13.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UC27	GATA-type domain-containing protein	Medium	13.8	1	376-395	GPDSKKRRGKAAPPGRCHSC	nucl(21.5),cyto_nucl(12.5),mito(3)	KKRRGKAA (380-387, prob:0.776)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEZ3	BHLH domain-containing protein	Medium	12.9	1	345-367	DDTKPRSRRSKSTSYGKNRRMST	nucl(23),mito(2),cyto(2),cyto_mito(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMR0	Sister chromatid cohesion protein	Medium	11.4	1	1748-1773	MSGQNPTKRARGRKPGSGKKRASTES	nucl(11.5),cyto_nucl(9.5),cyto(6.5),mito(6)	RPMKRKSSMSGQNPTKRARGRKPGSGKKR (1740-1768, prob:0.984)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U554	Eukaryotic translation initiation factor 2A	Medium	10	1	527-555	DQPEKLSKSAARNKKKREAKKLKDGEDGQ	cyto(11.5),cyto_mito(10.5),mito(8.5),pero(4)	SKSAARNKKKREAKKLKDGEDGQPARS (533-559, prob:0.983),KGHHER (566-571, prob:0.61)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBI9	SPX domain-containing protein	Medium	12.1	2	136-161, 702-721	FTGFLKAAKKHDRKRGARYRVKPLLQ, WYMYEKRSRLIRQRSGRDLD	plas(13),nucl(6),mito(4),cyto(1),pero(1),E.R.(1),golg(1),cyto_pero(1)	AAKKHDRKRGARYR (142-155, prob:0.851)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEH5	Uncharacterized protein	Medium	13.4	1	145-188	LPEQVQLERPNKKRKKNRPSLERRNRWTRKRPRRRESSESDIGD	nucl(20),cyto_nucl(13),cyto(4)	RPNKKRKKNRPSLERRNRWTRKRPRRRE (153-180, prob:0.995)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEV9	Uncharacterized protein	Medium	12	2	13-42, 111-140	SLAYLPRKRAARHRGKVKSFPKDDPKKPVH, SDEVKRRFYKNWYKSKKKAFTKYAKQHAEE	mito(17.5),mito_nucl(11),cyto(6)	PRKRAARHRGKVKSFPKDDPKK (18-39, prob:0.943),KLPRKTHK (238-245, prob:0.672)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UR22	Protein kinase domain-containing protein	Medium	13.5	1	45-68	RAPLATSRRRPLRRPPPTETCPSP	nucl(19.5),cyto_nucl(11),mito(5)	RRSSPRAPLATSRRRPLRRP (40-59, prob:0.796)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TVY0	Uncharacterized protein	Medium	12.7	1	536-559	RKSALAEDRRKREKRRQRELGGIN	nucl(20),cyto_nucl(15.5),cyto(7)	DRRKREKRRQR (543-553, prob:0.887)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U082	RanBD1 domain-containing protein	Medium	14.6	2	93-112, 127-154	EENGHRRKRSRDSKAEEDEN, QTTNIARKILSPKKKRSRDQLDKDEPKA	nucl(17.5),cyto_nucl(13),cyto(7.5)	PKKKR (138-142, prob:0.679)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U685	MYND-type zinc finger protein samB	Medium	10.2	1	565-595	KWEEFQRQFAKCRRCRRTKYCSKDCQKAAWV	nucl(14),mito(8),cyto(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U933	Uncharacterized protein	Medium	13.4	2	97-129, 801-820	LPLSEFKQREREERKQQKEREKARKEAEKRARA, AFRETAKKKKVDDRATRVAD	nucl(11.5),cyto_nucl(10),cyto(7.5),mito(5)	REREERKQQKEREKARKEAEKRARALAKGK (105-134, prob:0.987)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDT6	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.4	2	1-25, 38-64	MSYRRRQHRSCDQCRKGKRACDALL, RQAYNHSCSNCRKYKRKCTFDWLLSHK	nucl(16),mito(9)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URQ6	Uncharacterized protein	Medium	11.7	1	121-141	ALKHLMPYSPRRNPRNMNRMM	mito(12.5),nucl(12),cyto_mito(8)	EKREGKASRRRGKDS (77-91, prob:0.886)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UA63	Ubiquitinyl hydrolase 1	Medium	14	3	63-89, 847-867, 1028-1047	EAYHTWHIKDWRKLKKKEHGPTFHCAG, ASTGKPKQFIKRNPNQANQTL, KETKERLSKRTGIKGKQFEK	nucl(14.5),cyto_nucl(12.5),cyto(9.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UFA7	Usp domain-containing protein	Medium	12.7	1	639-670	SSVPVMVARKKLKKQSKTKKTNIRLSNNLSTP	nucl(17.5),cyto_nucl(13.5),cyto(6.5)	RKKLKKQSKTKK (647-658, prob:0.829)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGQ7	RRN9 domain-containing protein	Medium	13.9	2	360-384, 399-418	NTAERSQSRGRKRTRRSSARSESSR, SRLGSRRQSKSQNSRPRGRS	nucl(14.5),cyto_nucl(10.5),mito(7),cyto(5.5)	RKRRTIKNTAERSQSRGRKRTRRSSARSESSRQRSHSGHASSGRAPSRLGSRRQSKSQNSRPRGRSAGSDRKRSASR (353-429, prob:0.989)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQS3	DOC domain-containing protein	Medium	12.4	1	271-296	GRDGGWVRKKRRNRARKGGKGKSSAW	nucl(14.5),cyto_nucl(9.5),mito(9)	VRKKRRNRARKGGKGK (277-292, prob:0.991)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCD8	DUF4210 domain-containing protein	Medium	14.1	1	344-367	DQDALRRREKRHRRAESPKCPPGG	nucl(23.5),cyto_nucl(15)	RRREKRHRRA (349-358, prob:0.822)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UE79	Ribonuclease P protein subunit	Medium	13	2	38-74, 224-244	RPTSPTPEDNRDRRRRHRLQKKAYFLRKQKPRPLSAR, QFLNRPVDRANKKFKWRNVDY	nucl(10.5),mito(9),cyto_nucl(9),cyto(6.5)	RDRRRRHRLQKKAYFLRKQKPRPLSAREKR (48-77, prob:0.962)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UHN8	EHN domain-containing protein	Medium	11.4	1	9-36	FTVKIPRERGERLKRKPRDTRLPGQEIV	nucl(12.5),cyto_nucl(11),cyto(8.5),mito(5)	RERGERLKRKPR (15-26, prob:0.822)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUT1	Uncharacterized protein	Medium	14.3	1	7-52	DTDHAQRERSRSPRRRSRSPRRSRRSYSPRSRSRSRDDYRRSERRS	nucl(24),cyto_nucl(14)	ERSRSPRRRSRSPRRSRRSYSPRSRSRSRDDYRRSERRSR (14-53, prob:0.995)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U452	Uncharacterized protein	Medium	11.2	1	228-263	NSKGRDEPPKRENSNRPDRKRERRQKSKRKGPCVIL	nucl(11.5),cyto_nucl(8.5),cyto(4.5),E.R.(4),golg(3),mito(1),extr(1),pero(1),vacu(1)	KGRDEPPKRENSNRPDRKRERRQKSKRKG (230-258, prob:0.992)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UL13	Uncharacterized protein	Medium	11.2	1	95-117	GAQKTVVSRPRHQKKRLGNDLAM	nucl(10.5),mito(10),cyto_nucl(8),cyto(4.5)	AKAKAKPGTGGKS (277-289, prob:0.718)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U1B7	Uncharacterized protein	Medium	13	1	14-41	YLTADPATERPKKKRKKTKEVDTAVQGL	nucl(13),cyto(8),pero(3),mito(2)	RPKKKRKKTK (23-32, prob:0.943)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U2R9	Uncharacterized protein	Medium	13.1	1	52-76	FEVTQRRWLRPRKSGQSSDRRPPLQ	nucl(21),cyto(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UD98	Uncharacterized protein	Medium	10.5	1	250-278	GSSPSIRKTRRETPPRGNNPQSKKSRLNE	nucl(22.5),cyto_nucl(14),cyto(4.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGH5	U-box domain-containing protein	Medium	10.6	1	123-144	LLPCWRRISRLHKGFRRAREDD	nucl(14),cyto(9),mito(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U156	Uncharacterized protein	Medium	13.8	1	16-47	EVELGHVEEKRKKKKKKKKRGGFRPLNHTAAP	nucl(15),cyto(11)	KRKKKKKKKKRGGFR (25-39, prob:0.999)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5K1	Uncharacterized protein	Medium	14.3	1	146-165	EEAPTKKRRRASSSQKPSEI	nucl(17),mito(7),cyto(3)	KRRR (152-155, prob:0.646)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAI7	Uncharacterized protein	Medium	11.7	1	18-37	DTPRVRPLLKSKMNLKNQQN	nucl(14.5),cyto_nucl(12.5),cyto(7.5),mito(5)	RSTPKSAPTLKPAGRSPQAKPCKPFARRSTIAKSRPEPASKK (118-159, prob:0.769)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCJ4	Uncharacterized protein	Medium	12.1	1	30-50	ARYQWKKIENRPSLKRKRNAV	nucl(20),golg(3),cyto(2.5),cyto_mito(2.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDX7	Uncharacterized protein	Medium	14.4	2	16-41, 470-489	STDHDSQDLKKQRRSQRTTDQDQSQT, GKRVHNRPAKAQKREVSPDE	nucl(15.5),cyto_nucl(10),cyto(3.5),mito(3),plas(3)	KSKGKAGKATRR (153-164, prob:0.747)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDY6	Uncharacterized protein	Medium	13.5	1	916-944	DEGWAEMMKKREKKRNNWKMKKETSSFGD	nucl(21.5),cyto_nucl(14),cyto(3.5)	KKREKKRNNWKMK (924-936, prob:0.846)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKR3	NB-ARC domain-containing protein	Medium	10	1	641-668	VEKSPRLKASRDRRPKQRPKFPRSAWGI	cyto(8.5),cyto_nucl(8),mito(7),nucl(6.5),plas(2)	PRLKASRDRRPKQRPKFPRSAWG (645-667, prob:0.958)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U473	Uncharacterized protein	Medium	14.2	1	6-36	QSIPKPKTVFVKGKNTKRRPVIMRRKSSQTS	nucl(24),cyto_nucl(14.5)	GKNTKRRP (18-25, prob:0.689)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U4Y6	ANK_REP_REGION domain-containing protein	Medium	10.7	2	693-716, 794-813	PSVMELRKQKQEPRNQKQEYWRSV, ILFKRYYRSRCLFRTRKGYI	nucl(14.5),cyto_nucl(12),cyto(8.5),mito(1),plas(1),pero(1),cysk(1)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6F1	Uncharacterized protein	Medium	10.9	1	3-25	CDDPKCGCQPYPRKNRKVEIVLY	nucl(17),cyto(4),pero(4),cyto_pero(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U741	SPRY domain-containing protein	Medium	10	1	48-78	ASAQTDGPRSKRNKRDSRKKREAKGLDQEIV	cyto(15),cyto_nucl(13.833),nucl(9.5),cyto_mito(8.999)	PRSKRNKRDSRKKREAKG (55-72, prob:0.969)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBJ9	Ubiquitin carboxyl-terminal hydrolase	Medium	13.2	1	247-272	SVPDRPFPARVSRRRRKSRALQSSVS	nucl(21.5),cyto_nucl(14),cyto(5.5)	VSRRRRKS (257-264, prob:0.774)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UFC3	Uncharacterized protein	Medium	13.4	2	553-579, 2213-2235	DAIRGASKMKKQQRRRQSRAADSEKGH, LSHEVKRFKKLRRRANAVPRVPS	cyto(7),extr(6),nucl(4),E.R.(4),cyto_mito(4),cyto_pero(4)	AIRGASKMKKQQRRRQSR (554-571, prob:0.84),RFKKLRRR (2219-2226, prob:0.708)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UHQ8	Uncharacterized protein	Medium	12	1	164-194	QFLWLKLRSRKWSQFTRPKYRRPRRTNQSGQ	mito(12),nucl(10),cyto(3)	RR (184-185, prob:0.609)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UL47	Uncharacterized protein	Medium	13.5	2	33-59, 1000-1027	YSQSKGLPNWRPSRGRRQWGRQFSVGS, CGGFVYRRNKELKRMKRQRLRGSDITAQ	mito(15),nucl(9),cyto(2)	LKRMKR (1011-1016, prob:0.652)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULU7	Tr-type G domain-containing protein	Medium	13	1	69-93	KSVNYLRNKKAKETKKKESAPAPAA	cyto(13),cyto_nucl(13),nucl(11)	NKKAKETKKKESAPAPAAKA (76-95, prob:0.888),KK (169-170, prob:0.608)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2PIU3	Homeobox domain-containing protein	Medium	11.2	1	162-187	RTALDPKTEKKKMKRFRLTHNQTRFL	nucl(24),cyto_nucl(14.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGA7	Uncharacterized protein	Medium	13.2	2	24-43, 339-358	RSAIRRQTTIRRPSRHSSSA, REINARRDARRRARNAHSTM	nucl(24),cyto_nucl(14.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UII5	RGS domain-containing protein	Medium	12.9	1	248-282	HANTAPERKRRSPESPKKRWPRLHGFTKHFRRSSD	nucl(18),cyto_nucl(12),cyto(4),mito(3)	ERKRRSPESPKKRWPRLHGFTK (254-275, prob:0.943)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UL65	Uncharacterized protein	Medium	11.6	1	358-384	DSGSSSGTPSQKKKRNRASAFFHKLKE	nucl(13.5),cyto_nucl(12.5),cyto(8.5),mito(3)	KKKRNR (369-374, prob:0.712)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPS5	Protein png1	Medium	14.4	2	27-47, 367-386	EQLMRNKRFHRLQEHSRARTH, LEIRRKRRENLSKTDQKRLM	nucl(20),cyto(4),mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQ48	tRNA (guanine(9)-N1)-methyltransferase	Medium	12.1	1	69-121	KDDAPKVSKRQLKKLRRREQWDAQKEQRKTIRKEKTAAKKQRRREALNQARQE	nucl(15.5),cyto_nucl(11.5),cyto(6.5),pero(4)	KVSKRQLKKLRRREQWDAQKEQRKTIRKEKTAAKKQRRR (74-112, prob:0.98)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U4L0	S4 RNA-binding domain-containing protein	Medium	10.6	1	3-23	PVPRVYSKTYKVPRRPFESAR	nucl(15),cyto(7),mito(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U678	Uncharacterized protein	Medium	10.7	1	42-72	LETERARRDRESKNQRRRRRTQRLDVKIGHG	nucl(12),cyto_nucl(10.833),mito_nucl(8.833),cyto(8.5),mito(4.5)	RARRDRESKNQRRRRRT (46-62, prob:0.883)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCM5	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.1	1	21-44	AQACDRCRSKKIRCDGIRPCCTQC	nucl(21),cyto(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJN5	S5A_REDUCTASE domain-containing protein	Medium	10	2	10-30, 278-306	VEPRGKPIKKLPKEIQINPNA, AQMAAWAKKKERRYRKEFGDKYKRKSFVM	plas(17),vacu(3),mito(2),E.R.(2),cyto(1),pero(1),golg(1),mito_nucl(1),cyto_pero(1)	KKKERRYRKEFGDKYKR (285-301, prob:0.866)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2USA7	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.9	1	18-39	VHDGHPPCRRCQRLNRQSCVLT	nucl(16),mito(4),cyto(3),plas(2),pero(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U1L2	Uncharacterized protein	Medium	12.4	1	2-37	EAKRKYNKAVRELRNEKQRQRNRRIRENLERYRNEQ	nucl(16.5),cyto_nucl(12.5),cyto(5.5),mito(3)	LRNEKQRQRNRR (14-25, prob:0.656)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UE94	Uncharacterized protein	Medium	13.7	1	187-215	VTQKNEPKEEPKPRRSQRLTKSRNAPKPV	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	KNEPKEEPKPRRSQRLTKSRNAPKP (190-214, prob:0.887)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UH05	RNA polymerase II transcription factor B 38 kDa subunit	Medium	10.6	1	58-82	NCPVATCHKTLRKNRFRKQTFEDIN	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJF5	Mitochondrial distribution and morphology protein 34	Medium	14.5	1	354-382	LGAGRHSKAHSRKRKKRVVDLRRPKTTSD	nucl(17),cyto(7),mito(2)	RHSKAHSRKRKKRVVDLRR (358-376, prob:0.968)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKQ4	Uncharacterized protein	Medium	13.5	1	45-64	PNPAGEPRARRRRNLSQSGT	nucl(22),cyto_nucl(14),cyto(4)	KEKGKKTENQAEKAKDKKRPPL (508-529, prob:0.883)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZK0	SET domain-containing protein	Medium	10.4	1	561-593	YHSPTVPEAAKKKKKKKKKSKKGKDSAQAGGNT	cyto(14),nucl(6),mito(5)	AKKKKKKKKKSKKGK (570-584, prob:0.999)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3X8	Uncharacterized protein	Medium	11.4	1	174-200	SVEIVQRTEKRKRRARLYYMRQPRHDM	mito(20),nucl(4),cyto_nucl(4)	RKRR (184-187, prob:0.642),GQGGRGRGQKRRR (222-234, prob:0.926)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBF2	Uncharacterized protein	Medium	10.9	1	283-310	YLAYQETYKRCRKRAKRAGGWRHWLFRG	nucl(10),cyto_nucl(9.5),cyto(7),mito(5),pero(3)	KRAKRA (295-300, prob:0.676)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBU7	Non-specific serine/threonine protein kinase	Medium	14.5	1	825-850	PSDSDSVKGKKRFSRRHSKNGLAAVF	nucl(17),cyto(9)	GKKRFSRRH (833-841, prob:0.7)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UIA2	Uncharacterized protein	Medium	10	1	128-149	RNQSRVSKNKSKKQKGQQQTGQ	extr(24),mito(2)	KARKR (42-46, prob:0.637),SRAPSRRPSPRPSASQRPPPPPPTRAASTTSRQGQRGRGRQNERQDNRRGSGSGPSRNQSRVSKNKSKKQK (72-142, prob:0.883)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJR2	Uncharacterized protein	Medium	10.2	1	5-26	EESPAQRAARLRRERREAKIKE	mito(10),nucl(6),cyto(5),pero(3),plas(1),extr(1),E.R.(1)	AARLRRERREAKIKEG (12-27, prob:0.83)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UP28	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.7	1	8-36	NRPTHIKHACAHCRKTKSRCQGDPPCSEC	nucl(20),mito(6)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U353	SWIM-type domain-containing protein	Medium	11	1	88-114	VLARFKTQKTGRHGRGKKKDAHLDAKH	nucl(11),cyto_nucl(10),cyto(7),pero(5),mito(4)	KTGRHGRGKKK (96-106, prob:0.782)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U8V4	AAA domain-containing protein	Medium	13.7	1	14-53	GDGRDDKDKKDKPRYEPPPPPTTRLGRKKRKAAGPSTASK	nucl(21.5),cyto_nucl(13),cyto(3.5)	KDKKDKPRYEPPPPPTTRLGRKKRKAAG (20-47, prob:0.968)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEU7	Protein kinase domain-containing protein	Medium	10.7	1	65-84	VGLPRSTTFKRQNSERRDNL	nucl(21.5),cyto_nucl(13),cyto(3.