ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0P5	Endopolyphosphatase	Low	8.7	1	701-738	FLSLPNILVKKRKHKKKKNKKKKKKKTPEHDLKEVEKM	E.R.(12),golg(5),vacu(3),nucl(2),extr(2),mito(1),cyto(1),plas(1),cyto_mito(1)	KKRKHKKKKNKKKKKKKT (710-727, prob:1)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2X3	Piso0_005784 protein	Low	8.3	1	2-39	TKDIRRVSKARSSGKRSRSGCLSCKRLKIKCNEARPTC	nucl(9),mito(8),plas(5),cyto_nucl(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3M5	Piso0_004879 protein	Low	7.5	1	269-292	NTEPSFKTLFPRKRRKPGDEDIIG	cyto(12),nucl(10),cyto_mito(8.333),cyto_pero(6.833),mito(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y741	Piso0_003965 protein	Low	8.3	1	826-846	ESEGGNKKKTWKDFLKPKEKS	nucl(11.5),cyto_nucl(11),cyto(9.5),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y859	RING-type E3 ubiquitin transferase	Low	7.5	1	352-374	YERVHNRKLSARRYPKKLRCGHI	nucl(7),plas(6),E.R.(5),golg(3),mito(2.5),cyto_mito(2.5),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEG6	L-ornithine N(5)-monooxygenase	Low	9.9	2	59-82, 150-173	VELVKNKGRKRSHLKDTFKNNFEP, GREYSKHQLKKQMKKNMRKKTEGT	nucl(9.5),cyto_nucl(8),cyto(5.5),E.R.(4),mito(2),extr(2),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YHP8	Piso0_003287 protein	Low	5.4	1	491-511	IIYFLSKRDERRKVEQQAKEV	plas(21),E.R.(2),nucl(1),mito(1),pero(1),vacu(1),mito_nucl(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YKW3	Piso0_001474 protein	Low	5	1	400-419	LKQRPFSRPNFKNENKKVFR	plas(26)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YM87	Piso0_001990 protein	Low	6.1	1	4-23	TSTLRKNTKKLTLNNGQKIP	cyto(11.5),cyto_mito(11),mito(9.5),nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YST1	Isocitrate lyase	Low	8.5	1	16-35	MFNHMKRKKHTLSTFPYPTK	mito(11),nucl(9),cyto(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YT53	Mannosyltransferase	Low	8	1	1-44	MSEYRSHRKRIVAKTRKGGSAATSSKRGSKERYSKKGNYKSLSS	plas(20),E.R.(5)	HRKRIVAKTRKGGSAATSSKRGSKERYSKK (7-36, prob:0.892)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y028	JmjC domain-containing histone demethylation protein 1	Low	8.9	1	63-85	KVAGPSVYKRRSKRARIEIDYVA	nucl(15),cyto_nucl(13.5),cyto(10)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y6E7	Piso0_003718 protein	Low	5	1	66-90	EDISHKGSKGRSKPKPQSYVHKVLS	plas(23),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y9W6	alpha-1,2-Mannosidase	Low	8.8	2	29-51, 602-628	PLYYKDKQSKSSRSKKEMLVRGL, AKEHPEITKDNKKEQKQKFNKYVEQIV	nucl(5.5),mito(5),cyto_nucl(5),golg(5),E.R.(4),cyto(3.5),plas(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YB33	Piso0_004283 protein	Low	8.4	1	178-198	ISSTKQRRTSSKQPSAQRKAS	nucl(14.5),cyto_nucl(13.333),cyto(9),cyto_mito(5.999)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBK9	Piso0_002061 protein	Low	5.8	1	122-141	GQNKLSSKGRPKGKWKVEPW	mito(16),cyto(7),nucl(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YG59	Piso0_002857 protein	Low	9.1	1	1-29	MARRPARCYRYCKNKPFPKSRYNRGVPDA	nucl(11),mito(10),cyto(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YP82	Valyl-tRNA synthetase	Low	9.9	1	49-111	EGQTPVKKEKTPKEIEKEKKKAEKLAKFNAKKEKQAEDAKKKSSEPKKSKKEKQAREPAAEIK	mito(14.5),mito_nucl(12.166),cyto_mito(10.333),nucl(8.5)	KKEKTPKEIEKEKKKAEKLAKFNAKKEKQAEDAKKKSSEPKKSKKEKQARE (55-105, prob:0.995)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPG4	Piso0_001175 protein	Low	9.2	1	27-49	RSSPEFRKSLKKKSAKQQKLAAK	cyto(16),cyto_nucl(11.666),cyto_mito(10.166),nucl(6),mito_nucl(5.166)	RKSLKKKSAKQQKLAAK (33-49, prob:0.866)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YSF1	Piso0_001111 protein	Low	5	1	38-59	IFLPRWITRRYKFKLKENYVFL	plas(14),E.R.(6),mito(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0B7	Piso0_004753 protein	Low	5	1	28-48	NLENESKLRRRLERRHVEMLA	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YC31	Non-specific serine/threonine protein kinase	Low	9.6	1	5-26	YTADLKQHRKAPPPPVRSKTEP	nucl(22),cyto_nucl(12.833),mito_nucl(12.833)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEK5	Piso0_002266 protein	Low	6.8	1	80-99	IRVGTRTDKKQKPQDKIDIV	cyto(18),cyto_nucl(14.5),nucl(7)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFF4	Piso0_002582 protein	Low	5	1	215-234	RFGRREKKLENEKIERERSF	plas(15),mito(6),E.R.(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFY3	Endonuclease III homolog	Low	6.1	1	1-22	MSYSAPRRSKRRLQHIEVSASG	mito(20),cyto(4),nucl(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRF4	Piso0_000756 protein	Low	5.9	1	1021-1042	IKRMNSKRSKAQKIKNTTKITK	plas(12),E.R.(4),nucl(2.5),cyto_nucl(2.5),mito(2),pero(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZF1	Piso0_005597 protein	Low	8.8	1	19-40	GISRRICTSRRLFNEKNRKVFQ	mito(13),nucl(10),cyto(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZL7	Piso0_005665 protein	Low	8.7	1	16-41	NVKGKVLKTCIRCRQHKTRCDAWDTR	mito(14),nucl(10),cyto(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y8V7	Piso0_004466 protein	Low	5	1	262-287	LVSVWVKRFKWQPLKNRKIVFNPPKK	extr(9),mito(8),cyto(6),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YC43	Protein DML1	Low	9.6	1	471-492	FKNTMKYYRKVLKRVRDNEIIE	nucl(17.5),cyto_nucl(13),cyto(5.5),cysk(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YF74	Piso0_002498 protein	Low	5	1	62-82	IKTAQSPLKRKLKSRHLQMIA	plas(27)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YHH3	Piso0_003208 protein	Low	9.2	1	510-534	LGDLLCTKSKTRKKNYKLAAAWLRL	nucl(16),cyto_nucl(13.5),cyto(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLH5	CCT-alpha	Low	5.9	1	479-498	SQSALPTDTKRKKYKYYGLD	cyto(22.5),cyto_nucl(14.5),nucl(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLK7	Piso0_001735 protein	Low	8	1	175-201	STNPSRGRSNKSKNKSKRKFNMMPCLN	plas(16),E.R.(6),golg(3)	GRSNKSKNKSKRK (181-193, prob:0.786)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMS9	Piso0_001299 protein	Low	8.8	1	28-53	KGMSCLYTRHQQKRGPKNLYPKTLRR	nucl(14.5),mito_nucl(12),mito(8.5),cyto(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YN32	Piso0_001407 protein	Low	6.9	1	336-357	QKRLEHLKQNCKKNGKFDKEFC	cyto(11.5),cyto_nucl(10.833),nucl(8),cyto_pero(7.666),mito(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPT2	Piso0_000693 protein	Low	7.3	1	215-235	LSLSQDKKKIIRKIWKASDVD	nucl(10),mito(9.5),cyto_nucl(9.333),cyto_mito(8.666),cyto(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2B7	Mediator of RNA polymerase II transcription subunit 14	Low	7.7	1	1015-1037	NLSFRTNKFYKEKKLYVKLSLKE	nucl(13),mito_nucl(10.999),cyto_nucl(10.833),mito(7.5),cyto(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCG0	Ribosome-recycling factor, mitochondrial	Low	7.2	1	203-229	SVRSDFRNKFQKQSKKKRLSDEEEQVW	mito(17),nucl(6.5),cyto_nucl(4.5),cyto(1.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEZ3	Piso0_002408 protein	Low	8.2	1	288-315	HPDVPPKQSKSEKLQKRKRMLSDNADLV	nucl(15),mito_nucl(12.833),mito(9.5),cyto_nucl(9.333)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YI06	Piso0_003406 protein	Low	6.9	1	27-50	KYEFDKKQKSDRKTKEHTSKPVHE	E.R.(8),cyto_nucl(7),nucl(6.5),cyto(6.5),extr(2),pero(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YIX5	Piso0_003380 protein	Low	6.4	1	301-321	GTASKNKREARMKQNVEKAHQ	cyto(10.5),mito(8),cyto_nucl(8),nucl(4.5),cysk(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YND6	RNA exonuclease 4	Low	9.5	1	7-33	NWNRLSAKLNSSKKQKQERHSVTHGKI	nucl(21.5),mito_nucl(13.666),cyto_nucl(12.333)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZ89	Mitochondrial group I intron splicing factor CCM1	Low	6.5	1	40-70	TETEKPATSKKPDVKKSNKRQGPQLNSKLRD	mito(22),nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZM0	Palmitoyltransferase	Low	5	1	105-129	LMAPRSFHSKRVKRCVKKYDHFCLW	plas(21),E.R.(3),mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDP3	Piso0_002850 protein	Low	9.4	1	108-131	SQLKSNTKPSSKVKKQKTNSNAIL	nucl(16),cyto_nucl(11),mito(5),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEK0	Piso0_002260 protein	Low	8.5	1	23-46	SPGNGNRIRKQVQKKPPKVTDSYK	nucl(12.5),cyto_nucl(11),cyto(8.5),pero(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YKV2	DNA ligase	Low	7.9	1	585-605	SYYEPSKRSRNWLKLKKDYLS	nucl(13.5),mito_nucl(13.166),mito(11.5),cyto_mito(7.833)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YP75	Piso0_001830 protein	Low	9.1	1	467-490	SLVLRSPKRIHWEKCQQTRFREIQ	nucl(17),cyto_nucl(15),cyto(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRS4	Piso0_000879 protein	Low	7.7	1	154-179	YSSDVFKKKAKQIRKNMWWKKTKFYF	nucl(8),E.R.(5),cyto_mito(5),mito(4.5),cyto(4.5),pero(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTA0	Piso0_000172 protein	Low	8.2	1	172-193	LSSSITSRKRKNKDEYISNTKQ	plas(11),nucl(8),mito(2),pero(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZD2	37S ribosomal protein mrp10, mitochondrial	Low	9.2	1	1-21	MPYKKVQPNKKLPPLPRLKIR	nucl(17),mito_nucl(14),mito(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZG9	Piso0_005615 protein	Low	9.3	1	1-22	MAVKKENKKTESKKEEFKNEEE	nucl(15.5),mito_nucl(10),cyto(7),mito(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y171	Non-specific serine/threonine protein kinase	Low	9.7	1	640-666	NSDNLSSTKKKRKRGSRGGKRSSKGKK	E.R.(8),nucl(5),golg(4),extr(3),mito_nucl(3),cyto(2),pero(2),cyto_pero(2)	KKKRKRGSRGGKRSSKGKK (648-666, prob:0.997)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4K7	Magnesium transporter	Low	7.9	1	424-454	LIDRLKWRSRWMYFHRRKKLHYPTSKEKDVI	nucl(9),mito(7.5),cyto_mito(6),cyto(3.5),plas(3),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBG3	Piso0_002014 protein	Low	9.1	1	193-216	EALLNRIRSRKERKLCNARSNLYF	nucl(11),cysk(10),cyto(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEP9	Piso0_002310 protein	Low	9.8	1	140-171	KEYNQNYKNSHNKKEKNSNKKKDAFNNWERKN	nucl(20),cyto_nucl(16),cyto(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YES5	Piso0_002337 protein	Low	6.7	1	17-36	LYKQLIKKSHQLKSRKICLV	mito(18.5),mito_nucl(13),nucl(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRG2	Piso0_000765 protein	Low	9.5	1	70-89	GSDSVKKTERHAKKRIIFIG	nucl(14.5),cyto_nucl(9),mito(5),plas(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3U8	Piso0_004956 protein	Low	5	1	383-402	VSPTPRPKRIYNSSWRSKKH	cyto(8),extr(5),plas(4),cyto_nucl(4),mito(3),E.R.(2),golg(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCI2	Piso0_002399 protein	Low	8	1	14-42	NTTASRTQSPLRRRKPWKKLLYLKQAYPD	plas(22),E.R.(3)	RRKP (26-29, prob:0.641)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMF1	Piso0_001314 protein	Low	9.9	1	313-333	KDALLQKYSRKWRRNIPDVLF	nucl(16.5),cyto_nucl(10),mito(5),cyto(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPC9	Piso0_001139 protein	Low	6.5	1	61-83	NKKKSLRIFSWYRQKKNKEDIES	E.R.(9),extr(6),nucl(4),golg(3),pero(2),mito_nucl(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTP2	E3 ubiquitin-protein ligase PEP5	Low	9.4	1	907-926	VIQNNKCSRCQKRLEFPVVH	nucl(16.5),cyto_nucl(10.5),cyto(3.5),mito(3),golg(2),cysk(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZH3	Piso0_005619 protein	Low	9.4	1	144-174	NLKLRPIRCSSKKSYKKRSKLRLSTIYKFNP	nucl(19.5),cyto_nucl(14.333),cyto(6),cyto_mito(3.999)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0Z2	Piso0_004990 protein	Low	8	1	44-63	EYAPRFKKLRKAFKGRVSVS	mito(20.5),cyto_mito(12.333),cyto(3),cyto_nucl(2.833)	RFKKLRKAFK (48-57, prob:0.71)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y7H8	Piso0_004105 protein	Low	7.9	2	213-233, 664-684	SFEEWKKKKVEKSPYKNESRL, VGSLKKRKYDVHYQEKKLRGI	E.R.(9),extr(5),golg(4),nucl(3),cyto(3),cyto_nucl(3),pero(3),cyto_pero(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDB1	Piso0_002708 protein	Low	5.7	1	267-294	VYLSLKCSNNIKRKKKFRQNLNLVRRMP	plas(11),E.R.(6),pero(4),nucl(2),mito(1),cyto(1),golg(1),vacu(1),cyto_mito(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDT0	Piso0_001227 protein	Low	5	1	599-618	TKIFSFKKRKMLMKYVRWTW	plas(26)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YE49	Piso0_002104 protein	Low	7	2	59-86, 191-213	EKLEKDQKSLDKCNKCKHKLKFASDLIH, PDLEKKWPPKQPKHYSEPEYKKK	extr(11),E.R.(7),golg(7)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJ33	SWR1-complex protein 4	Low	9.2	1	13-37	QRGEGAPAKKKQKTNNGKTQRQSGM	nucl(20),cyto_nucl(12.333),mito_nucl(11.833),cyto(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRS7	Piso0_000882 protein	Low	8	1	206-227	TIENVKRRKLRIRKGFMSQKLI	extr(15),E.R.(6),golg(5)	RRKLRIR (212-218, prob:0.671)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUC1	Piso0_000025 protein	Low	6.8	1	18-45	DVSRGNTSKIHKSRRPPNTAFRQQRLKA	plas(17),nucl(5),mito(2),cyto(2),cyto_mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUX4	GPI ethanolamine phosphate transferase 3	Low	7	2	18-38, 316-339	FLQRQQQSRSRIKQQKFWFTS, SLFMYSKQKRFKFHKKNKSFYDTS	plas(24),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y194	Piso0_005094 protein	Low	7.8	1	70-98	QARVVYRATRGRRQCRRPRPTADSEPRGP	mito(11),nucl(9.5),cyto_nucl(8),cyto(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4F0	Mediator complex subunit 12	Low	9.4	1	1584-1606	LGDSSKEKVQPKRFRLRSYELLE	nucl(15.5),cyto_nucl(10.5),plas(5),cyto(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4I5	Piso0_005217 protein	Low	9	1	312-361	EKKGGGRHRAFKKKPSKQQQRRSLRRLKNSEKKIKERERKLREEKYGDPN	golg(7),E.R.(6),nucl(3),pero(3),vacu(3),plas(2),cyto_nucl(2),mito_nucl(2),cyto_pero(2)	EKKGGGRHRAFKKKPSKQQQRRSLRRLKNSEKKIKERERKLRE (312-354, prob:0.997)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCC4	Piso0_002337 protein	Low	5	1	469-488	ISEDEKKSKKEQKGIPELSR	mito(23),mito_nucl(14.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YE00	Piso0_002054 protein	Low	5	1	95-118	LDYNKQKTMSSRRRLRRQDSESYG	plas(15),E.R.(5),mito(4),golg(2),cyto_mito(2),mito_nucl(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEW0	Vacuolar fusion protein MON1	Low	9.1	1	661-681	SLNIIRWCQKYKKRLFIDDGV	nucl(17.5),cyto_nucl(13.833),cyto(7),cyto_mito(4.499)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YGF1	Piso0_003620 protein	Low	8.1	1	4-27	LDNRLTPEQIRQRRINRKGINLTI	nucl(12),cyto_nucl(12),cyto(8),mito(7)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRF3	Mitochondrial group I intron splicing factor CCM1	Low	8.8	2	30-53, 61-80	IFMVRSKKQTKAGDRNTTKRNEKI, DYRKAKQREAEYKKRLQELK	mito(17.5),mito_nucl(13.333),nucl(8),cyto_nucl(5.333)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YSH0	Translation factor GUF1, mitochondrial	Low	9.4	1	652-677	ADISRRKKLLERQKEGKKQMKSTGKV	E.R.(8),nucl(4),plas(4),mito(3.5),cyto_mito(2.5),extr(2),golg(2),vacu(2)	ISRRKKLLERQKEGKKQM (654-671, prob:0.858)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUG6	Atypical serine/threonine protein kinase BUD32	Low	7.5	1	44-71	ESSYIIKYRPRKPYRHPKIDKSITKSRT	nucl(12.5),mito_nucl(11.499),cyto_nucl(9.666),mito(9),cyto_mito(7.499)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y201	Piso0_005371 protein	Low	5	1	310-338	TISRYWNQAKMKNMRRRSRKDSNLPVEVC	plas(16),mito(4),E.R.(4),pero(1),golg(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y290	Piso0_005539 protein	Low	8.8	1	108-130	HQWFKDSRKSKSNPRRNWYHWAP	nucl(17),cyto_nucl(11.833),mito_nucl(10.333),cyto(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y420	Piso0_005034 protein	Low	9.6	1	1-22	MADVKKQDKRNNLSRRNANIDS	nucl(15.5),cyto_nucl(10),mito(5),cyto(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y9N4	Piso0_003839 protein	Low	9.6	1	150-171	QSADHHHHRHHHHHHHHHHSSP	nucl(18.5),cyto_nucl(14.5),cyto(7.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDM4	Methyltransferase-like protein	Low	7.7	1	297-316	GTDRRLLVNRKKQLKMYRNW	cyto(10.5),cyto_nucl(10.5),nucl(9.5),pero(3),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEC2	Piso0_002180 protein	Low	9.9	1	167-195	LKEESREKRLFHKKRQSDKKKSRSKKFDL	mito(22),nucl(5)	SREKRLFHKKRQSDKKKSRSKK (171-192, prob:0.977)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLT2	Piso0_001813 protein	Low	5	1	634-655	TYILYRKYPKKWYGRINGPVFF	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YR11	Piso0_000611 protein	Low	9.4	1	60-89	PSCSNCTKYARKCSYKSSRRVNPHERTLSF	plas(14),nucl(11)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUJ9	Piso0_000114 protein	Low	7.9	1	590-611	DTDGSKRDNKRFLNKRNWSDLI	nucl(10.5),cyto_nucl(9.5),cyto(7.5),plas(5),mito(1),golg(1),cysk(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFI9	Piso0_002619 protein	Low	8.7	1	6-32	NECRGITSKNTKCRRKVAENQKYCYQH	nucl(14.5),mito_nucl(12),mito(8.5),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YG16	Piso0_002812 protein	Low	9	1	60-82	ETEFSLVRRRKKLNPILRRILTE	nucl(19),cyto_nucl(11.666),mito_nucl(11.166),cyto_mito(3.166),cyto(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YI79	Piso0_003482 protein	Low	9.7	1	101-122	GTNIWKNRKHLKHITKEKYKLG	nucl(14),mito(7.5),cyto_mito(5),pero(2),cyto(1.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMW1	Piso0_001333 protein	Low	9.9	1	581-607	YPEIKRMYKTIDKNKHRHLKVKAEETY	nucl(18),cyto_nucl(13.5),cyto(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQ83	Piso0_000848 protein	Low	5	1	27-51	LYLSAKDKASHKKTRKIETSKEYSE	mito(7),plas(7),extr(5),E.R.