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGC3	Uncharacterized protein	Medium	10.8	1	60-89	AKYVDKPTGKGPKRRKRPIRKPPDSNFPVL	cyto_nucl(11.5),cyto(11),nucl(10),mito(3)	PTGKGPKRRKRPIRKP (66-81, prob:0.987)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UI09	Uncharacterized protein	Medium	14.3	1	21-45	GTVQVRPKKGKTKEGTPEWRRKLVR	nucl(23.5),cyto_nucl(14)	PKKGKTKEGTPEWRR (27-41, prob:0.734)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJ45	Casein kinase II subunit beta	Medium	14.5	1	22-62	ENDTESHDPRPRKRRKYIAKACNECKRRKIKCNGETPCQRC	nucl(25.5),cyto_nucl(14)	RPRKRRK (31-37, prob:0.773)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJK2	DUF155 domain-containing protein	Medium	12.2	2	19-44, 52-76	TDSREQQTSAQPRRRRSPSTRFITVD, DIPSMQQRHPPQPSRARPRSRIASA	cyto(8.5),cyto_nucl(8.5),nucl(7.5),mito(6),plas(2),pero(2)	RRRKVAPEKAKSYAERLPKARRAEK (199-223, prob:0.83)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPF9	Uncharacterized protein	Medium	10.1	1	132-153	SDCKRAWEENRERRKKKWEAWR	cyto(16.5),cyto_nucl(12.5),nucl(7.5)	RERRKKKWEAW (142-152, prob:0.838)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5V5	RRM domain-containing protein	Medium	14.2	2	58-83, 330-351	ATESWIQRKLRQKQEKKENIEKHLTE, HRDRDRDSYRYRDRDRDRDRGD	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(5)	KGWKPRRFGGG (189-199, prob:0.712)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UFC2	Uncharacterized protein	Medium	10	2	416-440, 443-465	NPQQPNVVKKSRKHRKVRAPGSGET, KSDSTPSKSRRQRTENRAPLQRG	plas(20),cyto(2),extr(2),mito(1),cyto_nucl(1),E.R.(1),vacu(1),cyto_pero(1)	KKSRKHRKVRAPGS (424-437, prob:0.895)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJT7	Uds1 domain-containing protein	Medium	11.3	1	133-153	QMTHKGIKKYPKNNVPNTPES	nucl(23.5),cyto_nucl(14)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQZ2	SWR1-complex protein 5	Medium	14.2	2	73-97, 246-266	EATIQKAKAKKAKKQKGKDEDGDDE, TDIKNTTKIRRPLRKVSRFDP	nucl(15.5),cyto_nucl(11.5),cyto(6.5),pero(3)	KAKAKKAKKQKGK (78-90, prob:0.923)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U578	Uncharacterized protein	Medium	13	1	50-80	KSDKLKLQKDSQTLKRKIRDLEKQLKDQQSD	nucl(20),cyto(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5H9	Transcription factor kojR	Medium	14.4	1	5-68	TDDSGRIRTRQRAKRACETCKLRKRKCDGHEPCTYCLRYEYQCTFKPHPRRKPAASKSSARPSE	nucl(24),cyto_nucl(13.5)	RRK (54-56, prob:0.62)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6L8	Uncharacterized protein	Medium	12.2	1	235-258	KYLGRERAHLRKRRTRLRQHDFQI	nucl(13),cyto(9),mito_nucl(9)	RKRR (245-248, prob:0.658)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAX0	Uncharacterized protein	Medium	12.5	1	93-112	RIVHKTKKGKGKQPEAKKED	nucl(17.5),cyto_nucl(14),cyto(7.5)	KTKKGKGKQPEAK (97-109, prob:0.823)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQB0	Uncharacterized protein	Medium	11.3	1	39-59	CDMPMRKKYRRLRIDSKDKSL	nucl(17),pero(4),mito(3),cyto_pero(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TYA0	Uncharacterized protein	Medium	10	2	15-36, 244-264	VSVVRLKKGKKRFELACYKNKL, NSKSNKKGGKGSKKSARQQDS	mito(24),cyto(3)	APSGGNSKSNKKGGKGSKKS (239-258, prob:0.912)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U0Y0	Uncharacterized protein	Medium	10.4	1	300-321	YISQSLQRCKKRRARVHAEILL	nucl(14),cyto(9),pero(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U1Z7	Fungal_trans domain-containing protein	Medium	12.2	2	16-50, 460-480	DWTWIHKHCRKTGWHPWKRRPVKAARQDQKREELD, AADPRLKQKSKIDFDKCRTFL	nucl(13),mito(8),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U4H8	PCI domain-containing protein	Medium	12.1	1	193-217	ATILSRKINKRYFNRKPKKSPEEIA	nucl(15.5),cyto_nucl(13),cyto(9.5)	KINKRYFNRKPKKSPEEIAKLKKEAEEREK (199-228, prob:0.925)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U519	Uncharacterized protein	Medium	14.2	1	122-164	KVDKTAKRESAKNKKKRSKDDRKEEQKERRKKKQESRKARKAQ	nucl(23),cyto_nucl(14)	KKSKEMKVDKTAKRESAKNKKKRSKDDRKEEQKERRKKKQESRKARKAQ (116-164, prob:0.999)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U528	AWS domain-containing protein	Medium	13.1	1	25-47	NASTEEKPPVRRRSTRVTRASLR	nucl(19.5),cyto_nucl(13),cyto(5.5)	KRSRDVMGKGKELGRRASLRPRTTAPKEEPTKAASEAPAAKKRR (204-247, prob:0.887)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEE9	Uncharacterized protein	Medium	14.6	2	43-64, 143-165	LSPPPPPVKRTRRSPKPTAAAR, EARLQMRMLRRRKDRSARWEESD	nucl(12),cyto(9),cysk(3),mito(2)	KRTRRSPK (51-58, prob:0.662)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJY5	Uncharacterized protein	Medium	10.7	1	588-612	ADSAERKKALKKAKKEQERLEKIEA	mito(11),nucl(7),cyto(6),pero(2)	RKKALKKAKKEQERLEKIEADKRAARKAASTK (593-624, prob:0.976)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TW29	Uncharacterized protein	Medium	10	1	65-101	RFLLRHPRATPPTRRQRGRRPRSQRPQWQPPKDPFVN	mito(17.5),mito_nucl(13),nucl(7.5)	PRATPPTRRQRGRRPRSQR (71-89, prob:0.896)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U592	Protein kinase domain-containing protein	Medium	12.5	1	135-155	RGQSLPTKRRKPRYVALKKIY	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	KRRRVEGERGQSLPTKRRKPR (127-147, prob:0.852)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5Z6	Uncharacterized protein	Medium	12.5	2	82-101, 225-245	QPMEVKRPCKRQKAGSKPSH, TFPIRRPWQTLRRWRLTAKRL	nucl(21),cyto_nucl(13.5),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6R1	Uncharacterized protein	Medium	11.3	1	1-31	MKNKSKGRSKGKGMNKLKKDHTNNNNNNKDS	mito_nucl(12.166),nucl(12),mito(12)	KSKGRSKGKGMNKLKK (4-19, prob:0.848)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBF1	FACT complex subunit spt16	Medium	10.5	1	1015-1034	WDELERKAKKKDRESGLDDE	cyto(15.5),cyto_nucl(13),nucl(9.5)	RKAKKKDRESGLDDEERGKKRKR (1020-1042, prob:0.962)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDN9	Chitin synthase	Medium	10	2	10-32, 94-114	RKLPIPRQSKHYQHVHRDNPSPL, QVMPEVRKKGRRRILIQKYMF	plas(20),mito(6)	KKGRR (101-105, prob:0.657)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UF56	DUF4050 domain-containing protein	Medium	13.3	1	89-115	SPEGDERTERRRKRRRQMEEEMRWNEG	nucl(19.5),cyto_nucl(12.5),cyto(4.5)	RRRKRRR (98-104, prob:0.821)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGV2	EVE domain-containing protein	Medium	14.2	1	25-69	VPDPATGEKRKRGRPRKYPEGSGPKPSPGPKRGRGRPRKDPSAST	nucl(23),cyto_nucl(14)	PATGEKRKRGRPRKYPEGSGPKPSPGPKRGRGRPRKDPSASTPSKPSTPKEGKRPVGRPRK (28-88, prob:0.999)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJS6	Uncharacterized protein	Medium	12.1	2	49-70, 73-96	SQSRNARPQTFRKQSSRPKTIY, AHPASHARHKRLRLRPKLLLQLQR	nucl(19.5),cyto_nucl(13),cyto(5.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UK38	Uncharacterized protein	Medium	10	2	25-49, 181-208	LPNQGHRLVRRSRKTNECYNRPGLR, VFSRKGSKVVRERRQQRERQKQAQEATT	mito(18),cyto(6.5),cyto_nucl(5)	KKPQVKRRPGR (982-992, prob:0.759)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UM92	WD_REPEATS_REGION domain-containing protein	Medium	12.7	2	1-24, 50-70	MDGNNHRSKRRRLDRSPSHENGYI, SWTLQKALPPKRPNTRLRSFS	nucl(17),mito(4),cyto(3),pero(3),cyto_pero(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPH1	NFACT-R_1 domain-containing protein	Medium	14.3	1	137-178	AEKNESLKKKQREERKTREEQRAREKQEKRERERLKWQKVHA	nucl(23.5),cyto_nucl(14)	LKKKQREERKTREEQRAREKQEKRERERLK (143-172, prob:0.961)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQV2	Uncharacterized protein	Medium	13.1	2	21-40, 92-118	ASSSPDKEERPNKNQPPESP, PDVRSKSKTAHSLRRRHKAARENTPRT	nucl(10.5),cyto_nucl(10),cyto(8.5),extr(3),mito(2)	SLRRRHKA (103-110, prob:0.713)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UTQ3	Uncharacterized protein	Medium	11.4	1	403-422	EGSPTYKQRRRRSSIPPGVN	nucl(26),cyto_nucl(14.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUS3	Uncharacterized protein	Medium	12.4	1	422-441	TQPSHPRKFHRKLCVSRPYQ	nucl(20),cyto(7)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXR7	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.2	2	30-53, 57-86	MSYNCQPCVRRKVKCDKAVPSCAS, AKLECLYKAPQPPRKRKRRESEDVHQRLAR	mito(16),nucl(6.5),cyto_nucl(5),cyto(2.5)	PPRKRKRR (68-75, prob:0.844)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U2H1	Uncharacterized protein	Medium	14.2	1	64-92	SVLTIRKIRRSWKRHKREKQDYAAFKNRI	nucl(11),plas(6),cyto(5),mito(2),pero(2)	RKIRRSWKRHKREK (69-82, prob:0.869),KRSPPREIKRTPGGRADSRTPSGKGR (161-186, prob:0.786)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6F2	RRM domain-containing protein	Medium	11.2	1	137-157	GGRGGRGRSRSRERSRSPGAD	cyto_nucl(14.5),nucl(12.5),cyto(11.5)	PSNKGKAGGQRGGGRGGRGRSRSRERSRSP (125-154, prob:0.985)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U8V1	Uncharacterized protein	Medium	12.4	1	15-34	DGDSKKKLGKGKKSGTESPQ	nucl(11),cyto(9),mito(5)	ARLAKRADGDSKKKLGKGKK (8-27, prob:0.926)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAV7	Uncharacterized protein	Medium	10.6	1	166-188	RLSLGMRRDKRKHIYRKTLEDVL	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UG53	DDE_3 domain-containing protein	Medium	10.8	1	110-130	SSKGWSKKAARQKAKERNSDL	nucl(9.5),cyto_nucl(8.5),cysk(7),cyto(6.5),pero(2)	GWSKKAARQKAK (113-124, prob:0.731)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UL99	Uncharacterized protein	Medium	14.7	2	732-753, 962-987	YPQTLIRCNHFKKRRRVESAAS, EARKAEMLRGRKKSHNEERENKEVED	nucl(20),mito(4),cyto(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULF3	Uncharacterized protein	Medium	12.4	2	1004-1036, 1038-1064	IACPTSKNKPQEKTSKKSKKSKEAKDVNKAEEP, QLRNGRWSCNHKCKDKTMCKHLCCREG	nucl(8),mito(7.5),cyto_mito(7),cyto(5.5),plas(5)	PQEKTSKKSKKSKEA (1013-1027, prob:0.863)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPW6	PX domain-containing protein	Medium	14.9	3	129-150, 785-806, 851-873	EDRLEETKRRKLARKCEKLVEL, LIKWHEDRKRWHLNKTRQKMAA, LDPISAERRRRVKQQDQLRRTAG	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQE8	Uncharacterized protein	Medium	12.3	1	118-140	GDSGARPGKKKHRHAHHEIGGAT	nucl(16),cyto_nucl(13),cyto(8)	RPGKKKHR (123-130, prob:0.76)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2US42	Chitin synthase	Medium	14	2	17-95, 146-185	VHSAFRESSRRRRRDSETGGLTDTLSSPTSHRHHHHRRHRSHSSRRKKDVDEERGDMGEEIRRKKSFVKPERSRIDQDH, GNINKPMERAPSRRRTKKRRHSRKISKKASAQERRRQKAL	plas(24),mito(1),E.R.(1),vacu(1)	RHHHHRRHRSHSSRRKKD (48-65, prob:0.885),RRKK (78-81, prob:0.638),ERAPSRRRTKKRRHSRKISKKASAQERRRQK (153-183, prob:0.999)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2USE2	Uncharacterized protein	Medium	11.1	1	67-93	DTITVNGAPKKRKRVRKVNTDRKFECT	plas(15),nucl(8),mito(3)	PKKRKRVRK (75-83, prob:0.873)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUT3	Mtf2 domain-containing protein	Medium	14.6	2	158-179, 403-433	EEVLKDIKQKKKRKTATTGSAD, VNQRDRDLKQHWKRMRNEKRGPRREPWWDLA	mito(13.5),nucl(9),cyto_mito(9),cyto(3.5)	KKKR (167-170, prob:0.66),KRMRNEKRGPRR (415-426, prob:0.776)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXA8	Isoleucyl-tRNA synthetase	Medium	10	1	647-671	GTLLPPLKPRKGKKKQTENQGPVYD	mito(17),nucl(5),cyto(3)	KPRKGKKK (654-661, prob:0.799)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U2J5	HMG box domain-containing protein	Medium	11.2	1	70-123	TTSDSKSEKKKSTKSTKAGKGTKKTTKKAKKSSTAKPKPKPRKQLTEKQKEAKK	mito(16),nucl(10.5),cyto_nucl(6)	SEKKKSTKSTKAGKGTKKTTKKAKKSSTAKPKPKPRKQLTEKQKEAKKTRELR (76-128, prob:0.999)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3Z1	Uncharacterized protein	Medium	13.8	1	67-101	LWRKWEPSRQRQVQRSKFKWKKIMKEREKQRQSHF	nucl(20.5),cyto_nucl(12),mito(3)	RSKFKWKKIMKEREK (81-95, prob:0.781)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U735	Uncharacterized protein	Medium	12.8	1	78-99	GENVLASKKRRAERRQRGGAVD	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	KKRRAERRQRGGAVDGKSTGKKRKR (85-109, prob:0.969)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U8N0	Uncharacterized protein	Medium	12.6	1	9-35	VATKVDRKRITDRKAQRNHRERVKAYI	nucl(19),mito(4),cyto(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UN29	Uncharacterized protein	Medium	13.5	2	31-56, 93-122	THEPKSSTPYRPRSSHRSKINDDWVP, LQPKTASKTTPSRKAKRRANLKLKEKDDRE	nucl(12),mito(11),cyto_nucl(8.5),cyto(3)	SSRLQPKTASKTTPSRKAKRRANLKLKEK (90-118, prob:0.949)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URK4	Uncharacterized protein	Medium	13.2	1	373-402	AQETQSPRKRRSSKNRKRKRRNGASISSSE	nucl(18.5),cyto_nucl(11),mito(6)	PRKRRSSKNRKRKRRN (379-394, prob:0.994)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TY93	Uncharacterized protein	Medium	11.2	1	1-20	MPKKGGKGKNKNKGGKAGGA	mito(13.5),mito_nucl(10.166),cyto(8),cyto_nucl(7.833),nucl(5.5)	KKGGKGKNKNKGGKAGG (3-19, prob:0.949),KLEKRKSGFFGWFKRKLKGEKA (607-628, prob:0.835)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3K3	Clr5 domain-containing protein	Medium	11.5	1	184-208	AESAERWATRKRRRRTRGWAGLPAD	nucl(12.5),cyto_nucl(10),cyto(6.5),mito(4),pero(3)	AKRKERLERLKAESAERWATRKRRRRTRGW (173-202, prob:0.981)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U836	Transcription initiation factor TFIID subunit 8	Medium	10.3	1	18-43	QPNAPDAKRIKRPYHHHHRLQTPVNV	nucl(20),cyto_nucl(14),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U9C0	Uncharacterized protein	Medium	10	1	286-309	TVDARRVERKKPGHVKARKMPTWV	mito(23.5),cyto_mito(14)	RGRGKR (188-193, prob:0.665),RRVERKKPGHVKARKMPTWVKR (290-311, prob:0.935)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UA82	DUF3395 domain-containing protein	Medium	10.1	1	229-259	AWEFGFIRPRERKNRRRVIARRQKELKKLVP	cyto(14),nucl(7.5),cyto_pero(7.5),mito_nucl(6.5)	RPRERKNRRRVIARRQKELKKLVPIK (236-261, prob:0.977)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJB4	Uncharacterized protein	Medium	11.2	1	40-62	DESKPTCTGCRRRGEKCQWRVLG	nucl(24),cyto_nucl(14.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKC3	Uncharacterized protein	Medium	10.1	1	303-326	ISSFQKSQKLKRTRRLDRQTLDRL	nucl(19.5),cyto_nucl(12),cyto(3.5),pero(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UNS7	AMP-binding domain-containing protein	Medium	11.7	1	18-68	GFLCKNQKIREQTAKKKEERRKKREERREKKERKKERKEGKKEGRHLHRYP	nucl(15.5),cyto_nucl(11.333),cyto(6),cyto_mito(5.333),mito(3.5)	TAKKKEERRKKREERREKKERKKERKEGKKEGRH (30-63, prob:0.999)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TX06	Uncharacterized protein	Medium	11	1	302-327	HYRLTLKKGYWKGKSKVKGKNEDPME	mito(7.5),cyto_mito(7.5),plas(7),cyto(6.5),nucl(3)	K (315-315, prob:0.603),K (317-317, prob:0.601)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U0U5	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.7	1	10-39	EPIVRVRTGCYTCRRRKKKCDEVRPSCGGC	nucl(20),mito(6)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBL5	Uncharacterized protein	Medium	12.3	1	310-337	AEARRIEKRDSRRSRKRKERSWEPAWDA	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(5)	RRIEKRDSRRSRKRKER (313-329, prob:0.964)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEZ4	Uncharacterized protein	Medium	13.2	1	29-54	AAGTHASPKKRRKVNHACVYCRRSER	nucl(21),cyto_nucl(14),cyto(5)	KKRR (37-40, prob:0.648)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2US75	Glutamate decarboxylase	Medium	11.6	3	1-24, 149-170, 475-498	MVHLSRVKRGKQAQKPQQEQDQGE, LATLAMKKRWQNKRKAEGKDWT, LRAHSAKKLPQQHAHYKNEKHSLQ	cyto(10.5),cyto_nucl(8.5),pero(7),nucl(5.5),mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUD3	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.9	1	165-188	LACIACRRKKIRCSGEKPACKHCS	nucl(21.5),cyto_nucl(12.5),cyto(2.