(3),cyto(2.5),cyto_nucl(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y136	Piso0_005034 protein	Low	9.1	1	1-22	MADVKKQDKRNNLSRRNANIDS	nucl(16.5),cyto_nucl(9.833),mito(5.5),cyto_mito(4.333),cyto(2),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y276	Mitochondrial group I intron splicing factor CCM1	Low	7	1	40-70	TETDKPATSKKPEVKKSNRRQAPQLNSKLRD	mito(20),nucl(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y278	Piso0_005526 protein	Low	9.8	1	54-78	ALSTDKKWSKDRINKKAKNLKVKMG	mito(14.5),mito_nucl(13.499),nucl(10),cyto_mito(9.332),cyto_nucl(7.499)	KDRINKKAKN (63-72, prob:0.687)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2T1	Piso0_005741 protein	Low	9.7	1	138-172	NLPSNHQKGSKQRRPCDRCRKRKTKCVVMPEAKNC	nucl(17.5),cyto_nucl(10.5),plas(3),cyto(2.5),mito(1),pero(1),E.R.(1),golg(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YB24	Piso0_004273 protein	Low	8.4	1	49-76	SSPKSSLSSSKERKKNYTRQKYRAVTGD	nucl(11.5),plas(11),cyto_nucl(8),cyto(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCD3	Piso0_002346 protein	Low	5	1	600-627	DIKIQHNHKVPKQQFKNQKLPKGENGNE	mito(7),pero(6),plas(5),E.R.(4),golg(3),cyto_pero(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNL8	General transcription and DNA repair factor IIH helicase subunit XPD	Low	9.8	1	688-708	VLADRRFSRKKSQLPKWIAQA	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YSP8	Lysophospholipase	Low	6.4	1	764-783	QQYCWKGKYSKARSHKADLN	extr(9),E.R.(6),nucl(4),vacu(3),golg(2),cyto_mito(1),pero(1),cyto(1),mito(1),cyto_pero(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2I4	Chitin synthase	Low	5	1	1125-1144	IVMKRWREFERDRKNQQGLP	plas(24),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YM44	Piso0_001945 protein	Low	7	2	37-57, 332-351	GTANDPKTYKKLRKQVWLGSI, PMYHIKGKKKHELSKAEQEE	plas(18),mito(6),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRD5	Piso0_000737 protein	Low	9.2	1	66-85	LGPSAKTKEVKRPRLNPFLT	nucl(15.5),cyto_nucl(12.5),cyto(8.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	C7U030	Truncated non-functional cytochrome oxidase 1	Low	5	1	456-479	LEFTLWKRTFNKDRKNYEKMYKMQ	plas(9),mito(6),E.R.(5),golg(3),mito_nucl(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1P9	Glycogen [starch] synthase	Low	8.2	1	562-585	MFDFANKNRRQRINQRNRTERLSD	nucl(11.5),cyto_nucl(11.5),cyto(10.5),pero(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y7K4	Piso0_004132 protein	Low	8	1	262-285	IYDYVPENKRPRKRHNGLFHGKQD	plas(18),E.R.(7)	AKKKAEKK (246-253, prob:0.7)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLU6	Piso0_001828 protein	Low	9.7	1	6-31	RGSEGSKSSSKRQNKSKGNESSPKLF	nucl(17.5),cyto_nucl(10.333),plas(4),cyto_mito(2.833),mito(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMR8	Piso0_001287 protein	Low	5	1	921-943	AFTCRFPKDPSRHKKLREDPAYQ	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YN59	MMS19 nucleotide excision repair protein	Low	8.5	1	1082-1101	ARGSEDPKRNVRKLNCDIRQ	nucl(11.5),cyto_nucl(8.5),cyto(4.5),extr(4),pero(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y000	Piso0_005804 protein	Low	5.8	1	192-215	NEIRPIPSYKPKKQKKGTASVLKT	plas(20),nucl(2),mito(2),mito_nucl(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y388	Piso0_005915 protein	Low	5	1	486-507	FIYWYRNNRKDKFQKETNTEME	plas(23),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y5C8	Piso0_004397 protein	Low	8.9	1	221-247	GKVVASKKFNTTKRPERKQVEIPKSPF	nucl(13),mito(12),cyto_nucl(8.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBD1	Phospholipid-transporting ATPase	Low	8.8	1	1239-1264	LEQFQKAIKKVRQVQRIKKQRGFAFS	plas(23),nucl(2)	K (930-930, prob:0.608)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFY2	Piso0_002777 protein	Low	8.7	1	53-74	QACDRCRAKKIKCDGKLPSCSS	nucl(12.5),cyto_nucl(9),plas(6),cyto(4.5),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YH27	Piso0_003057 protein	Low	5.4	1	330-370	CSDINKQVKKKVKGHNASCSAPKKSSSSKKSSKSTKGSDSD	extr(16),cyto(5),pero(2),nucl(1),E.R.(1),golg(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNM3	Piso0_001613 protein	Low	9.4	1	410-437	QHSILKLSITPKKPKKNRIQNENISFLS	nucl(16.5),cyto_nucl(10.5),cyto(3.5),mito(3),plas(1),pero(1),E.R.(1),golg(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YSQ3	Piso0_000561 protein	Low	6.7	1	626-646	GAMSSKSKPRKEPPLDRIRLH	cyto(9.5),cyto_nucl(8),nucl(5.5),E.R.(3),plas(2),extr(2),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0T4	Oligosaccharide translocation protein RFT1	Low	7	2	18-41, 57-78	YTLSLTYAWKKEKKNKWLVHITDI, AEINERSKRRQGKAKNVKESSE	plas(14),E.R.(6),mito(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1G7	Piso0_005173 protein	Low	8.4	1	1-24	MATLIPPPSKKQRKEAQNVRDVDI	nucl(13.5),cyto_nucl(10.333),cyto(6),cyto_pero(5.333),mito(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y226	GPI ethanolamine phosphate transferase 1	Low	5	1	978-999	VSESPISSRVKRRTRASKLSSS	plas(13),E.R.(6),mito(3),golg(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y234	Piso0_005405 protein	Low	6.1	1	381-401	TDFFNKFKKAVRESNNNRHAL	mito(13.5),cyto_mito(9.333),cyto_nucl(4.833),nucl(4.5),cyto(4),extr(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2C1	Piso0_005572 protein	Low	6	1	340-359	AVAKFQKRFRHEIQKRRMAV	mito(21),nucl(3),cyto(3),cyto_nucl(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y348	DNA helicase	Low	7.9	1	653-682	LKKSHTKYISKQKLQVYKKRKVMNNDLNDE	nucl(14.5),cyto_nucl(12.333),mito_nucl(10.832),cyto(6),mito(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YET4	Piso0_002346 protein	Low	6.2	1	600-624	DIKIQHNHKVPKQQFKNQKLPKGVN	cyto(7.5),extr(6),cyto_nucl(6),E.R.(5),nucl(3.5),mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YN49	Piso0_001425 protein	Low	5.7	1	563-583	RTWNWLKFWKKKPQSSTRKAF	plas(22),nucl(2),cyto(1),pero(1),golg(1),mito_nucl(1),cyto_pero(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNY6	Piso0_001736 protein	Low	8.1	1	91-112	SPFFGRKNHKLVRKNAKKDAEH	nucl(11),mito(10),cyto_nucl(10),cyto(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPF2	Piso0_001163 protein	Low	9.7	1	132-152	GARIGRRKRAQAKVGRSHRTN	mito(14),cyto_nucl(7.5),cyto(7),nucl(6)	GARIGRRKRAQAKVGRS (132-148, prob:0.889)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUU5	Piso0_000216 protein	Low	9.6	1	165-187	QFTAKRSIYHKRREKLLRWDEDR	nucl(18.5),cyto_nucl(13),cyto(4.5),mito(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YVA6	DNA primase large subunit	Low	9.9	1	1-21	MFRRAKRRTTGRRNFEQSKAG	nucl(16.5),cyto_nucl(10.5),mito(7)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0M0	DNA-directed RNA polymerase subunit beta	Low	9.6	2	3-25, 1094-1117	AKFRTLEREKRFQNPPKEKPTYQ, SAASVRCRRCSKKLEYYTQKGQYV	nucl(11.5),cyto_nucl(11.333),cyto(10),cyto_pero(7.333),pero(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2X0	Piso0_005781 protein	Low	5	1	599-619	TVSKHECQRNLWRKNAPNIYC	plas(17),E.R.(4),mito(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3I8	Piso0_004838 protein	Low	8	1	88-118	ERREALQRKVERQRRARNMRKEHTKDQREDF	mito(22),cyto(4)	RKVERQRRARNMRKEH (95-110, prob:0.802)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y632	Piso0_004664 protein	Low	9.6	1	220-239	QLSKSMKKSFRKPPPGSPMT	nucl(12),cyto(7),mito_nucl(7)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBQ5	Piso0_002110 protein	Low	9	1	24-45	AGNMDEKPRKRSRRYHAGVWIM	nucl(13.5),cyto_nucl(8.5),mito(6),golg(3),cyto(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YD72	Found in mitochondrial proteome protein 38	Low	5.8	1	12-32	LIARSFFPRWHRKNWVSQYST	mito(22),cyto_nucl(3),nucl(2.5),cyto(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YES7	Piso0_002339 protein	Low	7.1	1	623-642	IPPTPEEKRNRQMTDKRSNA	plas(18),nucl(6),mito(1),cyto(1),vacu(1),cyto_mito(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFH4	Piso0_002603 protein	Low	5	1	478-497	HEPFWIRRPKKEKNHDDDTE	plas(21),E.R.(3),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YI36	Piso0_003437 protein	Low	6.6	1	96-120	RQPLRPAHCQHRRPRRPPQAVCGRV	mito(21),nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YK10	Fatty acid synthase subunit alpha	Low	7.5	2	1439-1459, 1492-1514	PLLSLKYRSRQLKKRLSQIKA, RTEVIRRETKRQIRDAKKQWGND	cyto(20),cyto_nucl(11.833),cyto_mito(11.333),nucl(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YKU5	Piso0_001456 protein	Low	5	1	430-456	VLIHRAYRDMRKCKRKYGEDWDRYLKA	plas(19),E.R.(4),pero(2),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQ60	Piso0_000824 protein	Low	5	1	15-35	APIVAGKKAPKIKKNPSNVVA	extr(18),E.R.(4),vacu(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YVF4	Piso0_000434 protein	Low	5	1	84-103	ALKEPPRDRKKDKNVKHSGN	cyto(22),cyto_nucl(12.833),cyto_mito(12.333)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZL0	5-demethoxyubiquinone hydroxylase, mitochondrial	Low	5.8	1	22-47	CALRAAQESKKKRTSKKDASEVNYGA	mito(23),nucl(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y505	Piso0_005401 protein	Low	5.8	1	40-61	KSAYKQLSKKFHPDKNPSQEAH	extr(9),E.R.(9),golg(4),nucl(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y819	Piso0_004304 protein	Low	9.4	1	104-126	AASGVSKKSKKKNRCSFKSCSSA	nucl(16),cyto_nucl(13.5),cyto(7)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEW1	Ribosome-recycling factor, mitochondrial	Low	7.2	1	205-229	RSDFRNKFQKSSKKKRLSDEEEQIW	mito(19),nucl(6.5),cyto_nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQ36	Piso0_000800 protein	Low	9.8	1	871-893	LLSLRNPRIKKHYRTNSSKSAED	nucl(20),cyto_nucl(14.5),cyto(7)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YS25	Protein OS-9 homolog	Low	9.5	1	171-194	VFTLGHFKKSKKKNRSKLEEDGIY	extr(9),nucl(5),vacu(4),mito_nucl(4),mito(3),cyto(3),E.R.(3),cyto_mito(3)	KKSKKKNR (178-185, prob:0.763)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTL8	Piso0_000299 protein	Low	5.9	1	242-261	INEFKRKNKKDLSNNQRALR	cyto(21.5),cyto_nucl(14),nucl(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1C1	Protein disulfide-isomerase	Low	9.5	1	521-541	DGHELKKKLDEKKPSEDKKEE	cyto(14),nucl(4),mito(3),pero(2),E.R.(2),vacu(2)	KKKLDEKKPSEDK (526-538, prob:0.676)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y349	Piso0_005867 protein	Low	8.6	1	350-370	AVNARRKRTAKDREYDLRNQL	nucl(12.5),mito(10),cyto_nucl(8.5),cyto(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y5J4	Piso0_004469 protein	Low	5	1	64-84	GVKILRVNKMQRKWKQKLYGV	plas(22),E.R.(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y6A1	Piso0_004734 protein	Low	9.6	1	29-57	RYVCVCSNCKASKRKCDRRNPCGNCVKLG	nucl(15.5),cyto_nucl(10),cyto(3.5),E.R.(3),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YC82	Piso0_002293 protein	Low	7.2	1	786-805	TASRSIRKLGFKTKRDPPRS	plas(16),nucl(6.5),cyto_nucl(5),cyto(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRG9	Piso0_000772 protein	Low	8.6	1	1-21	MRKIWGSRKDRDKRRSFTGAF	nucl(13),cyto_nucl(11),plas(7),cyto(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTE8	Phospholipid-transporting ATPase	Low	7.8	2	64-84, 221-269	SPAPTWKQKVRRYFYMKGYCG, TSYVGPWRRFKKKCTKITFKCCRGIKKFAMYFAKRKTRQEYIRKREMER	plas(23),nucl(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZD5	Piso0_005581 protein	Low	9.6	1	1-38	MQLGSIKKRNRPTLSCNVCKRRKVKCDRKQPCTSCIKY	nucl(22),cyto_nucl(14.333),mito_nucl(11.999)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1F8	Piso0_005164 protein	Low	9.9	1	1771-1791	MEETNKKYKKLLKKHGEEVSS	nucl(18.5),cyto_nucl(13),cyto(4.5),mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1J9	Piso0_005207 protein	Low	6.5	1	448-468	DKHMREQQRHHQHQRQQHFYQ	E.R.(7),golg(6),nucl(4),cyto(3),extr(3),mito_nucl(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4M6	Glycogen [starch] synthase	Low	8.3	1	563-585	FDFAEKNRRQRINQRNRTERLSD	nucl(11.5),cyto_nucl(11),cyto(9.5),pero(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y521	Piso0_005419 protein	Low	6	1	812-831	LFHLLRRQMHRQFRKPLILF	mito(20),nucl(3),cyto(3),cyto_nucl(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBE2	Piso0_001990 protein	Low	6.1	1	4-23	TSTLRKNTKKLTLNNGQKIP	cyto(12.5),cyto_mito(11),mito(8.5),nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YH58	Piso0_003089 protein	Low	9.9	1	1117-1136	ESSPSPKKPVKREIGCNGNL	nucl(19.5),cyto_nucl(13),cyto(3.5),mito(2),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YHF3	Piso0_003188 protein	Low	9.1	1	35-56	NELHFYQRKGAKRRRRLPEFID	cyto(9),cyto_nucl(7.333),cyto_mito(6.833),nucl(4.5),pero(4),mito(3.5),plas(2),extr(2)	KGAKRRRR (43-50, prob:0.778)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YI86	Piso0_003489 protein	Low	5	1	142-163	DQSLRRRIDKAKEKYMKKNGSL	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YIZ1	Piso0_003399 protein	Low	5.4	1	492-514	AHVFGYKVKKLRKERLGNAKIGD	plas(11),mito(8),E.R.(4),nucl(1),cyto(1),extr(1),cyto_nucl(1),golg(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YKH2	Piso0_003149 protein	Low	6.8	1	139-158	QELVDEKKNKYKKTRWFSSW	mito(14.5),cyto_mito(9.833),nucl(7.5),cyto_nucl(6.333),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YKP2	RNA polymerase II holoenzyme cyclin-like subunit	Low	8.2	1	4-23	DYWSSSQRTKWQFNRQTLLD	nucl(12.5),cyto_nucl(11.5),cyto(7.5),pero(3),mito(2),cysk(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRB1	Piso0_000711 protein	Low	9.5	1	73-97	FQKEDPARIRLKKKSEKYVTSHKKL	nucl(15),cyto_nucl(9.5),mito(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0Z9	Ubiquitin carboxyl-terminal hydrolase	Low	9.6	1	697-716	APKPEKKNWVNGLKRRESKL	nucl(19.5),cyto_nucl(13.333),cyto(6),cyto_mito(3.833)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2D9	Piso0_005592 protein	Low	6.9	1	18-40	HIFTNPKAKANKKTQRWYKNVGL	mito(13),cyto(7.5),cyto_nucl(7.5),nucl(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4V0	Piso0_005340 protein	Low	9.4	1	313-341	APGIRNTKGKADNKKKYKQWFRMIKAMNI	plas(9),E.R.(9),nucl(4),mito(2),cyto(2),cyto_mito(2)	TKGKADNKKK (319-328, prob:0.697)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YE07	Piso0_002061 protein	Low	8.4	1	122-141	GQNKLSSKGRPKGKWKAEPW	mito(14),cyto(7),pero(3),nucl(1),extr(1),vacu(1)	RPKG (131-134, prob:0.622)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YH07	Piso0_003037 protein	Low	9.4	1	20-51	LIIMAKEKRTKPCFNCKKSKVKCIYTNTLPCE	nucl(15.5),cyto_nucl(11.5),cyto(6.5),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YIF8	Piso0_003201 protein	Low	6.9	1	38-62	GGKAPSKTAKPTKKYGQERELKITP	E.R.(10),nucl(5.5),cyto_nucl(5.5),cyto(4.5),mito(2),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJ84	Mitochondrial group I intron splicing factor CCM1	Low	8.8	2	32-52, 59-82	KAVPEKKSSSHLKTKLKHFIE, YTPLQLKKSFERQKGKQLRQSKAG	mito(19),nucl(5),cyto_nucl(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YK74	Ribosomal protein	Low	9.8	1	29-63	MLAPNDKKKREQVKESKKKEKRMQLLKLRHKQNPE	mito(17.5),mito_nucl(13.333),nucl(8),cyto_nucl(5.333)	KKKREQVKESKKKEKRMQLLKL (35-56, prob:0.955)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMN7	Piso0_001255 protein	Low	9.1	1	211-230	VPPKKEKKAAQQPKENKAKE	mito(13),cyto_mito(10.666),mito_nucl(10.166),cyto_nucl(7.166),cyto(7),nucl(6)	PKKEKKAAQQPKENKAKEVKPEQPAQAPKPKHP (213-245, prob:0.911)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPK2	Piso0_000611 protein	Low	8.2	1	60-89	PSCSNCTKYARKCSYKSSRRVNPHERTLSF	plas(15),nucl(9),cyto(1),pero(1),vacu(1),cyto_pero(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPK3	Piso0_000612 protein	Low	5	1	8-28	AIGRYSRPPWYKNRHLRMLYC	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQJ0	Piso0_000960 protein	Low	5	1	745-767	VQNIMQRIRRWRNANNNNENNEN	plas(8),E.R.(6),extr(4),golg(3),cyto(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YSU6	Piso0_000003 protein	Low	5	1	17-36	REKFDPKTGIKRGLKQRHIS	plas(22),mito(2),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4J6	GlcNAc-1-P transferase	Low	5	1	4-23	VPELRVRRKTKETVRGMKGG	plas(21),pero(2),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDL5	Piso0_002820 protein	Low	7.1	1	38-59	YNTSRIKKKLGCEEPKRYLKSS	mito(12),nucl(6.5),cyto_nucl(5.5),pero(4),cyto(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YI09	Piso0_003409 protein	Low	9.8	1	1037-1059	NTEKKEFFKTKKVKKTLDPTWNE	cyto(11.5),cyto_nucl(10.5),nucl(6.5),mito(4),E.R.(3)	RKAKEEKEKSKGDKK (822-836, prob:0.805)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLM7	Piso0_001755 protein	Low	5.7	1	471-491	TRSNIPQPHRRRSSPFGRRSS	plas(16),mito(4),nucl(2),E.R.(2),cyto(1),golg(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMG8	Piso0_001333 protein	Low	9.1	1	581-607	YPEVKRMYKTIDKNKHRHLKLKAEETY	nucl(16),cyto_nucl(13),cyto(6),mito(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPZ2	Piso0_000756 protein	Low	5	1	1021-1042	IKRMNSRRSKAQKIKNTTKITK	plas(13),E.R.(4),mito(3),pero(3),vacu(2),cyto_mito(2),mito_nucl(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YSA7	Piso0_001067 protein	Low	6.9	1	108-133	AISHHACYRTRHRHRRQTAHIYTPGH	mito(16),nucl(5),extr(3),cyto(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTU7	Piso0_000381 protein	Low	5	1	4-25	AATFRRMVKKSWRKWTTKEGLI	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y6G0	Piso0_003731 protein	Low	9.1	1	4-36	VLPISCISCRRRKIKCNKRKPCNQCIRRGIVCQ	nucl(14.5),cyto_nucl(10),mito(8),cyto(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBG4	Piso0_002015 protein	Low	9.6	1	737-756	KLGGKEPKKSRTKLHLTVDE	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFY7	Lysophospholipase	Low	5	1	606-625	QKQPDDCKKCFKKYCWVGNE	extr(26)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLG0	Piso0_001684 protein	Low	8.7	1	254-275	VETKSEHPRSPKKKTSIEPSKT	nucl(19),cyto_nucl(14.666),mito_nucl(10.832),cyto(7)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMD9	Piso0_001302 protein	Low	9.7	1	280-304	TEAGPKGKSDREKKMKIKAESKKTL	cyto_nucl(6),nucl(5.5),cyto(5.5),plas(5),mito(3),E.R.