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	C0STD9	Conidiophore development regulator abaA	Medium	13.9	1	174-197	AEYIYKTTGKRRSRKQVSSHLQVL	nucl(24),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZJ9	RING-type domain-containing protein	Medium	14.2	1	335-359	STENGKESGKKKKKDKETIKPGLVE	nucl(16),mito(10)	SGKKKKKDK (342-350, prob:0.888)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDY8	Actin cytoskeleton-regulatory complex protein pan1	Medium	14.1	1	1103-1125	QQGKIKKQEAKRRKEEADRLAKE	nucl(16),cyto_nucl(12),cyto(6),mito(5)	AKPASKKPPPAPPSRRGR (1015-1032, prob:0.872),IKKQEAKRRK (1107-1116, prob:0.772)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UE08	Uncharacterized protein	Medium	11.3	1	1257-1276	RDYVAARKRRRRIAELNAAK	nucl(12),cyto_nucl(11),cyto(8),mito(5)	RKRRRR (1263-1268, prob:0.712)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQ96	HAD_SAK_1 domain-containing protein	Medium	11.5	1	263-287	EWESQFLNKNHKRRHQQDRDEDTSY	nucl(14),cyto_nucl(12.5),cyto(9),pero(4)	RHHDDGPRRGGSYRGRGRGSGPRGRGHPNRGGQRGRGRGRD (308-348, prob:0.992)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U958	SRP54 domain-containing protein	Medium	12	2	50-72, 193-213	YPVYKKEKYTLKWKKVKEFNLIF, ESIRKGKTPKGGKKMRKWDAD	cyto(12.5),cyto_nucl(7),mito(5),extr(4),E.R.(4)	RRARKA (176-181, prob:0.67),IRKGKTPKGGKKMRK (195-209, prob:0.927)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UD47	Uncharacterized protein	Medium	14.7	1	1-57	MSRRLGRPAKKRDNTQDDCLDRGISNHPRHQTNRRVRSPRKRKVKRDSGKRSGHDIT	nucl(18),plas(4),cyto(2),mito(1),pero(1),golg(1)	NRRVRSPRKRKVKRDSGKR (33-51, prob:0.983)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULT3	Uncharacterized protein	Medium	10.9	1	87-109	TQIDSERPARHHQRKKSAPATPA	mito(15),nucl(9),cyto_nucl(7)	R (415-415, prob:0.603)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZ95	MIT domain-containing protein	Medium	10.2	1	214-236	LTGREQHHGKRRRGHSQKAMLSK	nucl(20.5),cyto_nucl(13.5),cyto(5.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDG2	Uncharacterized protein	Medium	14	1	193-216	AAADLEKKRKEREKNQAKAKDQPA	nucl(14.5),cyto_nucl(10.5),pero(6),cyto(5.5)	PKKKADARGGGPKPGTKQAKAAAEKTAAEAAKKAQP (3-38, prob:0.935),KKRKEREKNQA (199-209, prob:0.775)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJG4	t-SNARE coiled-coil homology domain-containing protein	Medium	10.1	1	361-386	FPRTVETVYRRKRRPSLAPAARSKWV	nucl(17.5),cyto_nucl(10),mito(5),cyto(1.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULS9	Mediator of RNA polymerase II transcription subunit 13	Medium	14.1	1	756-777	SDAPPLPSRKRKRARSNSVGSP	nucl(17),cyto(5),pero(3),cyto_mito(3)	RKRKRAR (764-770, prob:0.766)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UN66	Uncharacterized protein	Medium	12.6	1	76-108	DIPVPAKSAESKKKKKKKNKKKKASPKATDEAA	nucl(16.5),cyto_nucl(11),cyto(4.5),mito(4)	SAESKKKKKKKNKKKKASPK (83-102, prob:0.999)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TYF0	Fungal_trans domain-containing protein	Medium	11.8	1	15-42	KVLECKQLARDVKKKRPSRGCLPANLYR	nucl(19),cyto(3),pero(3),cyto_pero(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U545	Flap endonuclease 1	Medium	13	1	321-358	EEKANLKRKHDEKLQEQKKRKKEEAKAKKEAKARPRGA	nucl(18),cyto(9),mito_nucl(9)	LKRKHDEKLQEQKKRKKEEAKAKKEAKARPRGAG (326-359, prob:0.997)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U611	Uncharacterized protein	Medium	13.3	2	40-64, 74-93	QPSNGASKPAKPPKQPKSKDAPPAA, SPAELKKKAKAEKAARRAKE	nucl(15),cyto_nucl(13.333),mito_nucl(8.999),cyto(8.5)	SKPAKPPKQPKSKDAPPAAGGAPGEEKLSPAELKKKAKAEKAARRAKERAEREASGGAGAGPGPNAAPPKKGSTGGGAGGKEAPGQPYKSQRHRR (46-140, prob:0.997)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U9D9	Uncharacterized protein	Medium	12.1	2	3-30, 630-658	AMKTRRALAKEKQKTKASKDHSEQKEQL, NVYIRRLREISKKGRDYRRNENRLDKANG	nucl(17.5),cyto_nucl(11),mito(6)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UL27	Uncharacterized protein	Medium	10.8	1	33-55	IHNHKNPPKKSPLHNTHNIRQRI	cyto_nucl(11),nucl(10),cyto(10),mito(5)	KTRRIRLPLR (120-129, prob:0.648)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULL0	ENTH domain-containing protein	Medium	10.6	1	162-185	HGSEPQQPRRNERRRRPADEEDVE	nucl(14),mito(6),cyto(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQ39	Uncharacterized protein	Medium	13.4	1	327-348	SNHSCKHKTDSPPYRKHAPQKF	nucl(14),mito(7),cyto(5)	ARKLEKEARDNLRRPPRS (171-188, prob:0.712)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TWR0	Uncharacterized protein	Medium	12.4	1	663-688	AAPAPSSAKPHKEKKEKKHHHFFRRS	nucl(12),cyto(11),mito(4)	SAKPHKEKKEKKHHHFFRRS (669-688, prob:0.953)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U239	Uncharacterized protein	Medium	10.5	1	21-46	YVSWYLPRKEKEKKPNALREQDQKPH	nucl(21),cyto_nucl(13.5),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U7B4	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.9	1	20-49	ELSVACSNCRNRKLRCSKETPACQHCRKTG	nucl(22),mito(2),cyto(2),cyto_mito(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULU3	Serine/threonine-protein kinase ste20	Medium	10.7	1	6-27	FSSLKFRRPSSKLHKDPPSIGS	nucl(22),cyto_nucl(13.5),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UM69	Uncharacterized protein	Medium	14.1	1	391-410	RRGWMDKKWRPQKEPLRQIS	nucl(15.5),cyto_nucl(12),cyto(7.5),pero(3)	LKAGKKPAPK (311-320, prob:0.729),GKARKLK (457-463, prob:0.665)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U1R5	Uncharacterized protein	Medium	12.8	3	1145-1166, 1221-1241, 1265-1290	EHEWKTCKKGSHLRRIDPKLPA, LLDCSKLRIPRQKLRRELGEA, AEASQRFRSRGPRGPQRQNSRQTATT	mito(10),nucl(7),cyto(6),plas(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U2V4	Uncharacterized protein	Medium	12.6	1	135-166	DKDSNKKRKREAEQNGKSKKRSKGKKQSEAVE	nucl(15.5),cyto_nucl(9.5),mito(4),cyto(2.5),golg(2)	NKKRKREAEQNGKSKKRSKGKK (139-160, prob:0.99)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6N1	Nascent polypeptide-associated complex subunit beta	Medium	14.3	1	52-76	NSLKNRGKGTPRRKVKKVHKSSGAD	nucl(23),cyto_nucl(13.5)	KNRGKGTPRRKVKKVHKSS (55-73, prob:0.954)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6Z3	Uncharacterized protein	Medium	13.1	1	176-195	RELRLSTKKWLKERGRDARS	nucl(19.5),cyto_nucl(13),cyto(5.5)	RG (189-190, prob:0.604)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U706	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.9	1	38-71	ETDQCEPCKRYNRTCVRRKPRKNPIQFRPGSRAK	nucl(20),mito(3),cyto(3),cyto_mito(3)	R (58-58, prob:0.6)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UC64	Protein efr3	Medium	11.5	2	2-21, 1118-1140	EGVRQKCRPKHQVLVLKCYP, ADAETRGSRRKARSNTGRRGVSG	plas(14),nucl(4),mito(4),mito_nucl(4)	RRKARSNTGR (1126-1135, prob:0.686)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UF51	Bms1-type G domain-containing protein	Medium	14.5	2	1-31, 47-72	MQHHHRSTTKTSHKPFKTKHASKGALKEKAK, QQLMSKLDRRNQARQKQQVKHQEKAQ	nucl(17),cyto_nucl(10.5),mito(6),cyto(2),pero(2)	HKPFKTKHASKGALKEKAKGKVERGERGTRKT (13-44, prob:0.974)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UH68	Uncharacterized protein	Medium	14	2	600-624, 756-783	DDDCYYNTNKKRNKNRDFNLRKLLD, TETVMRGKGKKGKQSKKKTSSMPSEQLA	nucl(20.5),cyto_nucl(13.833),mito_nucl(11.666),cyto(5)	RGKGKKGKQSKKK (761-773, prob:0.934)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJ66	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit trm6	Medium	12.6	3	151-172, 367-389, 546-565	FSLAKYMLRKRRKYMKRFTVLP, TMKSNKRGAYYRKRNRWTRVQSV, AGNLSRKKRKVVTQETPTTA	mito(16),nucl(7),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJE9	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.7	1	4-36	TSAGRPAKRVRQACEPCRRKKAKCPGEQPVCSL	nucl(20),mito(4),cyto(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUM6	Uncharacterized protein	Medium	14.4	1	30-58	SRQSSIDSNSHPRKRQRRNGKGEPTDARD	nucl(24.5),cyto_nucl(14)	RKRQRR (42-47, prob:0.655)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXB0	Kinesin motor domain-containing protein	Medium	11.2	1	10-29	GLPTRRTTTTRQPTRRLGSL	nucl(16),mito(10)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U0B3	Uncharacterized protein	Medium	10	1	821-853	QRKKGQTIPSWKKHADKKKVRQASKKHAAAKVA	mito(21.5),cyto_mito(13.5),cyto(4.5)	IPRSLRLGDKHGEGKKERLARR (771-792, prob:0.825),KGQTIPSWKKHADKKKVRQASKKHA (824-848, prob:0.938)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3G6	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.4	1	25-70	VMKRRIGPELHQKPRKRATRQDPVSCESCRRKKLKCNRQQPCSSCV	nucl(25),cyto_nucl(14)	KPRK (37-40, prob:0.648)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3U0	Uncharacterized protein	Medium	12.9	1	326-346	AAKSKAKPAPPPPKPKPARFA	nucl(10),mito(7.5),cyto_mito(7),cyto(5.5),plas(1),pero(1),E.R.(1),cysk(1)	KK (164-165, prob:0.612),KSKAKPAPPPPKPKPAR (328-344, prob:0.89)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U465	Uncharacterized protein	Medium	10.4	1	648-670	SSSARGRPGRSSRGKPEKGQTRL	mito(13),nucl(7.5),cyto_nucl(6.5),cyto(4.5)	RGRPGRSSRGKPEK (652-665, prob:0.746)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U503	Uncharacterized protein	Medium	10.4	1	34-53	KTNVNRAKTKRWVEAKKISY	nucl(22.5),cyto_nucl(15),cyto(4.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6E7	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.3	1	113-139	AQQTAQRPPKKKARKNHVPTINRGKKD	nucl(24.5),cyto_nucl(14.5)	RPPKKKARKNHVPTINRGKK (119-138, prob:0.924)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UML1	JmjC domain-containing histone demethylation protein 1	Medium	13.2	3	9-29, 984-1011, 1088-1108	NHSGSRPPRYRTPSPPRRAVE, GPKRVACDACRKRRIRCHHKDEQSDPTP, AGKKGRSKACDDCRKSKVCRC	mito(15),nucl(8),cyto(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMY0	Transcription factor BYE1	Medium	14.3	2	6-33, 115-157	LVTTISRTKPKSKAQPKEKPPKPSVEPT, AAEKRRKEAEEKKASRRRKGKKGGRRGRPSEPKPEPKPEPKTE	mito(14.5),mito_nucl(12.833),nucl(10),cyto_nucl(6.833)	KPKSKAQPKEKPPK (14-27, prob:0.794),KPWEEAAEKRRKEAEEKKASRRRKGKKGGRRGRPSEPKPEPKPEPK (110-155, prob:1)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQY1	Uncharacterized protein	Medium	14.7	2	1-25, 33-54	MPPERQPAQKRRQLPFKPPSRQSSV, ASAKPKPQTKSKIKVPAKKPTT	nucl(16.5),cyto_nucl(9.5),mito(9)	KPKPQTKSKIKVPAKKP (36-52, prob:0.829)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URN2	Probable endonuclease lcl3	Medium	10.8	1	241-266	KGTGLWKGYRRNRKGWESPREYKTRM	nucl(7),plas(7),mito(5),cyto(4),pero(2)	AKRKGTGLWKGYRRNRKG (238-255, prob:0.77)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZD8	Uncharacterized protein	Medium	13.4	1	354-381	RMKPSTETIRPKKEKKRTRKPTALPSGA	nucl(14),plas(5),cyto(3),mito(2),cyto_pero(2)	RPKKEKKRTRKP (363-374, prob:0.95)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U546	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.1	1	40-66	VPKISRKIRACTECKRHKVRCDMKAGE	nucl(22.5),cyto_nucl(12.5),pero(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UB16	60S ribosomal export protein NMD3	Medium	10.2	1	403-434	PDVVLVKKHYTRKKNKSRNWRVKRMAREHEEE	cysk(10),cyto(8.5),cyto_nucl(8.5),nucl(7.5)	TRKKNKSRNWRVKR (413-426, prob:0.842)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEM1	HNHc domain-containing protein	Medium	11.1	1	173-193	TKTSTGRKKSARKLCVKRDDL	nucl(14),mito_nucl(11.333),cyto_nucl(9.333),mito(7.5),cyto(3.5)	KRKA (135-138, prob:0.654)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UTK8	H/ACA ribonucleoprotein complex subunit CBF5	Medium	12.9	1	435-488	GVDESKEDEKKKRKRHEGETPEERAERKRKKKEKKEKKERRKSKQEKEDSDDSD	nucl(17.5),mito_nucl(10),cyto(8)	EKKKRKRHEGETPEERAERKRKKKEKKEKKERRKSKQ (443-479, prob:1)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUP7	C3H1-type domain-containing protein	Medium	10.8	2	382-407, 479-498	GAPTQPRSKKSQKSRRLYQPRSQMAM, SSGSSPRAHRNQFKEKDSKT	mito(14),nucl(10),cyto(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZF5	Uncharacterized protein	Medium	12.4	2	122-145, 298-317	LSPACDKPRISKRKRTSSPPSPSS, DWTSPSTRRREYKKIDRASS	nucl(20),cyto_nucl(13),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3E8	Uncharacterized protein	Medium	10.3	1	90-117	EPRSEPIKEKWQRYQRKKKPGLAKNVLQ	mito(18),nucl(6),cyto(2)	KRIARGEPRSEPIKEKWQRYQRKKKPG (84-110, prob:0.9)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UD92	DNA-directed RNA polymerase	Medium	10	1	1201-1226	SSKIGKAIRAHRRRANHKQAKVQELL	mito(23.5),cyto_mito(13.5)	KALREILAGRKKKDG (500-514, prob:0.792),KAIRAHRRRAN (1206-1216, prob:0.75)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDW5	Uncharacterized protein	Medium	11.2	1	68-92	RCSGATPRCHNCHRRGRQCTYPSST	nucl(16),mito(7),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UER8	KRR1 small subunit processome component	Medium	14.5	1	307-359	EELESAKKEKKEKKEKKRKREAEAEADVDGSEKKEKKKKKSKSKESASSDGES	nucl(25.5),cyto_nucl(14)	KQRVKREEKMKERAKAFVPPEELESAKKEKKEKKEKKRKREAEAEADVDGSEKKEKKKKKSKSK (287-350, prob:0.999)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UN41	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.4	1	51-73	ARQKITRACDHCKEKKTRCTGTL	nucl(16),plas(4),cyto(3),mito(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URY5	Uncharacterized protein	Medium	10.7	1	475-500	NSAVTKRPTASKRRNNRDRYPQSWGC	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZY1	PB1 domain-containing protein	Medium	12.3	1	221-251	VESRRRTRSPNRGSRRANSRRPEVRRFRVKV	nucl(16.5),cyto_nucl(12.5),cyto(5.5),cysk(4)	RRRTRSPNRGSRRANSRRPEVRRFR (224-248, prob:0.923)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U2T8	Calcium-transporting ATPase	Medium	13	3	258-277, 1138-1158, 1187-1214	QKERQFVKLNKKKDDRQVKV, LKRVRGGRLRHLKHKLQHPEE, STPSQPPTPESRSRKRARSRSNSAFGPA	plas(23),E.R.