(3),extr(2),golg(2)	PKGKSDREKKMKIKAESKK (284-302, prob:0.887)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPR3	Piso0_000674 protein	Low	5.4	1	553-584	EKFFRVNPIQTNRKRYWRKRINEYNKIHNYEG	extr(12),E.R.(7),golg(5),nucl(1),plas(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQ01	Piso0_000765 protein	Low	9.5	1	70-91	GRDNVQKTKRYARKRIIFIGTS	nucl(14.5),cyto_nucl(9),mito(5),plas(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQ27	Piso0_000791 protein	Low	6.2	1	92-112	GRKKWQPSTRAVWNKNKQPQK	mito(10),cysk(6),cyto(5.5),cyto_nucl(5),nucl(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YSL4	Mitochondrial genome maintenance protein MGM101	Low	9.4	1	241-269	IFAEHITTKKKKKLWKLKRNPTLEYPYKK	mito(19.5),cyto_mito(11.5),nucl(5)	KKKKKLWKLKR (249-259, prob:0.876)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUP0	Piso0_000157 protein	Low	8.9	1	20-40	EISNSKKLPKVRKPQTDEEFL	nucl(16.5),cyto_nucl(12.833),cyto(8),cyto_pero(4.833)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y015	Piso0_005820 protein	Low	5	1	41-65	LTKSAKLFPSKDKKKYCNVDNQPAL	plas(17),E.R.(7),extr(1),pero(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y736	Piso0_003960 protein	Low	8.6	1	60-85	PTSNNYTGSRSNRKKKFNFIHHFQVP	nucl(9),E.R.(6),mito(5),pero(3),cyto(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YF80	Piso0_002504 protein	Low	9.3	1	602-625	DLNKHTIQYKMKKSKTKSGQHLAD	nucl(16.5),cyto_nucl(13),cyto(6.5),mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFU9	Iron-sulfur cluster assembly protein	Low	5	1	153-173	AVKDYRSKRVTKKPTLGPDAD	mito(15),cyto(12)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YP65	Piso0_001820 protein	Low	8.6	1	3-28	PTSNSEANTRRNKSRRRSSIESYPFK	nucl(17),mito_nucl(12.499),cyto_nucl(11.333),mito(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YU24	Piso0_000465 protein	Low	7.4	1	20-44	SEKYRAWEPKIKKYREKLVNSIPEE	cyto(15.5),cyto_nucl(15),nucl(9.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YU83	Piso0_000528 protein	Low	9.1	1	643-664	LDCIREERKTKIRKTNKGQYYT	nucl(14),mito(11),cyto_nucl(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZX9	Piso0_005781 protein	Low	7	2	42-61, 599-619	WIPRWIRSKRDTGKLKYRGL, TASKHECQRNLWRKNAPNIYC	plas(17),mito(3),E.R.(3),golg(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YAS8	Endo-1,3(4)-beta-glucanase	Low	7.5	1	6-34	LKNALKKIDKSLKDKHKEKQQSGNEEQQN	nucl(8.5),cyto_nucl(8),mito(7),cyto(6.5),pero(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFV0	Piso0_002743 protein	Low	5	1	254-273	LVFQRKSNSRNKKRAYSVIV	plas(13),mito(6),pero(3),cyto(2.5),cyto_nucl(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YH24	Glycerol kinase	Low	6.4	1	595-624	NNSFKAKLPDAERRRNWRRWERAIDRAKDW	mito(11.5),cyto_mito(9.5),cyto(6.5),nucl(5),extr(2),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQD5	Piso0_000904 protein	Low	7	1	81-101	DYLSKDKKPYVPKLKHERLTY	mito(16),nucl(6.5),cyto_nucl(6),cyto(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQU6	DNA ligase	Low	8.2	1	645-667	SFEQQFKKSKLRKRDVKTALFKD	cyto_nucl(12.5),nucl(11.5),cyto(10.5),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRW8	Piso0_000925 protein	Low	5	1	51-74	VDVNIRRCLKWRSCRPSNGWTRVE	extr(8),golg(8),E.R.(6),vacu(2),mito(1),plas(1),pero(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUT4	ATPase GET3	Low	9.7	1	275-296	DEDPCKRCQARWKMQKKYLDQM	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1M9	Magnesium transporter	Low	8.3	1	424-454	LIDRLKWRSRWMYFHRRKKLHYPTSREKDVI	nucl(10),mito(8.5),cyto_mito(5.5),plas(3),pero(2),cyto(1.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3W9	Piso0_004983 protein	Low	5	1	8-28	TSPIKTPSKTPSKTRKFVSRS	plas(24),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4M1	1,3-beta-D-glucan-UDP glucosyltransferase	Low	8.8	1	1689-1718	PGSQLRPRVLSKKQKRVRRMKVQLYTFIFL	plas(23),nucl(2)	SKKQKRVRR (1699-1707, prob:0.73)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y7N5	Piso0_004165 protein	Low	5.8	1	309-328	MPTSTNTSKPLCKKKKRSYH	mito(11),extr(8),cyto(4.5),cyto_nucl(4),nucl(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCS9	Piso0_002504 protein	Low	9	1	602-625	DLNKHTIQYKSKKSKMKNGQHLAD	nucl(15.5),cyto_nucl(12.5),cyto(6.5),mito(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YD30	Piso0_002613 protein	Low	9.2	1	506-535	VKVRPAGGAKRRKHKKKKHDSSYRLRHTLS	plas(13),nucl(3),E.R.(3),cyto(2),golg(2),mito_nucl(2)	VRPAGGAKRRKHKKKKH (508-524, prob:0.995)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFK1	Piso0_002634 protein	Low	8.1	1	75-99	TKRHYFVQWRKFTTKKNKTWEDDGL	nucl(15),mito_nucl(11.333),cyto_nucl(10.333),mito(6.5),cyto(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YHN3	40S ribosomal protein S25	Low	8.9	1	15-40	AAMAGGKKGKKKWNKGKVKDKAQHVV	cyto(15.5),cyto_nucl(10.333),mito(6.5),mito_nucl(5.833),nucl(4)	KAAAAMAGGKKGKKKWNKGKVKD (12-34, prob:0.985)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJR9	Piso0_002890 protein	Low	9.6	1	33-63	AKHGRSRGGCVNCKRSKKKCDEGKPFCQNCS	nucl(15.5),cyto_nucl(10),mito(8)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YM32	Piso0_001933 protein	Low	8.8	1	1-22	MAKSKGDRKRSHQIDERKRSAF	nucl(18),cyto_nucl(11.333),mito_nucl(11.333),mito(3.5),cyto(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNN8	Piso0_001629 protein	Low	7.5	1	7-36	RIAIVSSDKCKPKKCRQECRRSCPVVKTGK	nucl(9.5),cyto_nucl(8.333),mito(7.5),cyto_mito(7.333),cyto(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQ51	Hsp90 chaperone protein kinase-targeting subunit	Low	9.2	1	22-49	HPNVDKRSFIRWKQRDIHEKRQQRNIEI	nucl(17.5),cyto_nucl(12.833),cyto(7),cyto_pero(4.333)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YV56	Piso0_000333 protein	Low	5	1	663-685	LDTNKGEIKSWKRKQDNPEQDFD	golg(10),E.R.(8),extr(5),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	C7U023	Endonuclease, NAD5 group I intron encoded	Low	5.8	1	597-618	YFNKYPLRSSKSKRLNLIKEFY	plas(19),E.R.(4),nucl(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y059	DNA helicase	Low	7.8	1	649-679	LLKKSNTKYISKQKLQTYKKRKVMNNDLNDE	nucl(12.5),cyto_nucl(10.333),mito_nucl(9.666),cyto(6),mito(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y060	Piso0_005867 protein	Low	7.6	1	344-365	ADNTRRKRTAKDREYDLRNQLF	mito(13.5),nucl(10.5),cyto_mito(8.833),cyto_nucl(7.333)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4D3	DNA polymerase	Low	8.9	1	1498-1517	YYQKHVFKMRSKDGEHKQKL	nucl(15),cyto_nucl(13.5),cyto(10)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YG33	Methyltransferase-like protein	Low	9.4	1	297-316	GTDRRLLVNRKKQLKMYRNW	nucl(11),cyto(9),pero(3),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPA3	Piso0_001859 protein	Low	8.1	1	145-166	FGGYWKWWYKRRKENIKMIMNE	mito(16),nucl(8),cyto(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	C7U024	Endonuclease, NAD5 group I intron encoded	Low	5	1	477-496	IKYFNKYKLKTKKLIIYNNW	plas(17),E.R.(5),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZ91	Piso0_005526 protein	Low	9.9	1	54-78	ALSTDKKWSKERINKKAKNLKVKMG	mito(13.5),mito_nucl(12.999),nucl(10),cyto_mito(9.332),cyto_nucl(7.999)	WSKERINKKAKNLK (61-74, prob:0.75)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y113	Ubiquitin carboxyl-terminal hydrolase	Low	9.6	1	720-746	DDNKWFCSKCKRSTKSTKKISITRLPQ	nucl(17),cyto_nucl(13),cyto(7)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1B2	Derlin	Low	8	1	252-272	DQERKNARRRNEGRVKQHAKI	plas(20),E.R.(5)	RRR (259-261, prob:0.627)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1L8	GlcNAc-1-P transferase	Low	5	1	4-23	VPELRVRRKTRETVRGMKGV	plas(13),E.R.(9),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y396	Piso0_005925 protein	Low	8.7	1	582-601	VETCERKILRKEFRAKKIIS	nucl(14),cyto_nucl(12.5),cyto(9),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YC41	Piso0_002252 protein	Low	5	1	541-566	IIPFFIWGKAWRKKTKKLYLELVELT	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFB1	Piso0_002537 protein	Low	6.9	1	42-63	LVWDREKPRKLRPFVGKRSFNP	extr(6),E.R.(6),nucl(5),cyto(3),golg(3),mito(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YG13	Piso0_002809 protein	Low	5.7	1	124-146	FGLFLKYRRSRMKSNHVKNCASC	plas(16),cyto(3),nucl(2),mito(2),golg(2),mito_nucl(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJM9	Piso0_003643 protein	Low	9	1	702-723	KALPKVKKPNVARPANKKPSAT	nucl(17),cyto_nucl(13.333),cyto(7.5),cyto_mito(5.166)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YK06	Piso0_002978 protein	Low	9.7	1	99-119	DNTSSKKNKKGKALKEKRIVG	mito(18.5),mito_nucl(13),nucl(6.5)	KKNKKGKALKEKR (104-116, prob:0.862)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YL48	Piso0_001564 protein	Low	9.5	1	178-198	YETSPRKLPRRPARPIRIRSD	plas(11),nucl(4.5),cyto_nucl(4),E.R.(4),cyto(2.5),pero(2),golg(2)	KLPRRPAR (184-191, prob:0.676)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMK1	Piso0_001210 protein	Low	5	1	94-116	GIPCDKCKFCRKGRYNLCKEMRF	cyto(11),mito(5),extr(3),pero(3),E.R.(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQ84	Piso0_000849 protein	Low	5	1	211-231	ATSPRFGQRPNGKKKWFNFFF	plas(12),mito(10),E.R.(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTI0	Piso0_000260 protein	Low	9.5	1	1269-1288	SLKIDVNKHHEQKKNKKDIA	nucl(16),cyto_nucl(10.5),mito(4),cyto(3),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZY2	Piso0_005784 protein	Low	8.4	1	3-40	KTDMRRTSKARVSGKRSRSGCLSCKRLKIKCNEARPTC	nucl(10),mito(7.5),cyto_mito(5),plas(3),pero(2),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0R7	ER membrane protein complex subunit 3	Low	5	1	36-59	LLSPGPKKTPYKKIRETQFLRRAE	plas(12),mito(6),E.R.(4),mito_nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4F5	Piso0_005180 protein	Low	5	1	45-71	ESSSQHSKLEPKKIPKSLKREDRPVFI	plas(23),pero(2),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4N4	Piso0_005270 protein	Low	9.8	1	613-635	QDHSEHYRARRRYQQHETYYNDL	nucl(19.5),cyto_nucl(14),cyto(7.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YC55	Piso0_002266 protein	Low	6	1	80-99	IRVGTRTDKKQKPQDKIDIV	cyto(22),cyto_nucl(15),nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCJ1	Piso0_002408 protein	Low	8.9	1	290-314	DVPLKQTKSEKLQKRKRMLSDNADL	nucl(19.5),mito_nucl(13.833),cyto_nucl(11.166),mito(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YD80	Piso0_002673 protein	Low	8.3	1	162-184	FFFQNTRPRRQQRQQQQRQQEDM	nucl(10.5),cyto_nucl(8),cyto(4.5),plas(4),mito(3),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFC0	Piso0_002547 protein	Low	8.1	1	690-709	KDPNDSRKVLRHTRAYYKKL	cyto_nucl(12),nucl(11),cyto(11),mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMS7	Piso0_001297 protein	Low	5	1	819-842	DGVLRCVYRPKKNKYFLQHHRGDS	E.R.(10),plas(8),mito(2),extr(2),pero(2),cyto(1),golg(1),vacu(1),mito_nucl(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTF5	Peptide hydrolase	Low	7.6	1	48-69	LDEFQKKVFRFSKRRFWWSCFL	plas(13),nucl(7.5),cyto_nucl(4.5),golg(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4A5	Protein disulfide-isomerase	Low	6.9	1	522-541	GHDLRKKLDEKKPSEDKKEE	cyto(11),nucl(5),vacu(4),mito(2),extr(2),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y9F6	Piso0_004673 protein	Low	9.9	1	75-94	VTSCTFCRQHKIKCNASDNF	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBM7	Piso0_002081 protein	Low	6.7	1	6-27	KPETLVKKSKSQQKTAEQRAAD	nucl(9),mito(9),cyto(9),cyto_nucl(9),cyto_mito(9),mito_nucl(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEU1	Piso0_002353 protein	Low	7.8	1	173-197	KSTTRPSSRLARHWTRRQPDREAGF	extr(13),nucl(7),mito(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YGJ4	Piso0_003665 protein	Low	5	1	88-112	DEYEYRLNKHQRSKHKWFKWFGGDN	plas(23),mito(2),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YKV6	Altered inheritance of mitochondria protein 11	Low	7.1	1	15-34	ASSSDEYKQRRKRQMGIFMA	mito(9),nucl(6.5),cyto_nucl(6.5),cyto(5.5),plas(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMU5	Piso0_001315 protein	Low	7.9	1	359-384	ELDTCMKLIEKKKTKEKSQYAKFFGS	nucl(8),cyto(7),mito_nucl(7),mito(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFR7	Piso0_002708 protein	Low	7.1	1	267-294	VYLSLKCTNNIKKRKKFRQNMNLVRRMP	nucl(6),extr(5),E.R.(5),mito(3),plas(3),cyto(2),pero(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YGB1	Piso0_003580 protein	Low	8	1	204-227	DVPDSKRPGSKRKRRIPRSGFPSF	plas(16),E.R.(5),mito(2),vacu(2)	KRPGSKRKRRIPR (209-221, prob:0.937)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YK00	Piso0_002972 protein	Low	5	1	29-51	ALTSRCTVIRKRQHSRKMIYLKS	mito(22),cyto(2),extr(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YM52	Piso0_001953 protein	Low	5	1	399-420	VARSSSRKHLTKHSRNNSNASN	plas(10),mito(6),E.R.(4),golg(3),cyto_mito(3),mito_nucl(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNX4	Alpha-1,3-glucosyltransferase	Low	8	1	1-27	MGNPGSKKNVSKNSRQHKQGKVSSASK	plas(24),E.R.(2)	RQHKQGKVSSASKRGR (15-30, prob:0.677)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YSP7	Piso0_000555 protein	Low	8	1	1012-1046	ASAKKKTKLSSAELRKKKKERMKKKKELGDAYVSS	cyto(25.5),cyto_nucl(14)	SAKKKTKLSSAELRKKKKERMKKKK (1013-1037, prob:0.998)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTB3	Piso0_000187 protein	Low	7.8	1	126-152	FSGFKIKYVTWRHKQHREKKNSVSSSS	mito(15),nucl(7),cyto(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YU26	Piso0_000467 protein	Low	9.4	1	21-46	DSIEAKKNELKKSKRSKLNNVIEDSF	nucl(16.5),cyto_nucl(12.5),cyto(5.5),pero(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZI0	Piso0_005626 protein	Low	8.8	1	581-608	IENGLTRKSSKSKQFKKKVDRDLNDTLE	nucl(15),cyto_nucl(12.5),cyto(8),mito(1),E.R.(1),golg(1),cysk(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y156	Piso0_005055 protein	Low	9.6	1	463-483	NMMKKRSQLNLQKQQRDRVSK	nucl(18.5),cyto_nucl(14.5),cyto(7.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1P2	Biotin carboxylase	Low	8.3	2	35-56, 2186-2209	YIARRTFKIKALTRVNNRNQVF, DWPEARRYFFWRLRRRLNEEYLLK	mito(14.5),cyto_mito(11.5),cyto(7.5),nucl(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1T3	Piso0_005299 protein	Low	9.8	1	196-216	TEKPEREKKLKPLPKGQQTLN	nucl(19.5),cyto_nucl(14.5),cyto(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YB74	Mediator of RNA polymerase II transcription subunit 13	Low	9.6	1	1369-1389	VTNVKSWYCKNQKKNDNDIFD	nucl(19),cyto_nucl(14.5),cyto(8)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDR3	Piso0_002870 protein	Low	9.9	1	1094-1113	QNEQLRKNLRKKVSHVQNLY	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEJ4	Protein DML1	Low	8.9	1	471-492	FKNTMKYYRKVLKRVRDNEIIE	nucl(14.5),cyto_nucl(12),cyto(8.5),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YHN4	Piso0_003273 protein	Low	7	1	191-213	LMAKIEKKFKHRQNGPNDINKNN	mito(20),nucl(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZI3	Piso0_005629 protein	Low	7	2	209-233, 705-728	KNLDRVKTIKKTKGNPKANNRYNIG, FDTLKVKQKGNKQRMKEDDNKTEF	plas(14),E.R.(8),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y231	Piso0_005401 protein	Low	5.8	1	40-61	KSAYKQLSKKFHPDKNPSQEAH	extr(11),E.R.(7),golg(4),nucl(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4Z4	Piso0_005390 protein	Low	8.3	2	10-32, 645-664	EFYYPSQKSKEYKKLRQEVTNEY, NIEHKIYKGRPKINYRYYNW	plas(13),E.R.(5),nucl(4),mito(4),mito_nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBQ0	Piso0_002105 protein	Low	5	1	54-83	DKQLKSLKNLHGKKCEKCKARLRYAREAIV	E.R.(8),extr(7),cyto(5),golg(3),cyto_mito(3),cyto_pero(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJX3	Piso0_002945 protein	Low	6.7	1	12-31	NGSLRVVRVKKKSREGVVVK	mito(14),cyto(6.5),cyto_nucl(6.5),nucl(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMU4	Piso0_001314 protein	Low	8.9	1	316-336	KDALLQKYSRKWRKNIPDVLF	nucl(12.5),mito(9),cyto_nucl(8),cyto(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNM6	Sphingolipid delta(4)-desaturase	Low	7.5	1	345-366	DINKLWNRVKRSGKIKNGTSVK	plas(14),nucl(7),cyto(2.5),cyto_mito(2.5),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2K8	Piso0_005663 protein	Low	6.1	1	471-498	IESPTIPRFFRRRRWVRRCCRHSTVDTD	plas(18),nucl(3),cyto(3),cyto_nucl(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDJ8	Piso0_002803 protein	Low	7	1	40-63	NHVVKNDSRKQHSRKDLQKHVITP	mito(16),nucl(6.5),cyto_nucl(6),cyto(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFZ6	Piso0_002792 protein	Low	9.2	1	510-534	ASTRSNKKIDPQHARNQRRRSSTST	nucl(16),cyto_nucl(13.5),cyto(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YG61	Piso0_002859 protein	Low	8.2	1	643-663	IDSMHKNKKSFKALAKKFNDS	nucl(10),mito(7.5),cyto_mito(6),cyto(3.5),plas(2),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJ20	Piso0_003428 protein	Low	7.6	1	19-38	QVFRSTLKFMKNKNRNTQVS	mito(13),nucl(8.5),cyto_nucl(7),cyto(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRL1	Hsp90 chaperone protein kinase-targeting subunit	Low	8.7	1	22-49	HPNVDKRSFIRWKQRDIHEKRQQRNIEI	nucl(16.5),cyto_nucl(13.333),cyto(9),cyto_pero(5.333)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YSG4	Piso0_001124 protein	Low	8.7	1	97-118	AERPTHQSRGPRRDDYRRRARD	nucl(18),cyto_nucl(14.333),mito_nucl(11.165),cyto(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YVE6	Piso0_000425 protein	Low	9	1	239-262	TVKTKFLNRVPSKRNKTEKWLERL	nucl(15.5),cyto_nucl(12),cyto(7.5),mito(2),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4L9	Biotin carboxylase	Low	6	1	2186-2209	DWPEARRYFFWRLRRRLNEEYLLK	mito(15.5),cyto_mito(12),cyto(7.5),nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4M8	Piso0_005264 protein	Low	8	1	37-58	IWDYRKDCYKKNSKNLEKYNAG	mito(11),nucl(10.5),cyto_nucl(8.5),cyto(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEW5	Piso0_002379 protein	Low	9.9	2	32-53, 457-480	EEQILKSKTLNRKNFKKLSLES, YDKDVKIWAKKIRKIHKAQGETSH	nucl(13.5),cyto_nucl(11.333),mito_nucl(9.666),cyto(7),mito(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YGK2	Piso0_003673 protein	Low	5	1	364-383	FVKRETKRYKPNPSSKPWSE	extr(9),E.R.