(2)	KRVRGGRLRHLKHK (1139-1152, prob:0.709)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6H0	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.3	1	43-70	ENDLREEKKRQPVKRACNECRQQKLRCD	nucl(19),mito(4),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAU8	Uncharacterized protein	Medium	10	1	2-49	VLAKKHVPIVKKRTKTFKRHQSDRFKCVPESWRKPKGIDSRVRRRFKS	mito(21),cyto(5),cyto_nucl(4)	KKRTKTFKR (12-20, prob:0.707),RKPKGIDSRVRRRF (34-47, prob:0.731)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDE7	Uncharacterized protein	Medium	14.2	1	499-519	LIRRGSFKKHRRGSDARRSIS	nucl(23),cyto_nucl(14)	RRGSFKKHRRG (501-511, prob:0.772)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEF5	2'-phosphotransferase	Medium	13.5	2	8-46, 348-372	YQIHENKKSNPPHPRDKLVRRNKRKQPTIKPLRHHFQHL, EELVKQGNPKGRRNANKKKEDTTQP	mito(15),cyto(5.5),cyto_nucl(5.5),nucl(4.5)	KKSNPPHPRDKLVRRNKRKQPTIKPL (14-39, prob:0.931),KGRRNANKK (357-365, prob:0.67)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UG30	JmjC domain-containing protein	Medium	14.2	2	443-467, 575-594	GSENATPTRKRRKTHKSDACTKGGR, DEVGRLKKHQKEADEKRNKA	nucl(18),cyto(4),mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UI12	Uncharacterized protein	Medium	10.9	1	710-747	VAGRRSQKPETQKRRKQQLEKEKRQKEREERRNKEPAM	nucl(12.5),cyto_nucl(12.333),cyto(11),cyto_mito(7.333)	RRSQKPETQKRRKQQLEKEKRQKEREERRNKEP (713-745, prob:0.968)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKR8	Uncharacterized protein	Medium	11.1	1	84-108	SCPLPSSPTKPRLKRAKVSGEKDEA	nucl(23),cyto_nucl(14.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMR7	FNIP_N domain-containing protein	Medium	14.4	2	314-337, 1003-1027	GFPFPDITKRKKIKEKKTPMYAVA, DARTFTVKRLRLRRKAINNVFWRSP	nucl(11),mito(10),cyto(4)	KRKKIKEKK (322-330, prob:0.739)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQP9	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.1	2	5-24, 55-83	TSPASPTSIGRKRPRPPTEP, FRNVSACNRCRLRKNRCDQRLPRCQSCEK	nucl(11),mito(8),cyto(4),plas(1),extr(1),E.R.(1),vacu(1)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UTM5	Brix domain-containing protein	Medium	13.7	1	18-70	VKPANKLRRQLLHIKRKRLKDSTRRAERYRIKKEEAKNPKLKQERLKRNVPLT	nucl(22),cyto_nucl(13.5),cyto(3)	KPANKLRRQLLHIKRKRLKDSTRRAERYRIKKEEAKNPKLKQERLKR (19-65, prob:0.987)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZ27	Uncharacterized protein	Medium	12.1	1	110-148	LRSPRKGPSIRARRPRPPAKSSAPKLRKGGRPQRSKNTD	nucl(14.5),cyto_nucl(9.5),mito(8),cyto(3.5)	RSPRKGPSIRARRPRPPAKSSAPKLRKGGRPQRS (111-144, prob:0.996)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U0H5	Uncharacterized protein	Medium	11.5	1	226-252	QSWVLAPAKKRRRSVRRDVGRGKKGGI	nucl(14.5),cyto_nucl(10.333),mito_nucl(10.333),mito(6)	AKKRRRSVRRDVGRGKKGGIGEKVSRVNGKGAVKR (233-267, prob:0.985)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U305	Uncharacterized protein	Medium	13.6	1	15-40	ATCTPCAEKVDRRKRMKEAEAARSRR	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	RRKRMKEAEAARSRREKE (26-43, prob:0.829)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U7V5	Polynucleotide adenylyltransferase	Medium	10.3	1	399-418	NGSRRSSNTPHKSNNFRQAS	cyto(9.5),cyto_nucl(9.5),mito(9),nucl(8.5)	GRGGGRG (380-386, prob:0.638)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDY4	Uncharacterized protein	Medium	13.3	2	36-57, 75-100	LQEYQESSPKRRKARNGVSFAL, GKDTGVKTRKRCPARKTRNSVRGMVS	nucl(23.5),cyto_nucl(14)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UFR6	Zn(2)-C6 fungal-type domain-containing protein	Medium	10	1	1-38	MVDKQTKPNSKSRRTSSKRSRTGCRTCRARHLKCDESP	nucl(13),plas(8),mito(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGG2	KH domain-containing protein	Medium	14.2	1	3-39	DDERRVKRSRFDQTEPEPRRASRFDRRSRSPSSRQSE	nucl(23.5),cyto_nucl(14.5)	RRSR (28-31, prob:0.618)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UH01	Uncharacterized protein	Medium	13.1	2	269-290, 453-472	VEDKTKKPMKKKISKATNQTMR, LSKAEARKKKWSKILKFIGR	plas(14),E.R.(4),nucl(3),vacu(3),mito(1),pero(1),golg(1)	KKPMKKK (274-280, prob:0.685),ARKKKWS (458-464, prob:0.737)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UHZ4	TGc domain-containing protein	Medium	11.2	1	168-188	LPPKRQDTKTVQPPPRPRPSP	nucl(11.5),cyto_nucl(9),extr(6),cyto(5.5),mito(2),pero(2)	PRPPPIPVQKPRAPPPLPARKASTESAPALPPRRP (79-113, prob:0.803)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJI4	Homeobox domain-containing protein	Medium	11.5	1	45-72	AARRPQRKSTLTQQQKNNKRQRATQDQL	nucl(26.5),cyto_nucl(14)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJJ9	Uncharacterized protein	Medium	10.2	1	577-596	TVSVPEPQTNKKKGKGKGRR	cyto_nucl(9.333),nucl(9),cyto(8.5),mito_nucl(7.833),mito(5.5)	KKKGKGKGRR (587-596, prob:0.969)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQX2	Uncharacterized protein	Medium	10.8	1	71-97	RDTPEDPSKPKPRGKTKGKPDTRELIS	cyto(11.5),cyto_nucl(11.5),nucl(10.5),mito(4)	KPKPRGKTKGK (79-89, prob:0.837)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URG9	WD_REPEATS_REGION domain-containing protein	Medium	10.1	1	242-265	GGEGEAKKPKKKKKTKANDEFHVD	mito_nucl(9.666),nucl(9.5),mito(9.5),cyto_nucl(8.333),cyto_mito(8.333)	AKKPKKKKKTK (247-257, prob:0.976)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URL8	C2H2-type domain-containing protein	Medium	11.5	1	161-189	IFRRGCDLRKHYNRHRKHLFCRHRGCPQA	nucl(26.5),cyto_nucl(14)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TX61	Uncharacterized protein	Medium	12.8	1	10-43	SGTPAKARGSWRINKRRRRRARQSQRVTESNGQE	nucl(15.5),cyto_nucl(10),mito(7)	KARGSWRINKRRRRRAR (15-31, prob:0.966)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TX94	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.5	1	1-34	MATAIAKRKRARKACIPCHQRKRKCDTVYPCGMC	plas(15),nucl(7),cyto(2),mito(1),E.R.(1),golg(1),cyto_pero(1)	RKRAR (8-12, prob:0.66)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U815	C3H1-type domain-containing protein	Medium	14.7	2	21-48, 401-447	PETEEERTKRLRKEARRKLRVTWKPDDS, SEDDRYSYFKRNKPNGPNKSHPKVGLVPCRYWPEGKCRKGNDCTFRH	nucl(18),cyto_nucl(13.5),cyto(7)	TKRLRKEARRKLR (28-40, prob:0.838)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UA84	Ribos_L4_asso_C domain-containing protein	Medium	14.6	3	101-121, 186-213, 311-337	FAPTKVWRKWHQKLNLNQKRF, AKSRKMRAGKGKLRNRRFRQRRGPLVVY, KGEARTKRANVQKKNPLRNKQVMLRLN	mito(11),cyto(10),nucl(4)	AKSRKMRAGKGKLRNRRFRQRRG (186-208, prob:0.984)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEW7	Lysophospholipase	Medium	12	2	671-692, 801-820	DEEPPPSKRLFQPRNKDHKESD, VYERKKSDRLRREEEEARRR	mito(8),nucl(5),cyto(4),extr(4),plas(2),vacu(2)	RKKSDRLRREEEEARRR (804-820, prob:0.7)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKE6	Patatin-like phospholipase domain-containing protein AO090003000839	Medium	11.2	2	48-81, 669-696	ALNDWRPIYQRVRKNRGRRKKPRRTTDETREGVL, SSRDSCLQPSSNRRNRRRSTGNIFQEMR	plas(18),nucl(3),golg(2),mito_nucl(2)	RVRKNRGRRKKPRR (58-71, prob:0.977)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMG4	Uncharacterized protein	Medium	10.9	1	136-162	KDLERALKEKERYRKKFKELQSPAPSL	nucl(16),mito(4),cyto(3),plas(2),cyto_pero(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMM9	SCA7 domain-containing protein	Medium	13.3	2	107-132, 179-207	RGCIRAKQEKARRKKEARDAANRAKA, GEDDKDKEPKKKKKKEEPKPKVPKPKGPV	cyto(13.5),cyto_nucl(9.5),nucl(4.5),mito(3),extr(3)	AKQEKARRKKEARDAANRAK (112-131, prob:0.933),KSAKKSAVKGMAEDGTKKGKKRKTEGEDDKDKEPKKKKKKEEPKPKVPKPKG (154-205, prob:1)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UNG8	Rick_17kDa_Anti domain-containing protein	Medium	12.5	1	181-218	EDGHHHRHHHHHGHHHHRHKHRHGHRHHSHHGHHRSHS	nucl(19),cyto_nucl(15.5),cyto(8)	HHGHHHHRHKHRHGHRHHSHHGHHR (191-215, prob:0.876)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZU2	Usp domain-containing protein	Medium	14.3	1	236-265	PVIVVRPSTKREKKKKKRLADPTRRNYNHI	nucl(23.5),cyto_nucl(14)	TKREKKKKKRLA (244-255, prob:0.974)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UA83	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.2	1	286-305	CLTCREKKIKCQPNLPKCDQ	nucl(13),plas(9),mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UI76	tRNA-synt_1e domain-containing protein	Medium	13.8	1	497-525	VGEPINKSRSKKLRKGWERQKKAHEAWVA	nucl(15),cyto(8),mito(3)	KSRSKKLRKGWERQKK (503-518, prob:0.898)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMW4	DBF4-type domain-containing protein	Medium	13.5	1	589-626	SNDAGKRRNSIRKGTCQKKKERRRDPKPGYCENCRDKF	mito(14),nucl(9),cyto(3)	RARQQEKKKA (391-400, prob:0.688),KRRNSIRKGTCQKKKERRRDPK (594-615, prob:0.901)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URW3	Valyl-tRNA synthetase	Medium	11.7	2	72-120, 210-229	EKELERERRKAEKAKKFAEKKAKAAAKPAPAPKAQKKEKIEKEKTTDAY, VEKMLWKKEKKTRHDLGREV	cyto(11.5),cyto_mito(10),mito(7.5),nucl(6)	KTEKELERERRKAEKAKKFAEKKAKAAAKPAPAPKAQKKEKIEK (70-113, prob:0.998)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U7G0	Uncharacterized protein	Medium	11.3	2	29-51, 110-132	FLVLGFRHLRRRRLPPRISTVTH, PLFSNRPPSKQRRSPTTQCRQED	nucl(16),cyto_nucl(11.5),mito(5),cyto(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UHF1	F-box domain-containing protein	Medium	11.5	1	867-893	GAADQYKTSKRRFRRGRRGSNSTPEGQ	nucl(12.5),cyto_nucl(11),cyto(8.5),pero(4)	KRRFRRGRR (876-884, prob:0.791)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UII0	Uncharacterized protein	Medium	12.1	1	30-51	LAHNGIRKRIQKQRGQDHDSPA	nucl(14.5),cyto_nucl(10.5),cyto(5.5),mito(5)	SRTRARAHLAHNGIRKR (22-38, prob:0.657)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKG7	Uncharacterized protein	Medium	10.2	1	58-79	SLQPPKPKTRNGGHRHRRTESQ	nucl(20.5),cyto_nucl(13.5),cyto(5.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMM8	mRNA-capping enzyme subunit alpha	Medium	12.3	1	386-407	ASEDEERKRRARQAPPHANGNG	nucl(17.5),cyto_nucl(14),cyto(9.5)	RKRRARQAPPH (392-402, prob:0.764)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UN43	ATP pyrophosphate-lyase	Medium	12	1	1663-1686	EQQILPTSKRTKKPRDMPGDSRLA	nucl(15),cyto_nucl(12.5),cyto(8),mito(2)	KIRRPKAHGPLKHFPGAKGVQEAKSTSKLARRDVSPARR (393-431, prob:0.858)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UN82	Protein SDS23	Medium	13.1	1	487-507	PAESRSRRRRSSSSSLSVRRS	nucl(21),cyto(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2USI2	Uncharacterized protein	Medium	13.4	2	542-565, 652-677	YEEISENRRKRRRLDNSRDPSPVP, NLGYRSPILTRRKRIQPEPKQEEESS	nucl(23.5),cyto_nucl(13.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U752	Uncharacterized protein	Medium	14.6	1	320-341	RFRGIPKTRKSRKVRLLHHCYV	nucl(19),cyto(4),golg(2),cyto_mito(2),cyto_pero(2)	RK (328-329, prob:0.609)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBT3	BHLH domain-containing protein	Medium	14.4	1	260-282	ESQEAKRRRRRASHNLVERRRRD	nucl(23.5),cyto_nucl(13.5)	KRRRRRASHNLVERR (265-279, prob:0.85)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDF0	WD_REPEATS_REGION domain-containing protein	Medium	13.2	1	31-57	IVSDAGVRRKPKKPPPVTPRSFKRFFT	nucl(20),cyto_nucl(13.5),cyto(5)	RRKPKKPPPVT (38-48, prob:0.854)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U030	Uncharacterized protein	Medium	10	1	484-504	DPVEAAAKRKLKKTKKAETEH	mito(9),cyto_nucl(7),nucl(6.5),cyto(6.5),plas(2),extr(2)	AKRKLKKTKK (490-499, prob:0.852)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U937	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	Medium	10.7	2	8-30, 77-99	QTFRCVVRRPIGRRRLCERKFSA, SFYSTLKSKIRKARKRVYLSTLY	mito(21),nucl(2),cyto(2),cyto_nucl(2)	RKAR (87-90, prob:0.631)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBZ3	Uncharacterized protein	Medium	13.3	1	475-500	SEKASAPKKPSNRKTGPKKKGPIDPG	nucl(16),cyto(6.5),cyto_mito(5),mito(2.5)	ASAPKKPSNRKTGPKKKGPIDPGMKR (478-503, prob:0.974)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDP7	AAA domain-containing protein	Medium	10	1	1689-1712	RLNEKFAKEKKWTARNPQHWTVKE	nucl(19.5),cyto_nucl(14),cyto(5.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UFL3	Uncharacterized protein	Medium	13.9	1	272-320	TENHRIREPSTRRHNRRRERRHHAPPTSSSRQSSPRKRDRRSVPGHYTE	nucl(14.5),cyto_nucl(10),cyto(4.5),golg(2),vacu(2),mito(1),plas(1),pero(1),cysk(1)	GPRRKRGLKEKLLGKKH (169-185, prob:0.921),REPSTRRHNRRRERRHHAPPTSSSRQSSPRKRDRR (278-312, prob:0.971)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQJ3	Uncharacterized protein	Medium	11.3	1	9-29	TKDNDLSSKRRRFQPPITSFF	nucl(25),cyto_nucl(14.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UU36	Uncharacterized protein	Medium	14.2	1	152-183	PDDAPRPKRVRNRNKNKKNKNKKKNKDGADTL	nucl(24),cyto_nucl(14.5)	PRPKRVRNRNKNKKNKNKKKNK (156-177, prob:0.996)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUU9	Uncharacterized protein	Medium	12.3	2	369-395, 476-496	ILDRVHKVKQPTRRQLKYRKGPRAGAH, TSYAYRKKEFRSKWGNKFKMI	mito(10.5),nucl(10),cyto_nucl(8.833),cyto_mito(8.666),cyto(5.5)	RK (387-388, prob:0.613)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TX60	Uncharacterized protein	Medium	13.6	2	28-51, 192-218	ITKLRQKNTPWKDIQRKWLKKFGI, CPVCTQICQQRREKNRREKDRSHSAVL	mito(21),nucl(4)	KNRREKDR (205-212, prob:0.659),RLSGKGLGPRRRP (224-236, prob:0.8)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZH4	Histone-lysine N-methyltransferase set9	Medium	12.2	2	37-57, 456-477	RAYFWTNTRKNRTKYIPVRGV, ITDNPQKPKRSRGSRWKHGVVP	nucl(19.5),cyto_nucl(13.5),cyto(4.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U915	Uncharacterized protein	Medium	13.1	1	46-74	VAEGAPKKKKIIRKKRRPARIQVDPATVK	nucl(18.5),cyto_nucl(12.5),cyto(5.5)	APKKKKIIRKKRRPAR (50-65, prob:0.991)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBC2	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.2	1	6-36	VSIRSAPLAKRRKVRRACDFCRQHRVRCDGR	nucl(13),mito(12)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQM4	Uncharacterized protein	Medium	13.4	2	297-318, 733-773	QPSARSLKRRLLRLKRKHESVL, DFAALNKQREERRKKKEAKETKRKEKEERRAKRASERAQRE	extr(6),cyto(5.5),cyto_nucl(5.5),mito(5),nucl(4.5),golg(2),plas(1),pero(1),E.R.(1),vacu(1)	RSLKRRLLRLKRK (301-313, prob:0.775),QREERRKKKEAKETKRKEKEERRAKRASER (740-769, prob:0.998)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQQ9	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.9	1	9-30	KGCGECRSRKIRCDQARPTCSQ	nucl(18),mito(8)	RKAKAGNAGRRARKAPKS (58-75, prob:0.914)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UT28	Fe2OG dioxygenase domain-containing protein	Medium	10.6	1	1-27	MTSTTTTKKQPKTPKMTTQNKNQYHEL	nucl(14),mito(7),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U2L4	Uncharacterized protein	Medium	13.9	2	52-71, 614-641	EYQGRKRKEFEDYVRRNRIN, DIDKIERQMPRRVKKRRKLDDDRYEEYM	nucl(13),cyto(8.5),cyto_mito(7),mito(4.5)	PRRVKKRRK (623-631, prob:0.826)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3U7	Uncharacterized protein	Medium	12.8	1	334-356	YQGLLRTAKAKRKRDRRLSDASW	nucl(16.5),cyto_nucl(10.5),pero(4),cyto(3.5)	AKAKRKRDRR (341-350, prob:0.847)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UP08	GMC_oxred_C domain-containing protein	Medium	11.9	1	404-424	SDGVKRKKWEKLKEGWKERVQ	nucl(11),cyto(7),mito(5),cyto_pero(5)	KRKKWEKLKE (408-417, prob:0.735)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPL1	AB hydrolase-1 domain-containing protein	Medium	10.9	2	21-40, 692-715	SFLARRSKSRSHSINCHPID, LTASLPKSSRRTRRKATMKDSSNS	nucl(15.5),cyto_nucl(13.5),cyto(10.