(6),plas(5),golg(4),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPQ4	Piso0_000665 protein	Low	8.4	2	77-97, 657-677	LSYQRRWKYPRINGKSEHCFD, YVFNEFMKSKKKKTQLCARRI	plas(18),nucl(4),E.R.(3),mito_nucl(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPU9	Piso0_000712 protein	Low	8	1	192-211	ASPIPKASKKPAKKASSPSE	extr(8),mito(5),E.R.(4),cyto_mito(4),cyto(3),plas(2),pero(2),vacu(2)	KASKKPAKK (197-205, prob:0.75)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQZ0	Piso0_001112 protein	Low	5.8	1	401-437	LSHLKKRSFAGKNTTHRRIPFRTKKNSQLPRYRSDVQ	plas(10),E.R.(6),golg(4),mito(3),nucl(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTV7	Piso0_000391 protein	Low	8.2	1	235-256	FVVSKFGKKRFVRRFQNQLIMS	plas(10),nucl(9),cyto(3),golg(2),cyto_mito(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4F8	Piso0_005184 protein	Low	5	1	505-528	ALFFFCCYRKKRNEKKSEPDLEKD	extr(9),golg(7),E.R.(6),vacu(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y9R9	Piso0_003877 protein	Low	5	1	500-520	AKFYYVGRNRHKERKWNSMTP	plas(23),pero(2),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFT5	Piso0_002727 protein	Low	8.9	1	1-25	MNVFNKKIGKVKKNKGKANMIRVGY	mito(21.5),mito_nucl(13),nucl(3.5)	KIGKVKKNKGK (7-17, prob:0.758)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YL09	RHOMBOID-like protein	Low	8	1	197-221	DSEYRKMRKNEKARIKQLNRKPRFH	plas(11),mito(7),E.R.(4),golg(3)	KMRKNEKARIKQLNRKP (202-218, prob:0.783)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YN95	Piso0_001474 protein	Low	5	1	398-417	LKQRPFSRPNFKNENKKVFR	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNV3	Piso0_001698 protein	Low	9.1	1	48-74	ADKKKAEEAKKKLKKLHSKLSKEKSAL	mito(19.5),cyto_mito(11.333),nucl(4.5),cyto_nucl(3.833)	QSGADKKKAEEAKKKLKKLHSKLSKEKSALSQLKKKYAEASKKEKQKIKQLETKEKQKLLEAKKKSKQQESIAKKKEQDLLKKATKP (45-131, prob:0.996)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPB8	Piso0_001883 protein	Low	8	1	1152-1171	QELSKIPKKKFRDSDKTYAT	plas(24),E.R.(1),golg(1),vacu(1)	GSKKRK (1492-1497, prob:0.676)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQX9	Piso0_001101 protein	Low	8.8	1	281-300	TIKTIPTKQMPQKRRKSTMS	nucl(18),cyto_nucl(12.333),mito_nucl(11.333),cyto(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YV25	Piso0_000299 protein	Low	6	1	242-261	INEFKRKNKKDLSNNQRALR	cyto(21),cyto_nucl(14.5),nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZD1	Piso0_005575 protein	Low	8	1	131-159	GKSFPHWKTHPHDRRPHKRYKQDEYFEAQ	plas(12),E.R.(8),mito(3),vacu(2)	RKKGRN (413-418, prob:0.691)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0P1	Carboxypeptidase	Low	5	1	561-587	SSYKSRPTSIIKNKSSNKKKNVQWADQ	extr(12),E.R.(6),golg(5),cyto(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y328	Tafazzin family protein	Low	6.9	1	299-320	IESYRKRWRDLCKKYIDPRNPS	plas(7),nucl(5),E.R.(4),golg(4),mito_nucl(4),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y715	Piso0_003939 protein	Low	7.2	1	4-27	FNTIRGFGRNSKKNKKDIDPSSPF	mito(13),nucl(7),cyto_nucl(7),cyto(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YGS1	Piso0_002950 protein	Low	8.5	2	113-133, 514-536	GIVTNWKTKRHKGSCRSVIFD, NSDKPSSKKIKLSKQISSKQMKN	mito(12.5),mito_nucl(10.166),cyto_mito(9.833),nucl(6.5),cyto(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLJ6	Alpha-1,3-glucosyltransferase	Low	8	1	1-27	MGNPGSKKNVSKNSRQHKQGKVSSGSK	plas(24),E.R.(2)	SRQHKQGKVSSGSKRGRP (14-31, prob:0.715)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YND9	RHOMBOID-like protein	Low	8	1	141-167	GDSEYRKMRKNEKARIKQLNRKPRFHY	plas(24),pero(1),golg(1),vacu(1)	KMRKNEKARIKQLNRKP (147-163, prob:0.779)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUW1	Peptide hydrolase	Low	8.6	1	48-69	LDEFQKKVFRFSKRRFWWSCFL	nucl(12),plas(8),cyto_nucl(8),golg(3),cyto(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1K8	Piso0_005217 protein	Low	8.3	1	312-359	EKREGGRHRVFKKKPSKQQRRSLRRLKNSEKRIKERERKLREEKYGDP	plas(8),E.R.(7),golg(3),vacu(2),extr(2),mito(2),nucl(1),cyto(1),cyto_nucl(1),pero(1),cyto_pero(1)	KREGGRHRVFKKKPSKQQRRSLRRLKNSEKRIKERERKLR (313-352, prob:0.995)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3M6	Carboxypeptidase	Low	5.3	1	562-587	SYKSRPTSIIKSKSSNKKKNVQWADQ	extr(12),E.R.(7),golg(4),nucl(1),cyto(1),cyto_nucl(1),pero(1),vacu(1),cyto_pero(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YC98	Piso0_002310 protein	Low	9.8	1	141-172	EYNQNYRNSHHNKKEKNSNKKKDAFNNWERKN	nucl(19),cyto_nucl(14.5),cyto(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDZ8	Piso0_001297 protein	Low	5.7	1	820-843	DGVLRCVYRPKKNKYFLQHHRGDS	E.R.(10),extr(9),nucl(2),golg(2),mito_nucl(1),vacu(1),pero(1),plas(1),cyto(1),cyto_pero(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFV2	Piso0_002745 protein	Low	9.9	1	68-88	ENKFHQFKKIRSKKSEMKASG	nucl(18),cyto_nucl(11.5),mito(4),cyto(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YK59	Piso0_003032 protein	Low	6.2	1	53-73	EKVQLSKKKRITNDAIKRLLR	plas(9),cyto(4),nucl(3),mito(3),pero(3),mito_nucl(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YK85	Piso0_003058 protein	Low	6.5	1	79-98	ASDREKGKRQSRMQPGCQKS	mito(10),cysk(9),nucl(4.5),cyto_nucl(4),cyto(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLE2	Piso0_001666 protein	Low	5	1	253-275	DLNKLFQLRKKIKRKTEYYWIKY	plas(16),mito(5),E.R.(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0S1	Protein N-terminal and lysine N-methyltransferase EFM7	Low	7.9	1	19-44	YKEAPKPHFVKYKRKKDTSNNEIELR	nucl(11),cyto_nucl(10.5),cyto(8),mito(4),plas(1),golg(1),cysk(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1H4	Piso0_005180 protein	Low	5	1	45-71	ESSSQHSKLEPKKMPKSLRREDRPAFI	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2S6	Piso0_005736 protein	Low	6.2	1	1348-1375	SWDPKPCPGKLKQFKKKHSIKMSTFTKM	E.R.(7),plas(6),nucl(3),extr(3),vacu(3),cyto(2),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y309	Piso0_005826 protein	Low	9.2	1	12-39	EVDIKIARQKARKRMRVVCRRYKCLSNL	nucl(16.5),cyto_nucl(14),cyto(8.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y8G2	Piso0_004312 protein	Low	7.4	1	346-366	APTGAPADPCTRKRKRRYFLY	cyto_nucl(10),nucl(8),cyto(8),extr(8)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFZ2	Piso0_002787 protein	Low	9.6	1	181-203	GGARRMAAKRRARQKQRVQAGTY	cyto(9.5),extr(8),cyto_nucl(8),nucl(5.5),plas(1),pero(1),golg(1),vacu(1)	RGGARRMAAKRRARQK (180-195, prob:0.903)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YH78	Piso0_003111 protein	Low	9.4	1	42-75	DMGKRLDEARRRKKKGDKSLKDKKRSQRTSRDDS	plas(8),nucl(5),mito(5),mito_nucl(5),extr(4),cyto_nucl(4),cyto_mito(4)	EARRRKKKGDKSLKDKKRSQR (49-69, prob:0.994)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YND7	Piso0_001519 protein	Low	8.7	1	107-128	LSEILRCRWKSRRSLNDFKYEV	nucl(10),plas(5),mito(3),cyto(3),E.R.(3),cyto_mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNY5	Piso0_001735 protein	Low	5	1	137-157	SWLSWKRKTENSKKHKKTGNY	plas(13),E.R.(8),golg(3),mito(1),pero(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQ96	Piso0_000862 protein	Low	8	1	1022-1054	AGSECWKWMKRIYFRRKAKKAKNPEHELERNDP	plas(24),golg(2)	RRKAKKAK (1036-1043, prob:0.81)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRD3	Piso0_000734 protein	Low	8	1	21-40	TVSEAKAKRRHNPLYRDIES	cyto(14.5),cyto_nucl(14),nucl(12.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTJ3	Piso0_000274 protein	Low	9.5	1	504-531	DPPTVPSSSSKPSKKKKNKKKSSKKKKN	cyto_nucl(6.5),cyto(6),E.R.(6),nucl(5),extr(3),pero(3),golg(2),vacu(2)	KPSKKKKNKKKSSKKKKN (514-531, prob:0.999)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YU41	Piso0_000483 protein	Low	8.8	1	434-458	SDPSSSTKKPSKPSSKTSSRKTSKK	cyto(8.5),cyto_nucl(6),mito(4),plas(4),nucl(2.5),extr(2),pero(2),E.R.(2)	KKPSKPSSKTSSRKTSKK (441-458, prob:0.829)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZG0	Piso0_005606 protein	Low	7.3	1	328-350	TDDKITRQVVRKKRPVLPPLINT	mito(10),nucl(7.5),extr(6),cyto_nucl(6),cyto(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y7C8	Piso0_004053 protein	Low	5.4	1	125-144	GENLRSRKERKQTKTKDGED	extr(15),mito(5),cyto(2),golg(2),nucl(1),pero(1),E.R.(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDR2	Piso0_002869 protein	Low	9.3	1	297-325	KIKSDDIKKTMRQSNKKFKLSKEDKRTLW	nucl(16.5),cyto_nucl(13),cyto(6.5),mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YE70	Piso0_002126 protein	Low	5.7	1	147-167	GDTYKKKKKTVSSGLNHRRVI	plas(7),E.R.