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U1N9	Uncharacterized protein	Medium	11.2	1	153-174	SERSKLYTRKAKKLRTKRSEFI	nucl(10),mito(6),cyto(5),pero(5),cyto_pero(5)	RKAKKLR (161-167, prob:0.685)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U4J4	RNA-dependent RNA polymerase	Medium	13.7	2	10-42, 142-163	LSEREHGRGSRKQRSRKGKKHHKRSSTLGPSSQ, RDSRGKIRFKPPPKTDFWRKGL	nucl(10),mito(9),pero(4),cyto(2),plas(2)	EHGRGSRKQRSRKGKKHHKR (14-33, prob:0.992)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U952	Uncharacterized protein	Medium	11	1	1-22	MLTPIRVRGRRTKRPAPTEDAG	mito(15),nucl(8),cyto(4)	RGRRTKRPAPTEDAGPQLKRSKGRGGR (8-34, prob:0.819)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAH2	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.2	1	36-71	VDAIIRTKRKAREPKACYPCHARKVKCDRNLPCDGC	nucl(18),plas(4),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UE11	Uncharacterized protein	Medium	13.2	2	154-174, 476-501	FDEYWARTRNRDKFKRLRFTP, LEGDVRSSRTKRPRGKKDQVTSEVPW	plas(12),nucl(9),cyto(2),mito(1),E.R.(1),golg(1),vacu(1),cyto_pero(1)	KRPRG (486-490, prob:0.624)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UF10	Uncharacterized protein	Medium	11.6	1	793-822	QGKNASRGRRSQPKGLSRRRRDAPTKLTMP	nucl(10),mito(6),cyto(6),cyto_mito(6)	ASRGRRSQPKGLSRRRR (797-813, prob:0.86)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TYZ1	Uncharacterized protein	Medium	12.9	1	1-28	MAGAKKGKGKSGSKKNNKKSKAQEESEI	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	AKKGKGKSGSKKNNKKSK (4-21, prob:0.963)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U4S1	Uncharacterized protein	Medium	12.7	1	253-274	ASPTIGRIPWRRKSNNPKSLSL	nucl(20),mito(6)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U7R9	Uncharacterized protein	Medium	13.4	1	157-182	NKTAQTPKRRAGRPKGAKNKRSPTPE	nucl(21.5),cyto_nucl(13.5),cyto(4.5)	PKRRAGRPKGAKNKRS (163-178, prob:0.962)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAD8	Uncharacterized protein	Medium	11	1	244-267	ADSFRGKRRKRTSVTSTEERRNKR	nucl(10.5),cyto_nucl(9.5),cyto(7.5),pero(4),mito(2),plas(2)	KRRK (250-253, prob:0.636)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UFW7	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.9	1	50-79	CETASKECRTRPSKRRTRRTRDPLSPLNSG	nucl(9.5),mito(8),cyto_nucl(8),cyto(5.5),pero(2)	KRR (63-65, prob:0.612)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UI08	Uncharacterized protein	Medium	10.5	1	72-94	EDWVNPWKTNRRRAIPPGRSTIR	nucl(22),cyto_nucl(14),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UK30	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.9	1	52-81	KAKRACVFVAPQRRRPRKRTDSRVAQLERE	nucl(17),mito(3),cyto(3),plas(3),cyto_mito(3)	RRRPRKR (64-70, prob:0.693)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URY0	Transcription initiation factor TFIID subunit 2	Medium	13.5	1	663-688	FDIPYNTKYKRLKRNKRQKERAAAAS	nucl(12.5),cyto_nucl(10.5),cyto(7.5),pero(5)	KRLKRNKRQKER (672-683, prob:0.847),KDPNPAKRKREE (1180-1191, prob:0.787)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UT61	Uncharacterized protein	Medium	14.3	2	84-103, 115-143	GDGPVSKKRRRNGCNTTMIA, DHLRCDEEKPCKRCQRRNIQCKVPPKQID	nucl(19),mito(4),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UT88	Uncharacterized protein	Medium	11.3	1	703-728	MDRTRANSPAPPRKHRRDRSSGPSEA	nucl(14.5),cyto_nucl(12.833),cyto(10),cyto_mito(6.333)	SPAPPRKHRRDR (710-721, prob:0.795)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXC2	J domain-containing protein	Medium	12.2	1	454-484	ADAMTKKGKDEKEKKKKEKKSKHEHVEETTA	cyto(14.5),cyto_nucl(13),nucl(8.5),pero(3)	HKKSKKKGA (221-229, prob:0.807),KKGKDEKEKKKKEKKSK (459-475, prob:0.99)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U115	Uncharacterized protein	Medium	13.1	1	191-212	RRSTNPSVKKQLQKSKRTYEAA	nucl(21),mito(3),cyto(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEP7	Origin recognition complex subunit 4	Medium	10.2	2	82-101, 150-170	PSRPGLRSSGRQRKAPQRYE, QTERLTRTRSRRPPVRFTGTE	nucl(11.5),cyto_nucl(10),cyto(7.5),mito(7)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UHJ2	tRNA 4-demethylwyosine synthase (AdoMet-dependent)	Medium	10.4	1	753-774	FDPNDQRVHKKGKKKALQAATE	cyto(12.5),cyto_nucl(7.5),E.R.(5),pero(2),vacu(2),nucl(1.5),mito(1),plas(1),extr(1),golg(1)	PKRVFGKKPLKVAGRRR (97-113, prob:0.787),KKGKKK (762-767, prob:0.711)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULE1	Autophagy-related protein 2	Medium	10.7	1	1666-1687	SQSPSFRKKLRLSRSKYHKMTF	nucl(12.5),cyto_nucl(11.333),cyto(9),cyto_mito(7.833),mito(5.5)	TPKKDPPKRPR (913-923, prob:0.77)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUQ3	MHD domain-containing protein	Medium	10.4	1	259-288	APEEGTTKRKTKKKKKKKVKKSSRAAPAIP	extr(9),nucl(8),mito(8),mito_nucl(8)	KRKTKKKKKKKVKKSSRA (266-283, prob:0.999)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3Q7	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.4	1	42-66	FVCQYLPSRRGGRRKPRHEIVYHHP	mito(13),nucl(6),cyto(4),plas(2)	RGGRRKP (51-57, prob:0.721)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UB80	Uncharacterized protein	Medium	14.5	1	96-125	IARKRFLHLQYKRRNKKKKWVRFTEKDQDD	nucl(25.5),cyto_nucl(14)	LQYKRRNKKKKW (104-115, prob:0.914)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UIW4	Uncharacterized protein	Medium	11.4	1	102-123	GMKALVNKIKKKKKYDLDDFLV	nucl(12),mito(9.5),cyto_mito(8),cyto(5.5)	KIKKKK (109-114, prob:0.731)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMG6	Uncharacterized protein	Medium	12.2	1	256-279	QMERKGKVVKQNSRYTGRKRRPAF	nucl(16),cyto_nucl(12),cyto(6),pero(2),cysk(2)	KAMEHGKMQLPRKGDKAWIMRKKEQMERKGKVVKQNSRYTGRKRRPA (232-278, prob:0.947)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPT3	WD_REPEATS_REGION domain-containing protein	Medium	12.7	2	131-152, 754-776	AAQPRWRPTKRGKDGKWLPPAE, ESMQAAKKSSSQKRKPVNGDTPS	nucl(11.5),cyto_nucl(10.333),cyto(8),cyto_mito(7.333),mito(5.5)	KAGEKGDKK (311-319, prob:0.622)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U010	Uncharacterized protein	Medium	10	1	37-56	QYQNRGPRPRARQNAEDLIK	cyto(13),nucl(6),cysk(5),pero(3),mito_nucl(3)	RGRGQAPGRGGPRGNSQRGGAQRGGGAQRGRGQ (559-591, prob:0.832)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCG5	UDENN domain-containing protein	Medium	10.9	1	645-667	PITLSRSGSRRKRWSNIFLRRDS	nucl(17),mito(4),cyto(4),cyto_mito(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULF6	Uncharacterized protein	Medium	14.3	1	119-146	QRTSSSQGPRRSGRKRRKISNYSKLIDV	nucl(25.5),cyto_nucl(15)	PRRSGRKRRK (127-136, prob:0.896)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UND4	MAGE domain-containing protein	Medium	10.2	1	27-47	QSQGPTPQRRRTSNQNQHQTQ	nucl(21.5),cyto_nucl(14),cyto(5.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQC7	PDCD2_C domain-containing protein	Medium	11.7	1	108-127	ATRKLKSQPAPKKEEKQEPE	nucl(14.5),cyto_nucl(13.5),cyto(11.5)	RKPGSIRALRATRKLKSQPAPKKEEKQEPEKEKEEEK (98-134, prob:0.938)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URD7	Uncharacterized protein	Medium	13.4	1	99-121	APDSSPTKPKRGRPAKRGAKGSP	nucl(14),mito(5),cyto(3),extr(2),pero(2)	KPKRGRPAKRGAKGSPSKKAK (106-126, prob:0.994)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2USD4	Uncharacterized protein	Medium	13.4	1	26-61	DDWKGLTDSKERRRRQNRINQRAYRQRKRAEKLGLP	nucl(20.5),cyto_nucl(13),cyto(4.5)	KERRRRQNRINQRAYRQRKRAE (35-56, prob:0.852)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UTL8	Uncharacterized protein	Medium	13.7	1	14-38	ETSLMPPPPPPKRIKRPATVLNEDV	nucl(21),cyto_nucl(13),cyto(3)	RKKR (394-397, prob:0.661)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U2Q3	Uncharacterized protein	Medium	13.6	1	33-56	GADEHGRRKRGRPPKTPRPSTTAI	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	GRRKRGRPPKTPR (38-50, prob:0.919)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U8V2	CYCLIN domain-containing protein	Medium	10	1	334-362	LASDPDQKKNLRRIRKKLTHCQNPDKAGV	nucl(19.5),cyto_nucl(12),cyto(3.5),mito(2),pero(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKG2	Uncharacterized protein	Medium	12.7	2	140-159, 644-664	KPTDIKKKYMKSSGGRKDSK, EAPRSTHKKKTERDREKERLE	mito(21),nucl(2),cyto(2),cyto_nucl(2)	RRGKKEAK (358-365, prob:0.693),KKKPAP (546-551, prob:0.658)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2USQ5	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.2	1	29-58	VTACQVCRSRRTKCDQKKPRCSFCEKTGAE	nucl(18),mito(7)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UU13	Pre-rRNA-processing protein ipi1	Medium	10.1	1	1-25	MGSSAKKKKEKQKDFTKAKLKVGKA	mito(10),cyto(7.5),cyto_nucl(7.5),nucl(6.5)	AKKKKEKQKDFTKAKLKVGKAKGK (5-28, prob:0.961)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TVY3	ELMO domain-containing protein	Medium	12.4	1	263-284	SGNEARRSKRHNPEKWRRLGFE	nucl(17),cyto_nucl(13.5),cyto(8)	KR (271-272, prob:0.618)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXM7	Uncharacterized protein	Medium	11.4	1	393-417	VASIRPTRSKQQPKRGHRHCNSAPN	nucl(12.5),cyto_nucl(9.5),cyto(5.5),mito(3),plas(2),pero(1),golg(1),cysk(1),vacu(1)	RKRQRAKAVARAKERMRR (236-253, prob:0.85)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZ02	Uncharacterized protein	Medium	14.5	2	15-41, 867-886	ESGVLGPQQSKKQKRQNAKSGAAAQNR, REKLREKKERDAEYEKKYKR	nucl(17.5),cyto_nucl(11.5),mito(5),cyto(4.5)	RLKAEYKRERKGAMRELRKDANFIAREKLREKKERD (842-877, prob:0.907)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U445	Uncharacterized protein	Medium	10.8	2	36-58, 525-549	KVEPSFTRISKRRRNAEMEREIA, VYDTVWRWRHRFRPRKDPSDTQTTT	nucl(12.5),cyto_nucl(9),cyto(4.5),pero(4),mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U830	Uncharacterized protein	Medium	13	1	23-50	TTNSEALPRDKREKKPKKKLQTIDMDAE	nucl(17.5),cyto_nucl(10.5),mito(7)	RDKREKKPKKK (31-41, prob:0.915)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U9L6	Conidiophore development regulator abaB	Medium	11.8	1	74-94	SIHRYQVKKLRRLQSNGSRLA	nucl(17),cyto(6),mito(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGJ4	Vacuolar import and degradation protein 21	Medium	11.5	1	934-954	SLPPVRRRTTQPVRVDRRRSS	nucl(25.5),cyto_nucl(14)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPP8	Uncharacterized protein	Medium	10.8	1	87-113	TDGIDCTPSRRLRRRSTPLPRSRRSLD	nucl(21.5),cyto_nucl(12.5),mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UT82	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.9	1	72-92	EHELCKQRKVKCDRAQPSCGW	nucl(20),mito(3),cyto(3),cyto_mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZ00	ORC_WH_C domain-containing protein	Medium	12.5	1	26-53	VTSAKAHGERPSKRRKVQPEIKEQKSES	nucl(18),cyto_nucl(14),cyto(8)	RPSKRRK (35-41, prob:0.705)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U0G9	Uncharacterized protein	Medium	12.8	1	237-277	NTPANLPRKQKPRSRAQKENYIKVRKHGACEKHRKQHKRAD	nucl(20),cyto_nucl(14.5),cyto(7)	RKQKPRSRAQKENYIKVRKHGACEKHRKQHKRA (244-276, prob:0.872)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U7W9	Uncharacterized protein	Medium	14.3	2	129-148, 412-434	MKPLEKTIKKRDDRKLDYER, VLAAAKKKPPPPPPKRIGSNQGL	nucl(14.5),mito(10),cyto_nucl(9)	KKKPPPPPPKR (417-427, prob:0.804)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULH2	Uncharacterized protein	Medium	14.3	2	45-70, 745-766	SATPTRTSDKPARKRRKVNYAGADET, SDTHDTFKCKRCRPDGAQFIKA	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(3)	ARKRR (56-60, prob:0.685)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6T5	SAGA-associated factor 11	Medium	11.9	1	268-294	PPTITKKKKLGAPKKLSGKKPPPAPSS	nucl(16),cyto_nucl(14.5),cyto(11)	KKKKLGAPKKLSGKKPPPAPSSK (273-295, prob:0.982)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U725	XPG_I_2 domain-containing protein	Medium	12.3	1	32-56	GALPPEKRKTRLLRLEKSRRKLELL	nucl(15.5),cyto_nucl(11),cyto(5.5),pero(4)	KRKTRLLRLEKSRRK (38-52, prob:0.779)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U8R2	CVNH domain-containing protein	Medium	14.9	1	138-157	LEKARRNPKLMERLRRQGKL	nucl(18),cyto(4),mito(2),pero(2)	RREEARQKMLEKARRNPKLMERLRRQGKL (129-157, prob:0.879)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U9I8	Ribosomal_L28e domain-containing protein	Medium	12.3	1	123-150	ARVSAIRRSQKPKKDTPPQKPRGAQARK	nucl(15.5),cyto_nucl(10),mito(7),cyto(3.5)	RRSQKPKKDTPPQKPRGAQARK (129-150, prob:0.866)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEF8	F-box domain-containing protein	Medium	12	1	678-703	AGAAGAGARRRRRRAREAERIYNADD	nucl(10),mito(8),cyto(7)	GARRRRRRAR (684-693, prob:0.91)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TY49	Uncharacterized protein	Medium	13.5	1	29-54	VPKVWEAYPGRRRKRPPGQSVSRTAL	nucl(22),cyto_nucl(14),cyto(4)	RRRKR (39-43, prob:0.708)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZM2	W2 domain-containing protein	Medium	10.9	1	144-173	ETSGKGGKKNKADKKTRREQRNKKNETANG	nucl(10.5),cyto_nucl(10),cyto(8.5),mito(7)	GKGGKKNKADKKTRREQRNKK (147-167, prob:0.964)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U288	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.2	1	43-69	VSMACLACKKSKRKCSGVPPCDNCRAF	nucl(24),cyto(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U599	Uncharacterized protein	Medium	11	2	27-51, 174-195	TLQTRRHQSSYRRTKQRLRVKPDAS, VQSRWGTKRRMAREDRQLRKES	mito(15),nucl(10)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6I6	ENTH domain-containing protein	Medium	12.7	1	145-164	DQIRAERKKARTNRNKFGGF	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	PPRARATKQPEPPKP (241-255, prob:0.683)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAI6	Uncharacterized protein	Medium	13.7	1	83-107	LLKVTVPRRTGRKRKRGSDEPFTGV	nucl(13),cyto_nucl(11.5),cyto(8),mito(3)	RRTGRKRKR (90-98, prob:0.824),RPRRKSGSRR (616-625, prob:0.786)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBA7	Uncharacterized protein	Medium	13	1	1-29	MAYNPQRAPPRAPRRRRPPQPPRYPGSHI	nucl(13),cyto(7),mito(6)	APPRAPRRRRPPQP (8-21, prob:0.897)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UNC9	SWIB domain-containing protein	Medium	14.1	1	173-197	HDGKDAKKNAPKRSKQRFSHFFKTI	nucl(17),cyto(5),mito(3),cyto_pero(3)	PKR (183-185, prob:0.612)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U0Q9	Eukaryotic translation initiation factor 3 subunit C	Medium	12.5	1	159-180	SNSRGFNAVKQRIKKNNKEYAT	nucl(18),cyto_nucl(14),cyto(8)	RGGRGPGRGGQARGGPRLPGGQ (819-840, prob:0.812)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U7N6	Protein kinase domain-containing protein	Medium	11.4	2	569-594, 759-782	EARNAPHQPRKTRKWQFGIRSRNQPY, SDTEWHPISKRFRNKEKEITSPYP	nucl(17),cyto_nucl(13.5),cyto(8)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UD13	Uncharacterized protein	Medium	13.9	1	364-384	HRPIAVARKVAKKRKLYDSGT	nucl(16),mito(7),cyto(4)	WKVKRGSESGKEFKHHRPIAVARKVAKKRK (349-378, prob:0.935)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UE12	Uncharacterized protein	Medium	12.4	1	81-114	FSPNSPSVKIGKRERRRRRREERRDARRGQHEKM	nucl(12),plas(5),mito(3),cyto(2),golg(2),pero(1),cysk(1),vacu(1)	VKIGKRERRRRRREERRDARRG (88-109, prob:0.996)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URJ8	Uncharacterized protein	Medium	10.6	1	67-86	MLRHVFSTPRRRKLLRKLEY	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UTM6	Diadenosine tetraphosphate synthetase	Medium	11	1	132-155	VDEEKEAKKKKKAKETKAVRLDDA	cyto(13.5),cyto_nucl(13),nucl(11.5)	KEAKKKKKAKETK (136-148, prob:0.951)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U2V6	Uncharacterized protein	Medium	12.2	1	293-320	QISYNRVIGKDKKKKKKLLEDVKPKVAS	nucl(15.5),cyto_nucl(11.5),cyto(6.5),pero(3)	KDKKKKKKL (302-310, prob:0.924)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBX9	BTB domain-containing protein	Medium	10.4	1	21-54	NRSFTRSDRVGKPRRSPRKTHRHVKAKKMQEKVE	cysk(9),nucl(8),cyto(8),cyto_nucl(8)	RVGKPRRSPRKTHRHVKAKK (29-48, prob:0.971)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCQ3	Uncharacterized protein	Medium	14.6	2	120-139, 524-544	YTLTKFGRKRRTPAMKQGST, CSWRQERELAFAKRRRRRSSS	nucl(17.5),cyto_nucl(13),cyto(7.5)	KRRRRR (536-541, prob:0.701)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UE06	Uncharacterized protein	Medium	12.5	1	171-194	HSPPLRSGRKKLRHSPCRNDKANG	nucl(21),cyto(3),extr(2),cyto_pero(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UK54	Ubiquitin	Medium	12.1	1	95-130	KNICRKCYARLPPRATNCRKKKCGHTNQLRPKKKLK	nucl(16.5),cyto_nucl(16.5),cyto(7.5)	RPKKKLK (124-130, prob:0.805)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UM98	Uncharacterized protein	Medium	11.5	1	15-37	MAIHCRRRYRLLPSKNPNPNMPP	mito(14),nucl(9),cyto(3)	KKRHARR (281-287, prob:0.699)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPD3	Uncharacterized protein	Medium	12.2	2	2-25, 53-72	EPDTTRRSACDRCRGQKLRCVRLP, CYTTKPVSRRLPQSYTRRRS	nucl(20.5),cyto_nucl(13.5),cyto(5.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQL0	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.2	1	126-151	MQQPLQQKRAYRQRRKDPSCDACRER	nucl(18),mito(5),cyto(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2USV7	Separase	Medium	13.1	1	231-251	QATVRPKTTSRRKNEAQEEEN	nucl(16),cyto(7.5),cyto_mito(5.5),mito(2.5)	RKPRAPAR (1481-1488, prob:0.69)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UTM0	Uncharacterized protein	Medium	10.2	1	144-165	DLFSRHHRSRQSDARKRTFTRM	nucl(19.5),cyto_nucl(13.5),cyto(4.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULL1	AAA domain-containing protein	Medium	14.9	1	190-216	LRNADLKKPAKKKVSPRRKDLRPAAAS	nucl(16),cyto(10.5),cyto_mito(6)	RRKAMPSTLRNADLKKPAKKKVSPRRKDLR (182-211, prob:0.98),EERRSGRKLRVPGQTPRRS (282-300, prob:0.793)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URF9	AAA_16 domain-containing protein	Medium	13.9	2	353-377, 383-407	SSLSARNKRAHHRRRLKLLSKAQAE, SNDPSTPSKKGKRQKTRITKSTLES	mito(9),nucl(5),cyto(4),extr(4),pero(2),E.R.(2)	RNKRAHHRRRLKL (358-370, prob:0.818),KKGKRQK (391-397, prob:0.721)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U2X2	Uncharacterized protein	Medium	13.2	1	47-69	VQSVTMKKKTTRKNGERASSRSQ	nucl(20.5),cyto_nucl(13.5),cyto(5.5)	NMKKAKPRIGIRRL (283-296, prob:0.827)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U961	Uncharacterized protein	Medium	10.4	1	10-32	REAGERKRKEKASKQACTKCKHS	mito(10.5),mito_nucl(10.5),nucl(9.5),cyto(3),pero(3),cyto_pero(3)	EREAGERKRKEKA (9-21, prob:0.837)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCL9	Uncharacterized protein	Medium	11.1	1	5-42	RSTMPKKSSPGQHTRDNKKEKKKPAQAPRRQTNPQTDS	nucl(8),mito(7),plas(6),cyto(3),pero(2)	KSSPGQHTRDNKKEKKKPAQAPR (11-33, prob:0.92)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMT9	AP-1-like transcription factor yap1	Medium	14.3	1	26-46	LSSNQPPQKQQNDKQRSQAKT	nucl(25.5),cyto_nucl(15)	GKKRRESDDKAAKKPGRKPLTSEPTSKRKAQNRAAQRAFRERKEKH (133-178, prob:0.985)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URK3	MI domain-containing protein	Medium	12.3	1	26-52	ASGSRKRSPPSRSPSPNRRRSPPGDSV	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(5)	RKRSPPSRSPSPNRRRS (30-46, prob:0.794)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UT86	UBX domain-containing protein	Medium	12.2	1	343-364	NHNVRNPVAKRKPEKKEKSIDA	nucl(11),cysk(8),cyto(5),mito(2)	KRKPEKK (352-358, prob:0.704)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TVZ0	Uncharacterized protein	Medium	11.8	1	103-128	SLDPTKFRPRHKHKHSKSRDGRFPRI	nucl(13),cyto_nucl(9.5),mito(8),cyto(4)	KFRPRHKHKHSKSRDGR (108-124, prob:0.885)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TX34	Uncharacterized protein	Medium	14.2	1	4-31	RSESWKASQLEKKRKARRELRQQRGYDA	nucl(16),cyto(6),mito(4)	EKKRKARRELR (14-24, prob:0.87)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAR0	Uncharacterized protein	Medium	11.8	1	95-116	AVKRNISSKKRRTLQRRQTILH	nucl(10),mito(9),cyto(7)	SKKRRTL (102-108, prob:0.702)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBZ8	Uncharacterized protein	Medium	10.6	1	243-287	LSRHLQTTNKDKHNKRNLRLLVHKRQKLLRYLRRKERGGPRWQHL	mito(16),nucl(9),cyto_mito(9)	NKRNLRLLVHKRQKLLRYLRRKERGGP (256-282, prob:0.831)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UC38	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.2	1	1-33	MEQTTRIRKRVPKSCRRCHRRKQRCVGFPTCAN	nucl(18),mito(7)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEL4	RING-type domain-containing protein	Medium	10	1	619-645	YALLLLRSRIRRRRWRAPKSLVDRLPV	extr(16),plas(5),E.R.(3),mito(2)	RIRRRRWRAP (627-636, prob:0.786),KSSKKEK (704-710, prob:0.65)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UHY9	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.9	1	107-134	KRVSTACDFCRKRKKKCDFRYPNCSACT	nucl(18),mito(6),cyto(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUX6	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.8	2	7-30, 39-61	SGGCVTCKQRRVKCDEAKPECQAC, GYNRHQNTKLKFKDQNHKFCTNT	nucl(15),mito(9),cyto(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6R6	Ubiquitin carboxyl-terminal hydrolase	Medium	12.8	1	395-416	DVERARKRQKLDRQRDEEKKTE	nucl(16.5),mito_nucl(10),cyto(8)	RARKRQKLDRQR (398-409, prob:0.745)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBM4	WD repeat-containing protein jip5	Medium	13.8	2	64-83, 381-412	IDTMWRTRRHKGSCRCLTFG, DSDGERRRADEAKRKRKKGKGKDRSGGQHVMA	cyto(12),nucl(10),extr(2),pero(2)	RRRADEAKRKRKKGKGKDR (386-404, prob:0.995)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGL7	Aa_trans domain-containing protein	Medium	10	2	325-349, 634-655	LLRPETPGRRKRKPRGGTGNNTRTG, FTRSGKYNPRIKWQKNCFRFFL	plas(27)	TPGRRKRKPRG (330-340, prob:0.931)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKU7	DNA ligase	Medium	11.3	1	1-22	MSSPAKKRKRDVPVSSPYRNRS	nucl(11.5),mito(9),cyto_nucl(7.5),cyto(2.5),plas(1),pero(1),cysk(1),vacu(1)	KPAKGGRRK (624-632, prob:0.686)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6U6	Uncharacterized protein	Medium	10.7	1	625-648	LHYRIIYSVRTKPRPKRSIFGENG	nucl(22),cyto_nucl(13.5),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBP5	Uncharacterized protein	Medium	12	1	676-700	RVSFASPDTSPKRKKDHKRKSSGGQ	nucl(13.5),mito(12),cyto_nucl(8)	PKRKKDHKRKSSG (686-698, prob:0.926)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UFL0	ATP-dependent RNA helicase dbp9	Medium	14.5	1	560-589	FVSFRKQNENRIRKAREKNRGKGNGRKFAG	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	KRRK (366-369, prob:0.622),NRIRKAREKNRGKGNGRKFAGVKKKVDPLKTFNRGRK (569-605, prob:0.994)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UHC6	Uncharacterized protein	Medium	11.2	1	282-301	FTRRSNCREHMKRHDPSLRK	nucl(24),cyto_nucl(14.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJV3	Uncharacterized protein	Medium	11.3	1	644-663	STTSKPPSSPGKGHKRRSSL	nucl(23.5),cyto_nucl(14)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXH6	Uncharacterized protein	Medium	13	3	93-112, 228-249, 251-270	SWNKCKCIKKCDGPDRHCKP, NWDKCQCKKVCHQADPHCKPQD, DWNNCRCRGKWCDNFQPNCN	extr(9),nucl(8),mito(5),pero(2),cyto(1),E.R.(1),vacu(1)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXY5	Uncharacterized protein	Medium	10.1	1	146-168	EKEWTKGKKPERKTSKETKHEAK	cyto(14.5),cyto_nucl(13.333),nucl(9),mito_nucl(6.499)	KGKKPERKTSKETK (151-164, prob:0.808)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXZ4	Uncharacterized protein	Medium	13.1	2	69-95, 603-626	GETLPSFRPHPSKRKRRIVIHSSPYLR, GLWGSRPSKEPHVKRRWTVTERRV	nucl(10),mito(7),cyto_nucl(7),cyto(4),extr(4)	KRKR (81-84, prob:0.657)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZR3	Uncharacterized protein	Medium	11.7	1	255-283	AGSTNSSRSHSHRKRRRHRSNSRVCQSLN	nucl(10),cyto(9),pero(4),mito(2),plas(2)	HRKRRRHR (266-273, prob:0.819)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZY5	Uncharacterized protein	Medium	14.4	1	28-49	VTASNAKPGKKRRPDEDRLMSA	nucl(16),mito(9)	SAPAPSKPKKAIRTPSAPARVTASNAKPGKKRRP (8-41, prob:0.924)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U9G8	Uncharacterized protein	Medium	10	1	5-24	CTFFQPQKKRGPTGHRVSQI	nucl(13),mito(6),cyto(5),plas(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UN91	Rick_17kDa_Anti domain-containing protein	Medium	10.3	1	161-180	EDAMKKYKGKKEHEQQQQEY	nucl(20),cyto_nucl(14),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UP64	PNP_UDP_1 domain-containing protein	Medium	10.2	1	507-534	VSSASKPPVPPRSKKPRGYISRRNTQIP	cyto(9.5),cyto_nucl(9),nucl(7.5),mito(4),plas(4)	PRSKKPR (517-523, prob:0.694)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPQ2	1-phosphatidylinositol-3-phosphate 5-kinase	Medium	13.9	1	422-442	EVPPKESKKALVKNKPKERLL	nucl(13.5),cyto_nucl(11),cyto(7.5),mito(3)	K (430-430, prob:0.606),KNK (434-436, prob:0.608)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQN9	Uncharacterized protein	Medium	12.9	1	105-131	TDSSLSPSTQKRRKTRKDRGLHVEPVF	nucl(18.5),cyto_nucl(11.5),mito(4),cyto(3.5)	RRKTR (116-120, prob:0.641)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UTR7	BAR domain-containing protein	Medium	13.9	1	392-423	AIQKKAPPPPPPSRAKKPPPPPPPMKKPILNA	nucl(22.5),cyto_nucl(13),cyto(2.5)	KKAPPPPPPSRAKKPPPPPPPMKKP (395-419, prob:0.979)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUR6	Uncharacterized protein	Medium	10.5	1	75-94	PTTHRISKAKKGKRVHACEY	nucl(20.5),cyto_nucl(13.5),cyto(3.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3R3	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.7	2	2-28, 30-55	DLLHIPPKERKSRTSRPKVRTGCVTCK, SSTNSQLDRARRKKCDEARPHCRTCV	nucl(16),mito(3),cyto(3),plas(3),cyto_mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDX8	Uncharacterized protein	Medium	10.5	1	1589-1614	ISGKLRPYIKRSKPEKKEKIEEELRK	cyto(11.5),cyto_nucl(10.5),nucl(8.5),mito(4)	YIKRSKPEKKEK (1596-1607, prob:0.814)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKT4	Spindle pole body component	Medium	13	1	954-977	YEPVRKRRTATSSRDKERLRRKAA	nucl(13),mito(10),cyto(3)	RKRRTATSSRDKERLRRKAAEGNAQKEMKKERR (958-990, prob:0.933)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULS4	Uncharacterized protein	Medium	14.2	1	164-185	DGVKGNKKGKDKQQKDKTLTQM	nucl(24),cyto_nucl(14.5)	RGDGPSKRGLRKSGDGVKGNKKGKDKQ (150-176, prob:0.928)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQE5	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.6	2	155-179, 182-212	TATPVNVPRKRGRPRKHPLPIPGGQ, ITKGRSKTGCITCRRRKKKCDETKPSCLNCQ	nucl(12),cyto(4),mito(3),E.R.(3),plas(2),golg(2)	PRKRGRPRKHPLPIPGGQLKITKGR (162-186, prob:0.947)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UT75	Ribosome biogenesis regulatory protein	Medium	13.6	1	188-220	IRGMSRAERKERIRRNERKMRNNERKSRKSGGG	mito(13),nucl(11.5),cyto_nucl(7.5)	PLPTPKPPTKWELFARKKGIGRFSGKAGAGLAEKERRKK (102-140, prob:0.929),KGSSIRGMSRAERKERIRRNERKMRNNERKSRKSGGG (184-220, prob:0.991)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U605	Uncharacterized protein	Medium	12.1	1	34-56	NPYGSPRPSSKRHSRKASYAGTP	nucl(14.5),cyto_nucl(10),mito(6),cyto(4.5)	RARR (189-192, prob:0.625)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U688	Uncharacterized protein	Medium	11.7	1	149-168	SEEGSKKKKRTEKSVDMDKL	nucl(13.5),cyto_nucl(12.5),cyto(10.5)	ASEEGSKKKKR (148-158, prob:0.824)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U853	RING-type domain-containing protein	Medium	10	1	33-52	YAPSQRRRCHMPTNARNRKT	nucl(13),mito(10),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBW0	Histone transcription regulator 3 homolog	Medium	14.9	2	239-260, 455-475	CQVPIKKPKKALLKFLKRQSDP, QTESVRSKSRRTRLRESHAEA	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	GRTKGIARRD (1801-1810, prob:0.656)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UFB3	Uncharacterized protein	Medium	10.5	1	589-610	YESLRERERERDREKNKYNDYL	nucl(22.5),cyto_nucl(14),cyto(4.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UL48	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.7	2	47-67, 616-635	NVPPRSSLPGKKQYKNAKVAI, RPCLCRRDARHTSPQQKPSF	nucl(21.5),cyto_nucl(13),cyto(3.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPU7	C2H2-type domain-containing protein	Medium	13.5	2	4-29, 139-161	AQPVDESDRRHPRRRVLNRPPPSLSS, PTPQEPKESHKKIRRVNHHTSDS	nucl(25.5),cyto_nucl(14)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TWF0	Uncharacterized protein	Medium	14.8	1	8-38	DTLSASERKRMRDRKARKVAREKRDTRIKAL	nucl(17),mito(5),cyto(3)	RKRMRDRKARKVAREKRDTR (15-34, prob:0.971)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U2G8	FAM192A_Fyv6_N domain-containing protein	Medium	11.6	1	105-129	GEDWKIPARKRRRDKKDLLFPGKKR	nucl(18),cyto_nucl(14.333),mito_nucl(9.999),cyto(7.5)	IPARKRRRDKKDLLFPGKKRK (110-130, prob:0.97)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBY2	Uncharacterized protein	Medium	10.8	1	32-55	PPTSVPLSKRDKRRSALQERLQDL	nucl(15),mito(6),cyto(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCL8	Uncharacterized protein	Medium	13.7	1	283-310	FESTSASKKKSKTKKRQKKVRSWAGAIL	nucl(12.5),mito(11),cyto_nucl(8),cyto(2.5)	GKRRHAHR (61-68, prob:0.679),SKKKSKTKKRQKKVRSWAGAILTRGKGKRHS (289-319, prob:0.995)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKX2	BZIP domain-containing protein	Medium	12	1	100-133	RVLLWTRAEKKEKREKKKKKKKKKENPMVSMVDT	nucl(14.5),cyto_nucl(11),cyto(6.5),mito(4)	AEKKEKREKKKKKKKKK (107-123, prob:1)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UL32	zf-primase domain-containing protein	Medium	12.6	1	51-71	AIEARLKLKQLQKNRGRPGTS	nucl(17),cyto_nucl(13),cyto(7)	GKGKGEGPRK (573-582, prob:0.678)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULA0	DNA-directed RNA polymerase subunit	Medium	12.4	1	127-146	ALRMRDPKRRFDHIWRLSKD	nucl(11),cyto(8),mito(6)	NRPVKAIRSRLKGKEGRL (334-351, prob:0.809)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQQ1	Uncharacterized protein	Medium	10.8	1	11-37	QQPGNTQRPRSPRKHTRSATKTRVAPQ	nucl(15),mito(6),cyto(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZI6	Protein kinase domain-containing protein	Medium	13.3	1	781-809	LRGDIQRSKVPRKKRRRPAKSGPERNDVP	nucl(19),cyto_nucl(12),mito(5)	RSKVPRKKRRRPAKSGP (787-803, prob:0.986)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U313	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.4	1	10-34	HKACDACGRRKVRCNGQQRCQQCEH	nucl(14),mito(6),cyto(4),pero(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3X4	Uncharacterized protein	Medium	11.3	1	116-139	DWEDKFFWGRRKKKTREAQVAAEI	nucl(9),plas(8),cyto(5),mito_nucl(5)	KK (127-128, prob:0.615)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U9W3	General transcription and DNA repair factor IIH	Medium	13.3	1	26-49	RSEGSASRAKRRKQRGGAEWEVSR	nucl(19.5),cyto_nucl(12.5),cyto(4.5)	SRAKRRKQR (32-40, prob:0.788)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBV5	Uncharacterized protein	Medium	11.7	1	487-508	EEEEKSRAKKPKKTIGSRIVGF	cyto(9.5),cyto_nucl(8),mito(6),nucl(5.5),plas(3)	SRAKKPKK (492-499, prob:0.763),RKGKR (544-548, prob:0.632)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U0I7	WD_REPEATS_REGION domain-containing protein	Medium	11.9	1	403-422	IEGQDRKRKKEQPWEHDLRK	mito(10.5),cyto_mito(8.833),nucl(7.5),cyto_nucl(7.333),cyto(6)	KEKERRK (351-357, prob:0.681),HDRKVAKQKKLRGSGWEKRFR (370-390, prob:0.88)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3W4	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit trm61	Medium	10.7	1	421-469	EEDEKRCREKWPSNRVQEPQGPQKSKKQLKRESREKRDLQRKEQSQPET	nucl(12.5),mito_nucl(11.166),cyto_nucl(9.833),mito(8.5),cyto(5)	KSKKQLKRESREKR (444-457, prob:0.8)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBF7	Uncharacterized protein	Medium	13.6	1	129-148	SGPVKKKISLNDYKNKRKTG	nucl(14),mito(6),plas(3),cyto(2)	GRANRKRVEALLKFSGKRKMA (397-417, prob:0.741)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCI9	Uncharacterized protein	Medium	10.4	1	150-172	DSSPQSDKKGTKRKRTGDSEQDG	nucl(14),mito(9),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJR8	Uncharacterized protein	Medium	13.1	1	1-34	MMEPVQASKKKKKKKSKKKPKKRLPLDIGNIDSP	nucl(19.5),cyto_nucl(11),mito(2),cyto(1.5),plas(1),pero(1),cysk(1),vacu(1)	SKKKKKKKSKKKPKKR (8-23, prob:0.999)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULU9	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.3	1	32-60	APKQVKCTYLKPARRRGPKVRRQMGNIES	mito(18),nucl(6),cyto(2)	ARRRGPKVR (44-52, prob:0.726)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UNL1	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.4	1	14-41	DGITTGPGTKRRRIRPSRARGLRTRTGC	nucl(20.5),cyto_nucl(13),cyto(4.5)	TKRRRIRPSRARGL (22-35, prob:0.87)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UR19	Uncharacterized protein	Medium	10.6	1	404-425	RKSPSKRSSPTKPQRQPLQRSN	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URW5	Uncharacterized protein	Medium	11	1	275-301	VEETEKPLSKREMKRRAKKARLGVIDG	cyto(18),cyto_nucl(11.833),cyto_mito(10.833),nucl(4.5)	KPKTDKPASKQKG (239-251, prob:0.667),KPLSKREMKRRAKKAR (280-295, prob:0.939)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2PIQ7	Mitochondrial 18 kDa protein	Medium	11.3	1	289-314	WEEYKEERRRAKEERKKELEERGRKG	nucl(13),cyto_nucl(12),cyto(9),pero(5)	ERRRAKEERKKELEERGRKGP (295-315, prob:0.94)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TWQ8	Uncharacterized protein	Medium	11.7	1	385-409	SAVKRALAKKEQQEKEKQKNNGASS	cyto(10.5),cyto_nucl(8.5),mito(6),nucl(5.5),plas(2)	GTKNGKNVKKVGAGSKKSK (226-244, prob:0.796),KRALAKKEQQEKEKQKNNGASSSKPAAKEQTPGSRRSRKAK (388-428, prob:0.948)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U595	Ubiquitin carboxyl-terminal hydrolase	Medium	11.6	1	1-21	MTLRVKRRRLSRQPTMVNQLD	nucl(19),mito(4),cyto(2),pero(2),cyto_pero(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U8T3	Uncharacterized protein	Medium	13.7	1	1306-1338	LDEARQKVDTRRQVRQRDMKNEKDKRDKAKAEI	cyto(16),cyto_nucl(13.166),cyto_mito(9.166),nucl(9),mito_nucl(5.666)	RRKKEEEGSKEEK (415-427, prob:0.702),RKLKSKEKAIEDKKDVKEKKEEEKEKEKEKEKE (648-680, prob:0.958),KNEKDKRDKAKA (1325-1336, prob:0.709)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U9F3	Uncharacterized protein	Medium	10	2	190-215, 458-480	GTDPSKVPPTRKKRKIPRSGTPAAKK, ARGLLLKKLKARNKPHVPRAVSS	plas(21),E.R.(2),vacu(2)	PPTRKKRKIPRSGTPAAKK (197-215, prob:0.95)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAL2	Uncharacterized protein	Medium	10.1	1	25-52	LSLSPRIPIPKRKPHPPKPVQSNPKTQS	plas(10),nucl(6),mito(5),cyto(3),golg(2),cyto_pero(2)	IPKRKPHPPK (33-42, prob:0.769)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGT6	Uncharacterized protein	Medium	10	1	188-208	TEERENRPRRHHRDSHYEDKY	nucl(18),cyto_nucl(11),mito(7)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UHT7	Uncharacterized protein	Medium	10.2	1	214-240	GAGSGKGKKGKKNKKDKKKKGAVAAEE	cyto_nucl(13.333),cyto(13),nucl(11.5),mito_nucl(7.166),cyto_pero(7.166)	SGKGKKGKKNKKDKKKKG (217-234, prob:0.998)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULM6	Uncharacterized protein	Medium	12.8	1	105-124	SGAGVETEKKKKRTRQQNRN	nucl(13),mito(9),cyto(2),plas(1),pero(1),golg(1)	KKKKRTR (113-119, prob:0.742)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULX1	C2H2-type domain-containing protein	Medium	10.2	1	365-396	AAELERKDRTRAQRQEKRYTARVNRAANNQKH	nucl(14),mito(10),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQ12	Uncharacterized protein	Medium	11.5	1	317-336	ASDASDTKRKSWFKRRFSKD	nucl(26.5),cyto_nucl(14)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URH9	Uncharacterized protein	Medium	11.2	1	68-93	LYFGNKKLGGRRRKARRAGNGARKEI	nucl(11.5),cyto_nucl(11),cyto(9.5),extr(2),pero(2)	KKLGGRRRKARRAGNGARK (73-91, prob:0.977)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UU01	Uncharacterized protein	Medium	13.3	1	376-403	MREREKKVTKIMKKGKEHLQKVEKKESR	nucl(11.5),cyto_nucl(11),cyto(9.5),plas(3)	GKEKEKEKE (238-246, prob:0.672),KLMREREKKVTKIMKKGKEHLQKVEKK (374-400, prob:0.907)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUF3	Mediator of RNA polymerase II transcription subunit 19	Medium	14.4	2	380-401, 416-442	AEPERSRPSRGRKRHYDDNSFV, FYSNSEGISKKKRKKDHVSKISTPLPE	nucl(11),plas(6),cyto(4),mito(2),golg(2)	KKKRKK (425-430, prob:0.808)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXC7	FHA domain-containing protein	Medium	12.7	1	598-630	KDSRWDERWNGRKNFKKFRKKGDRNRSRHMIQT	nucl(15),mito(7.5),cyto_mito(6),cyto(3.5)	RWNGRKNFKKFRKKGDRNRS (605-624, prob:0.949)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZR4	Uncharacterized protein	Medium	12.1	1	172-201	GWGAWAPLRKRGKNKKKNKKLKIVEPEAES	nucl(15.5),cyto_nucl(13),cyto(9.5)	LRKRGKNKKKNKKLK (179-193, prob:0.991)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UC25	CDP-diacylglycerol synthase	Medium	10.7	1	85-110	HLDRQINKTCQRQNPRSPQMPPKPEF	nucl(9.5),cyto_nucl(9),cyto(7.5),pero(6),mito(3)	RK (464-465, prob:0.604)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMR9	Vacuolar membrane-associated protein iml1	Medium	14.8	1	712-742	YDENVFQPFRKRRHRRKPSKIKRPSEPEVKA	nucl(12),mito(9),cyto(4)	RKRRHRRKPSKIKRPSEP (721-738, prob:0.993),PKKPALKSS (788-796, prob:0.673)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UN85	18S rRNA aminocarboxypropyltransferase	Medium	10.4	1	8-30	NYSRGGKKFSSTPRPRPVPRGDG	nucl(14),mito(12)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UTB5	Uncharacterized protein	Medium	13.2	1	136-156	EALVRKQKARVEKKKELDAVL	nucl(13),mito(9),extr(3)	R (145-145, prob:0.601)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZQ4	Uncharacterized protein	Medium	11	1	85-111	EDYIDKGRRRSRPKKQLHKPQPREVIP	nucl(11),cyto_nucl(10),mito(9),cyto(7)	KGRRRSRPKKQLHKP (90-104, prob:0.925)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U020	DNA replication licensing factor MCM7	Medium	10.8	1	68-87	QREGSGRRRREPKLKYMQML	nucl(15),cyto(9),pero(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6P2	Structural maintenance of chromosomes protein 5	Medium	10.4	1	272-291	LKQLRARQKKLQADNKSDKD	nucl(21.5),cyto_nucl(13.5),cyto(4.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UB09	Uncharacterized protein	Medium	14.8	1	1-30	MNHKKPRNSSPERATKRRRISSPISRKNPS	nucl(19),mito(3),cyto(3),cyto_mito(3)	KKPRNSSPERATKRRRIS (4-21, prob:0.821)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBK5	Uncharacterized protein	Medium	12.2	1	1027-1054	TTPPTAGEKPEKKKKKKGTTAVEAPNKA	mito(9),cyto(8.5),cyto_nucl(8.5),nucl(7.5)	KPAPKKKAGEE (1012-1022, prob:0.775),PTAGEKPEKKKKKKG (1030-1044, prob:0.976)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UF55	AAA domain-containing protein	Medium	11	1	916-941	RKFDEQYGDRKSRRKKSPGWGFTPAS	mito(16),nucl(8),cyto(3)	KSRRKK (926-931, prob:0.683)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UG55	Casein kinase II subunit beta	Medium	10.6	1	323-350	AQNSAIAKRKKAPMRRRRYNPDQMSING	cysk(16),nucl(7),cyto(4)	AKRKKAPMRRRR (329-340, prob:0.893)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGL9	Mevalonate kinase	Medium	10	1	1-26	MHNGRGRRKNGSVKAPKNRQRPTMSH	mito(10),nucl(5),cyto(5),cyto_nucl(5)	RGRRKNGSVKAPKNR (5-19, prob:0.745)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGY4	Uncharacterized protein	Medium	14.9	1	76-95	GKTLGGKKNKKAKAPSDQRS	nucl(18),cyto_nucl(13),cyto(6)	GKTLGGKKNKKAKA (76-89, prob:0.849),GKIRGGKKGKK (128-138, prob:0.871)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2USH3	Uncharacterized protein	Medium	14.2	1	182-218	GANLANKAHKKHKKEKKHKKDKKHHKRKSSSSSSSSS	nucl(24.5),cyto_nucl(15)	KAHKKHKKEKKHKKDKKHHKRKS (188-210, prob:0.999)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TWW1	Fungal_trans domain-containing protein	Medium	13.5	2	1-22, 607-631	MKRKHPEYEQRRTNKRSLREPL, GALGWARKVFRRRQRWQLGRLILTC	nucl(17),mito(5),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXL5	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.5	1	1-34	MPPRRSHKKSRTGCIQCKKRRVKCDERGPPCSNC	nucl(23.5),cyto_nucl(12.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U463	C2H2-type domain-containing protein	Medium	12.8	1	224-244	GYVQKPSKRRAPRGSKSRTAQ	nucl(15),cyto(4.5),cyto_mito(4.5),pero(4),mito(3.5)	KPSKRRAPRGSKS (228-240, prob:0.841)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U557	Anaphase-promoting complex subunit 1	Medium	11.5	1	629-653	IPKKDPVFSKRMKKRKPPDERSLLV	plas(7),extr(6),cyto(5),nucl(4),cyto_mito(4)	KKRGRRE (361-367, prob:0.711),VFSKRMKKRKP (635-645, prob:0.87)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U616	Basic leucine zipper (bZIP) transcription factor atfB	Medium	14.2	1	173-193	AASKCRQKKKEHTKLLETRFR	nucl(24),mito(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U9B0	E3 ubiquitin-protein ligase bre1	Medium	10.2	1	731-755	CVEERLTSRSRKCPNCNRSFGNNDY	nucl(21),cyto_nucl(14),cyto(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U9C8	Uncharacterized protein	Medium	11.9	2	88-107, 186-206	QPPPPQPQPPPQQQPPQPQY, TPSTTPKPTPKPTPKSTPKVT	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UH58	SAM_MT_RSMB_NOP domain-containing protein	Medium	13.3	2	253-275, 344-367	LASLLCKNEKRKKPRQRIISMDA, VSPAEERKKQGKKRKRGQDEAGDA	cyto_mito(11.5),mito(11),cyto(10),nucl(5)	KRKKP (262-266, prob:0.664),RKKQGKKRKR (350-359, prob:0.945)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJF4	Uncharacterized protein	Medium	11.4	2	71-91, 398-418	VFHLWGTRKNRRKAREWAQAH, KFLERERERGQKRSMKKYTKR	cyto(13),cyto_nucl(10),nucl(5),mito(5),plas(4)	KVRHAREEEIKKLRRADEEEKAEERKLAAEKIKKEERERILRGMNAEEQRKFLERERERGQKRSMKKYTKR (348-418, prob:0.955)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKX5	Branchpoint-bridging protein	Medium	11.1	1	51-77	RADPPVDGVKKRKKRNRWGDAQENKAA	nucl(10),cyto(8.5),cyto_mito(6.5),mito(3.5),plas(2),pero(2)	KRGRSPVRADPPVDGVKKRKKRNR (44-67, prob:0.943)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUT4	DNA damage-binding protein cmr1	Medium	14.2	1	40-70	PNRATGSQAKTKKKPAPKKVKKEEESPAPRR	nucl(16),cyto(7),pero(3)	AKTKKKPAPKKVKKEEESPAPRRMSSRLR (48-76, prob:0.988)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UV64	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.1	1	13-43	ARKMRKVTRACDACKRKKKACTGNLPCRPCL	nucl(18.5),cyto_nucl(10.5),plas(4),mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXG7	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.8	2	3-33, 42-66	KVPIRSRTGCLTCRRRKKKCDERHPVCSGCD, VSNDLVPRTRRPRGRRQLAVTQLPH	nucl(10),cyto(8),mito_nucl(8)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3W8	Uncharacterized protein	Medium	10.7	1	43-69	NPPYESRSSQRVKKKKKHKMATYSVYL	nucl(13),cyto_nucl(10.833),mito_nucl(10.333),cyto(7.5),mito(6.5)	QRVKKKKKHK (52-61, prob:0.909)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBP4	Uncharacterized protein	Medium	13.6	2	57-80, 353-384	DRVLKTVSKRGKQAKRLNQAPPSQ, KANPGIKRKRLDKEDLKKGGRNNNLKKRLRGS	nucl(16),cyto_nucl(12.333),mito_nucl(8.833),cyto(7.5)	PGIKRKRLDKEDLKKGGRNNNLKKRLR (356-382, prob:0.924)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UNC7	WD_REPEATS_REGION domain-containing protein	Medium	13.8	2	381-409, 412-445	QRYSHMPQIRRIKRQRHVPKPIKKAGEIK, ELNAIKRRQENIRKHTRKDKLKPRESERQKMILT	mito(13),nucl(12.5),cyto_nucl(7.5)	RRIKRQRHVPKPIKKAGEIKREELNAIKRRQENIRKHTRKDKLKPRES (390-437, prob:0.988)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UTZ2	Uncharacterized protein	Medium	12.9	1	212-238	EEFRERRREAQGKQRNIRKVSKPFPRI	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	RRREAQGKQRNIRKVSKPFP (217-236, prob:0.774)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGT0	Mannose-P-dolichol utilization defect 1 protein homolog	Medium	10.4	1	255-283	QMVYYWKAPTKPKKAKKAAPKPVERAPVA	plas(14),E.R.(8),vacu(2),nucl(1),extr(1),golg(1)	PTKPKKAKKAAPKPVERAP (263-281, prob:0.965),PKPSGKTPTTRRRG (292-305, prob:0.679)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UK86	SRP40_C domain-containing protein	Medium	14.5	1	338-366	LSVTRGKGFTKEKNKKKRGSYRGGPIDIS	nucl(17),mito(3),cyto(3),cyto_mito(3)	KGFTKEKNKKKRGS (344-357, prob:0.898)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UU02	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.8	1	30-63	DVVRGRKHKTTACRACKLKKLKCRGDPPCEHCTL	nucl(20.5),cyto_nucl(12),mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2PIY7	CMP/dCMP-type deaminase domain-containing protein	Medium	10.6	1	121-145	IDYMVAPKPRPKKNRELNTRFEDDA	nucl(14),cyto(11)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXC6	DNA polymerase kappa	Medium	12.3	1	573-601	SQDAEPVPPKPRKRKSTSQEPVDPRQKRL	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(3)	KPRKRK (582-587, prob:0.69)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXG2	Transcription factor oryO	Medium	11.3	1	33-84	ESPAIPSLTNKKRPRSQPDNTSSPACNQCRTRKIRCDRQQPKCSNCRRADVE	nucl(17),plas(5),cyto(2),mito(1),pero(1),golg(1)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U321	Uncharacterized protein	Medium	12.9	1	286-312	MDYRIITAKIKPKKFKKAQQDIDDSMR	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	KPKK (296-299, prob:0.633)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U6T4	zf-C2HC5 domain-containing protein	Medium	13.7	1	83-109	TATSSKNPAARQKKGKKSKPPLHSAGP	nucl(21.5),cyto_nucl(13),cyto(3.5)	PAARQKKGKKSKPPLHSAGPPRR (90-112, prob:0.97)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U960	Uncharacterized protein	Medium	13.1	1	35-60	GISRARSTSGRRKKLIKKANSIRFSF	nucl(18.5),cyto_nucl(12.5),cyto(5.5)	GISRARSTSGRRKKLIKKA (35-53, prob:0.901)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UCW2	Uncharacterized protein	Medium	11.1	1	98-117	YWDRSTPRDRTRPNGRPVTK	cyto_nucl(11.5),nucl(11),cyto(8),mito(5)	KKGGKKK (852-858, prob:0.729)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UFB2	Uncharacterized protein	Medium	11.1	1	159-186	LEEEQERIKRRQRRRIEREEKDQRRIQK	nucl(10.5),cyto_nucl(10),cyto(8.5),mito(5)	RIKRRQRRRIEREEKDQRRIQKLWE (165-189, prob:0.928)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJD0	Uncharacterized protein	Medium	12.2	1	200-224	ITFKRTQLDDPPKGKRRKREDSNEP	nucl(16),cyto_nucl(12.5),cyto(7),mito(3)	KGKRRKR (212-218, prob:0.807)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UTH5	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.8	2	1-20, 53-76	MYQTKGPRPAEKRIRRAAAA, LRPNATTRFKNLKQSQRRNTVQGL	mito(16),nucl(10)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2MHH2	ATP-dependent DNA helicase II subunit 2	Medium	11.9	2	117-138, 556-582	MIITHCKKLKYRRKIVLVTNGQ, IADVKKVPPKAKGRKRTRETEKPLSGL	cyto(17),cyto_nucl(13.833),nucl(8.5),mito_nucl(5.166)	KKVPPKAKGRKRTR (560-573, prob:0.925)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXJ9	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.6	2	11-40, 44-66	RPGSACEECRRRKVRCDRRRPQCQVCFETG, KISTTRLPRGPRKGQLRTLRTRI	nucl(12),mito(8),cyto(3),plas(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U248	LisH domain-containing protein	Medium	13.9	1	620-654	APPTPQQTNKPAPKKKETKDSRKRPSKKANTAAAA	nucl(21.5),cyto_nucl(13),plas(2)	KPAPKKKETKDSRKRPSKKA (629-648, prob:0.965)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U7L0	Uncharacterized protein	Medium	12.9	2	163-184, 368-387	GEVRHNPRRKFPKGPKLRRGDA, GELLRRGRKKRSEGVLDGKL	plas(11),mito(3),cyto_nucl(3),E.R.(3),golg(3),nucl(2.5),cyto(2.5)	NPRRKFPKGPKLRR (168-181, prob:0.871),RGRKKR (373-378, prob:0.684)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U8W2	VASt domain-containing protein	Medium	14.4	1	52-81	GPSGFSKLLAARKKRKKKENQKATEELPTQ	nucl(8.5),cyto_nucl(8.5),cyto(7.5),mito(5),pero(2),plas(1),golg(1),cysk(1),vacu(1)	LAARKKRKKKE (60-70, prob:0.965),GKKRSVSPGRRWK (207-219, prob:0.751),PRARAASKVGGKGKGRRKRG (1049-1068, prob:0.975)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UAT9	Uncharacterized protein	Medium	10.9	1	10-66	SNSPAKKTSAPEKKYKCQFCNRAFSRSEHRSRHERSHTKERPFKCLKCRSTFVRRDL	nucl(17),mito(4),cyto(4),cyto_mito(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UDF7	Importin subunit alpha	Medium	10.6	2	4-41, 102-121	RYIPEHRRTQFKARNQFRPDELRRRREEQQVEIRKQKR, QATTKFRKLLSKERNPPIER	nucl(13),cyto_nucl(10.5),cyto(6),pero(4),mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UEA0	Probable kinetochore protein nuf2	Medium	13.5	1	8-29	SQQFRGSQQHHGRGRKKEDEND	nucl(22),mito(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UHP6	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.9	1	15-47	ACNICRQRKVKCDAEYPKCRNCRVRNQICVTTD	nucl(18),mito(3),plas(3),cyto(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPU9	AAA domain-containing protein	Medium	13.8	1	2-37	DLERRDLHPDQTRRRRRNVGRRRLRNRAPISARFNL	nucl(14.5),cyto_nucl(12),cyto(8.5),mito(3)	RRRRRNVGRRRLRNRA (14-29, prob:0.93),KGKGKSPAGAGAK (1399-1411, prob:0.689)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKG6	Eukaryotic translation initiation factor 3 subunit A	Medium	10.8	1	812-837	ERDFEAKKKQRIKEVQDRRRRERAER	nucl(12),cyto_nucl(8.833),mito_nucl(8.833),mito(4.5),cyto(4.5),plas(2),E.R.(2)	KRHEEFERRRKAAERDFEAKKKQRIKEVQDRRRRERAEREEAERRQKEEEERIKREEEERAAKEEERRRVLAEEKAKREEERKKLDEIALKQKQREEEAEARRASRKTGFPEPPARAEPERTAPR (799-923, prob:0.994)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKY6	Uncharacterized protein	Medium	12.9	2	15-42, 363-386	ADTPVPDPARKRRSRETSHKSNPEDPNA, PLPVLLRTKRSKRCKSCKHILVKP	nucl(17),mito(4),cyto(4),cyto_mito(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULK0	Uncharacterized protein	Medium	14.9	3	8-28, 94-113, 631-653	ILPRTHRLKYRSPCQLRQLPG, GEPGYYSKTRKQTRKLLSET, QAVEKRKKGARGRQSIGQKKRAH	mito(21),nucl(5)	EKRKKGARGRQSIGQKKRAHHSSK (634-657, prob:0.965)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULX0	HECT domain-containing protein	Medium	14.3	3	131-160, 270-294, 368-389	VPSDLSSQDHHRRSKRRSRASTNDSRKECS, HGKSHSRTEKHRQERERTSRHNTST, NIPSPPALRHRPQKHRGRTGDG	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UM12	Lysine--tRNA ligase	Medium	14.6	2	22-53, 74-97	VTGEKVSKSELKRRQKLREKEAKKKEKEAAAP, YFEIRSKRINKLRETKQPDPYPHK	nucl(12),cyto(11),pero(3)	SELKRRQKLREKEAKKKEKEAAAPPKPAKK (30-59, prob:0.996)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQ23	Uncharacterized protein	Medium	12.5	1	172-194	STNERSHWGSRKRKRPQSIGEGE	nucl(17.5),cyto_nucl(11.5),mito(5),cyto(4.5)	RKRKR (182-186, prob:0.675)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUK3	Uncharacterized protein	Medium	10.1	1	1-21	MQTKTKRKRLSRGGRWTEEER	nucl(17.5),cyto_nucl(10.5),mito(3),plas(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U2Z5	Sod_Cu domain-containing protein	Medium	10.4	1	106-128	LVSDGEEKKKKKKKEEAKEDQGC	cyto(12.5),cyto_nucl(11),nucl(8.5),mito(4)	KKKKKKKE (113-120, prob:0.944)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U385	RelA_SpoT domain-containing protein	Medium	10.1	1	47-72	TKDPSSLERKLRQRERLRKRLYPSKE	mito(11.5),mito_nucl(11.333),nucl(10),cyto_nucl(8.333),cyto(5.5)	RQRERLRK (58-65, prob:0.638)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBM0	Uncharacterized protein	Medium	14.3	2	305-332, 611-633	PKPHKCSKGENCPKYRKRQRQLEKLAAE, DVTKSGYMKKRKQARFLRHEWQD	nucl(19),mito(5),cyto(2)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UID0	CBFD_NFYB_HMF domain-containing protein	Medium	11.5	1	234-255	GSDQNEQPKRKRGGRRPKDDSD	nucl(18),cyto_nucl(14.833),mito_nucl(9.999),cyto(8.5)	KRKRGGRRPK (242-251, prob:0.891)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKQ0	Uncharacterized protein	Medium	11.5	1	302-331	DETQREREIRRERKAERERVKDERRKKIGE	nucl(13.5),cyto_nucl(11.5),mito(7),cyto(6.5)	REIRRERKAERERVKDERRKKIGELRSKR (308-336, prob:0.978)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPM1	Uncharacterized protein	Medium	10.1	1	136-157	GTDGKKSKGKGKRNARRDSDAT	nucl(11.5),mito_nucl(10.832),cyto_nucl(9.999),mito(8.5),cyto_mito(8.499),cyto(6)	KKSKGKGKRNARR (140-152, prob:0.924)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPM4	Uncharacterized protein	Medium	10.1	1	446-466	SSSTNGRKKSQRQKTPHDDSF	nucl(19),cyto_nucl(13),cyto(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPY1	Uncharacterized protein	Medium	11.7	1	104-131	GEASKHNTSLKHKKKKRRVIPIIPADED	nucl(13.5),mito_nucl(12.5),mito(10.5)	KHKKKKRR (114-121, prob:0.918)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2PIN6	Uncharacterized protein	Medium	10.9	1	237-257	YVKARNRKGRIINRSLRRGFR	pero(10),nucl(9.5),cyto_nucl(8),cyto(5.5)	KARNRKGRIINRSLRRG (239-255, prob:0.781)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXA3	S5 DRBM domain-containing protein	Medium	11.3	1	19-42	GGDRGRGRGRRGRRGGKQEEKEWQ	nucl(9),mito(9),mito_nucl(9)	RGRGGFGSRGDRGGDRGRGRGRRGRRGGKQE (7-37, prob:0.994)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U572	GATA-type domain-containing protein	Medium	11.5	1	209-237	LSDELQKLLTRRKKRKRKQSTASVEKSCA	nucl(11.5),mito(11),cyto_nucl(7.5),cyto(2.5)	RRKKRKRK (219-226, prob:0.945)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5U5	Uncharacterized protein	Medium	12.4	1	40-60	EMPPKKRSAPSAPKKARQSKL	nucl(12),mito(8),cyto(7)	PKKRSAPSAPKKARQSKL (43-60, prob:0.884)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBY0	Uncharacterized protein	Medium	10	2	1-22, 111-133	MQQFKQWRRPSQTKPHDPVLTS, EEKKKKTWSSWLRRKTTVKKTEV	nucl(10.5),mito(8),cyto_nucl(8),cyto(4.5),plas(1),extr(1),pero(1),cysk(1)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UI67	Uncharacterized protein	Medium	11.8	2	7-29, 56-81	RLEWVKRLFLKPRRSRGFPKTSD, DDNYDPKARYTRRRKRSSRPHDVVSD	mito(15),cyto_nucl(6.5),nucl(6),cyto(5)	RRRKR (67-71, prob:0.709)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UL34	Uncharacterized protein	Medium	13.1	1	23-45	LWDSPSKRGTRKVNRTPVKEEST	nucl(20.5),cyto_nucl(14.5),cyto(5.5)	KRRT (177-180, prob:0.639)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q9HFB3	pH-response transcription factor pacC/RIM101	Medium	13.3	1	137-157	DFCGKAFKRPQDLKKHVKTHA	nucl(24),mito(1),cyto(1),pero(1),cyto_mito(1),cyto_pero(1)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TX81	Uncharacterized protein	Medium	11.9	1	352-371	PLPSKWTPKEWKEKNRAYYD	nucl(18),cyto(5),mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TXJ3	Uncharacterized protein	Medium	10.4	1	153-177	LYRGGRCRSRTWKRNARGRRVRLPT	nucl(6),mito(6),mito_nucl(6),plas(4),cyto(3)	KRNARGR (165-171, prob:0.648)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TZD3	Ribosomal protein L19	Medium	14	1	232-253	MDAKRAKNKALRERRQERLEAK	nucl(13.5),mito(9),cyto_nucl(8),pero(3)	RARELNAARRIGRNRGLGKRKGTKEAR (135-161, prob:0.959),IQKAKAERHRERVLKEEMDAKRAKNKALRERRQERLEAK (215-253, prob:0.949)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3Y8	RNA-dependent RNA polymerase	Medium	11.5	2	771-790, 1006-1025	GFAPRTFRPLRKRLRKCLIG, EQAWRAYRKRVSPRARDVPA	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U584	Phospholipase	Medium	14.6	2	245-278, 1745-1772	GEQQGRQQQQQQQQQKKKKQLRRRQENDSTPQTE, EALNRNATAQSRRRRRRATTLGSKREFH	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(3)	RRRRR (1757-1761, prob:0.681)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBZ5	ATP-dependent rRNA helicase spb4	Medium	13.4	2	516-537, 555-591	DWDDYKYKDKQREKRRIELLQE, ETTAWSNKLDDRNKKQKRREQKQRRQEKNKWEKMTEE	nucl(18),cyto_nucl(13.166),mito_nucl(10.166),cyto(7),cyto_mito(4.666)	RNKKQKRREQKQRRQEKNKW (566-585, prob:0.948)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGE8	Uncharacterized protein	Medium	13.8	1	77-108	IEKVKKEYEERQKKKKDKSKEKKPDEESKKEE	nucl(20.5),cyto_nucl(12),mito(3)	KKKKEEALAKEIEKVKKEYEERQKKKKDKSKEKKPDEESKK (66-106, prob:0.996)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UMA8	Uncharacterized protein	Medium	14.8	1	186-213	VGEDPTSPRRRKHRRRQRGRPRRDANAM	nucl(17),mito(6),cyto(2)	PRRRKHRRRQRGRPRR (193-208, prob:0.993)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UNF1	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.9	2	3-39, 47-69	NITTEPTKSRRQNKGLACEECRSRKLKCDMSQPQCST, CITNTARRPRGPRKGHVNVLRSR	nucl(22.5),cyto_nucl(12.5),mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQY0	tRNA-dihydrouridine synthase 3	Medium	12.6	2	361-386, 484-508	AEEEGPPKKKQKRDKTKRPLSPSLGV, NGALTEKGKKPNTKQDKTKSEVPAD	cyto(11.5),cyto_nucl(11),nucl(9.5),pero(5)	PPKKKQKRDKTKRP (366-379, prob:0.917)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U466	Uncharacterized protein	Medium	10.8	1	260-279	AYSDRSRPQPTRERDPARRR	nucl(21.5),cyto_nucl(12.5),mito(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UGN5	Uncharacterized protein	Medium	13.1	1	390-414	LSRVGSQRRRPIRSRGRFSLHKIWN	nucl(21),cyto(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UP83	Uncharacterized protein	Medium	10	2	52-71, 97-118	VSMKTFQKARKAKNPSKCNW, FGYRNTKKQKRFTKAMKKRIDD	extr(12),golg(7),E.R.(6)	QKRFTKAMK (105-113, prob:0.633)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2US03	Uncharacterized protein	Medium	10.4	1	478-505	DQSPQPSKAVRPPPQRRQLRSVNERSWS	nucl(20),cyto_nucl(13),cyto(4)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUC4	Uncharacterized protein	Medium	13.7	2	64-93, 108-128	ENTESTESRPRRYRRRFKPQTTPKKEFDKV, VVPPPKRRRFAWLKNPQYRID	mito(13),nucl(10),cyto(4)	RRYRRRFK (74-81, prob:0.69)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U3B6	Uncharacterized protein	Medium	11.3	1	537-567	YSSMKTRCICSIKKKKKHIIRPHSLPGRRTP	nucl(9),cyto(9),cyto_nucl(9)	KKKKKHIIRPH (549-559, prob:0.834)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U5J8	Uncharacterized protein	Medium	10.1	1	144-165	RTVWRFWCLKKRSRINRLVQLA	nucl(16),cyto(5.5),cyto_mito(5.5),mito(4.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UHS8	Uncharacterized protein	Medium	10	1	269-300	PADNAARSRARRNRKKRRNRRINKKAEPESEP	cyto(13.5),cyto_nucl(11),nucl(7.5),pero(5)	RSRARRNRKKRRNRRINKKA (275-294, prob:0.998)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UK41	Uncharacterized protein	Medium	12.4	1	250-277	LFKKLWTGHERKKPSRRERARRHSAADA	nucl(12),cyto(6),pero(5),mito(2),cysk(2)	HERKKPSRRERARRH (258-272, prob:0.932)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UPH9	Uncharacterized protein	Medium	13	1	156-175	EEVRRAKKKAEDNRERKAAE	cyto_nucl(12),nucl(11.5),cyto(9.5),mito(5)	RRAKKKAEDNRERKAA (159-174, prob:0.82),KKAKRETKR (451-459, prob:0.713)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UQH6	Uncharacterized protein	Medium	12.5	1	1-23	MNQSRTKRASGRGKGRVKTKQDI	mito(9),nucl(7),cyto_mito(7),cyto(5)	RASGRGKGR (8-16, prob:0.681),KRKRPS (402-407, prob:0.711)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UUP9	SpoU_sub_bind domain-containing protein	Medium	11.2	2	64-87, 128-151	YKESRDTRSNKTEKKSQGRKWLDD, EDSNRPQDKRHSRRAEPTKHHRAT	mito(14),cyto(6),nucl(3),golg(2)	RR (140-141, prob:0.603)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2TY73	Uncharacterized protein	Medium	11.1	1	31-51	KVPAPRKRGRPIGSTKRRKTG	nucl(10.5),cyto_nucl(10),cyto(8.5),pero(3),mito(2)	PAPRKRGRPIGSTKRRK (33-49, prob:0.925)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U9A3	Uncharacterized protein	Medium	14	1	91-117	EKPFPPGEKKRAMKKANRRPVPPSRPG	nucl(15),cyto(6),mito(4)	PPGEKKRAMKKANRRPVPPSRP (95-116, prob:0.958)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UBL4	S4 RNA-binding domain-containing protein	Medium	14.8	1	298-323	ITLLKAKPAEKKDNKRPKRDQSSDET	nucl(13),mito(11),cyto(3)	DKHERREGRIARKR (183-196, prob:0.766),KPAEKKDNKRPKR (304-316, prob:0.769)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UJ90	Uncharacterized protein	Medium	13.4	1	142-162	MINKARSKASKQPPKVKLSKL	nucl(21.5),cyto_nucl(13.5),cyto(4.5)	RSKASKQPPKVKLSKLTSISGGRQGSVGGNKSQKKRKHK (147-185, prob:0.96)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UKL2	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.8	1	47-87	GSKPAKEPLPMQKRRRVTRACDECRRKKIKCDGKQPCTHCT	nucl(22),cyto(3)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2ULS6	Uncharacterized protein	Medium	10.7	1	588-615	SRENTPETPPRSRRNTPRQPDMRQHSTL	nucl(21.5),cyto_nucl(11.5),mito(5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UNV0	ANK_REP_REGION domain-containing protein	Medium	11.2	1	229-259	VKICSGCIQRERKRAFRKKQRKPEEDELFQK	nucl(11),cyto_nucl(10.5),cyto(8),plas(3),mito(2)	ERKRAFRKKQRK (239-250, prob:0.89)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UNX6	Endoplasmic reticulum junction formation protein lunapark	Medium	14.9	2	152-173, 382-401	GDDKRKSESKRKSSNPQQQQPP, EQPEPETKTRPVRRSNRKKA	nucl(10),cyto_nucl(9),cyto(6),plas(4),pero(3),mito(2)	PKRTKSKGGDDKRKSESKRK (144-163, prob:0.907),RPVRRSNRKKA (391-401, prob:0.802)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2URZ2	Uncharacterized protein	Medium	10.8	1	78-99	HYNNHSRRHSRGPRRTMRYSRD	nucl(22),cyto_nucl(13.333),cyto(2.5)	
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2U641	Uncharacterized protein	Medium	13.6	1	2-26	MVFDHQRAKRKNGNVKPPRKSKYNS	nucl(22),cyto_nucl(13),mito(2),cyto(2)	AKRKNGNVKPPRKS (9-22, prob:0.78)
UP000006564	Aspergillus oryzae (strain ATCC 42149 / RIB 40)	Q2UN23	C2H2-type domain-containing protein	Medium	10.9	1	195-216	LATPRDVRRPHRQQVKRFFCHY	nucl(16),mito(4),cyto(3),golg(2),cyto_pero(2)