(6),golg(5),pero(3),nucl(2),mito(2),mito_nucl(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEF4	Piso0_002212 protein	Low	5.8	1	74-100	EDLKKNDFMKWRKKQINKANTAKIKNN	mito(16),cyto(6.5),cyto_nucl(5),nucl(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEQ7	Piso0_002319 protein	Low	8.5	1	6-26	KLSGRYGKRCLPRQVIRPVRF	mito(13),nucl(9),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YHC6	Piso0_003160 protein	Low	9.9	1	40-59	WFQNTKRRTIPNHLLPKKKT	nucl(20.5),cyto_nucl(15.5),cyto(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YSU4	Piso0_000001 protein	Low	9.8	1	7-37	KSLSRSRSGCYECRRRRKKCDESRPKCGLCV	nucl(13),plas(11),cyto(1),golg(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTL4	Piso0_000295 protein	Low	6.3	1	556-583	QEAQKSQPKSQPKQEKSKNQEKPSNDKA	cyto(19),cyto_nucl(15),nucl(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YU33	Piso0_000475 protein	Low	8	1	120-140	QRENKFTKKRQVDSAIKRPKV	mito(20.5),cyto_mito(13.166),mito_nucl(12.499),cyto_nucl(3.999),cyto(3.5)	KEKAKQTAPK (105-114, prob:0.644)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3Z7	Ubiquitin carboxyl-terminal hydrolase	Low	9.8	1	716-742	DDNKWFCSKCKRSTKSTKKISITRLPQ	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBP9	Piso0_002104 protein	Low	5	1	62-81	LEKGQKSLDKCNKCKYKLKF	extr(12),E.R.(7),golg(5),vacu(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YC49	Piso0_002260 protein	Low	7.6	1	23-46	SPGNGNRIRKRVQKQPKVTHAYKD	cyto_nucl(10),nucl(9.5),cyto(9.5),pero(3),mito(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDE1	Piso0_002743 protein	Low	5	1	250-269	LVFQRKSNSRNKKRAYSVIV	plas(16),mito(3),cyto(2.5),cyto_nucl(2),pero(2),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDQ0	Piso0_002857 protein	Low	8	1	1-31	MARRPARCYRYCKNKPFPKSRYNRGVPDPKI	mito(12),nucl(9),cyto_mito(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLK9	Karyogamy protein 5	Low	5.5	1	498-519	FYSILRTKKNRLHEKVAKSRSI	E.R.(10),plas(7),pero(3),mito(2),cyto_nucl(2),golg(2),nucl(1.5),cyto(1.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLT8	Piso0_001820 protein	Low	8.8	1	8-28	EASARHSKSKRRSNIESYPFK	nucl(18),mito_nucl(12.499),cyto_nucl(11.833),mito(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YP71	Trimethylguanosine synthase	Low	9.8	1	26-49	HNYYTLPKRCKKYWDKRYSLFSKF	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YT62	Piso0_000132 protein	Low	9.3	1	225-247	ESSSPPMKSKQYKRKSILPYHYP	nucl(16.5),cyto_nucl(13),cyto(8.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTZ1	Piso0_000427 protein	Low	7	2	83-105, 315-335	YSPTWHRYNRHYKRNDWNRLKIP, IGYGWWLTKKRQERIRRSYRF	plas(19),mito(5),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUV2	Endoplasmic reticulum junction formation protein lunapark	Low	7.7	1	34-53	QLSRIRTKSRNIKHNLCTYL	cyto_nucl(9.5),nucl(9),cyto(8),mito(5),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y090	Piso0_005899 protein	Low	8.7	1	490-518	DKPAKDTDKSKKKEKKEKKNKEIKTEEDK	plas(18),E.R.(3),nucl(2),golg(2),vacu(2)	DKSKKKEKKEKKNKEIK (497-513, prob:0.985)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y320	Piso0_005837 protein	Low	9.9	1	76-100	VRAAIQSVRRNRKRSYRSKHMDTSD	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y327	Piso0_005844 protein	Low	8	1	33-61	NLYNTKRYGSNWTKKWRNKKDVSIANSSV	mito(15),nucl(8),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3K2	Glutamyl-tRNA synthetase	Low	9.7	2	183-203, 542-562	ELKKNEKLSKGKKESHKANFE, ATPAKEERPKHKKNPEVGTKE	cyto(11),nucl(7),mito(4),pero(2),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4X4	Piso0_005368 protein	Low	9.7	1	75-98	NNEYRYSVNKHSKRFNKKLVSYMD	nucl(17.5),cyto_nucl(10.833),cyto_mito(3.333),cyto(3),mito(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y750	Piso0_003974 protein	Low	9.8	1	63-92	EVRPETQQEQQKRRREERRKQIQESHDRQL	nucl(20.5),cyto_nucl(16),cyto(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YC76	Piso0_002287 protein	Low	9.1	1	164-186	RILSKGRKFERARGRRRSRGFKV	mito(20),cyto_nucl(4),nucl(3.5),cyto(3.5)	HSNKAPRILSKGRKFERARGRRRSRGFKV (158-186, prob:0.99)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YKP7	Piso0_001403 protein	Low	7.3	1	614-638	KEFVAKMSKKLKKHSSTSRAAQEKD	mito(10.5),cyto_mito(9.5),nucl(8),cyto(7.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMT7	tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase	Low	9.3	1	230-249	QPEHKETKEERRERKMKEGL	nucl(17.5),cyto_nucl(14),cyto(9.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YN85	DNA ligase	Low	7.7	1	585-605	SYYEPSKRSRNWLKLKKDYLS	mito_nucl(13.166),nucl(12.5),mito(12.5),cyto_mito(8.333)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2L0	Piso0_005665 protein	Low	7.8	1	16-41	NVKGKVLKTCIRCRQHKTRCDAWDTR	mito(14),nucl(9),cyto_mito(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBB2	tRNA-5-taurinomethyluridine 2-sulfurtransferase	Low	8.3	1	6-26	RPYRRFFSRSWTNRPKRYISH	nucl(13),mito(13),mito_nucl(13)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBS0	Piso0_002126 protein	Low	5.9	1	180-200	GESYKKKKKTVSSGLNHRRVI	plas(12),nucl(3),cyto(3),cyto_nucl(3),golg(3),pero(2),E.R.(2),cyto_mito(2),mito_nucl(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCZ6	Dolichyl-phosphate-mannose--protein mannosyltransferase	Low	5.4	1	1-22	MSQSLRKRGTKKSNVSNVINQE	plas(20),E.R.(4),nucl(1),mito(1),vacu(1),mito_nucl(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YD93	Piso0_002687 protein	Low	9.4	1	23-45	LCCFQNPSSRRENRVRRSQSSLS	nucl(18.5),cyto_nucl(12.833),cyto(6),cyto_mito(4.833)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFZ3	Transketolase	Low	5	1	39-62	AHAVWKKMRFHPKDTKWINRDRFV	cyto(14),cyto_nucl(8.5),extr(7),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YK08	Stress-associated endoplasmic reticulum protein	Low	8.4	1	7-32	KQRAANAKWAKKNIKKQGKPRSKDEE	mito(13),E.R.(4),plas(3),cyto(2),golg(2),nucl(1),extr(1),pero(1)	AANAKWAKKNIKKQGKPRS (10-28, prob:0.91)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQV8	Piso0_001080 protein	Low	7.9	1	317-347	FQGAGQSLRQSKKRKDKNSQHTPLKNHSRSP	cyto_nucl(13.833),nucl(13.5),cyto(12),mito_nucl(7.666)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUR5	Piso0_000185 protein	Low	5	1	243-267	GKICFRKCFVSRRPKNSRKFIKGSQ	plas(16),mito(7),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y037	Piso0_005844 protein	Low	8	1	36-64	NLYNTKRYGSNWTRKWRNKKDVSIAHSSG	mito(15),nucl(8),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0U6	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	Low	9.5	1	299-318	MKATRKAQYYRQKKRAQDIN	nucl(16.5),mito_nucl(10.5),cyto(6),mito(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YA36	Piso0_003994 protein	Low	5	1	55-80	NEIKQLHKKAKSQYKHPRSQKLASNS	golg(8),E.R.(7),extr(6),plas(2),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YA92	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2	Low	7	1	1-21	MVKKESKKKEVSKKLSASNSS	plas(16),nucl(5.5),cyto_nucl(3.5),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCY3	Dolichyl-phosphate-mannose--protein mannosyltransferase	Low	5	1	6-28	ADYSQRRQLRSRTKLTSDKKDED	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YIB7	Piso0_003520 protein	Low	9.8	1	59-80	HGSAKKNSRLKRLPSNVLRKLS	nucl(19),cyto_nucl(14),cyto(7)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YKZ5	Aldehyde dehydrogenase	Low	6.4	1	414-433	GAQSRKKNVKVDKIRAKIRS	cyto_nucl(8.5),cyto(8),pero(8),nucl(5),mito(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YL50	Piso0_001566 protein	Low	8.2	1	415-435	VKEFKRRPNESEKKYNRRLTS	nucl(12),cyto_nucl(10),mito(9),cyto(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRU7	Piso0_000904 protein	Low	7.8	1	81-101	DYLSKDKKPYIPKLKHERLTY	mito(18),nucl(7)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1P4	1,3-beta-D-glucan-UDP glucosyltransferase	Low	8.7	1	1689-1718	PGSQLRPRVLSKKQKRVRRMKVQLYTFIFI	plas(23),nucl(2),E.R.(2)	SKKQKRVRR (1699-1707, prob:0.73)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2F3	Piso0_005606 protein	Low	9.1	2	239-259, 388-410	LWYYIKKRSFRKIRENHHFYR, TDDKITKQVVRKKRPVLPPLINT	mito(12),nucl(6.5),cyto_nucl(5.5),extr(4),cyto(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2V1	Piso0_005762 protein	Low	9.1	1	34-67	TSSLKGPVSKPKQAHKTKKSKSKNPLKGAKGENV	plas(21),nucl(3),E.R.(1),golg(1),vacu(1)	PVSKPKQAHKTKKSKSKNPLKGAK (40-63, prob:0.962)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y319	Piso0_005836 protein	Low	5	1	93-112	STQVQNTKKLPNEKNKRLVT	extr(8),plas(6),pero(4),golg(4),mito(2),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y7D9	Eukaryotic translation initiation factor 3 subunit B	Low	6.3	1	631-650	LNAADRKKVRKNLREYSAQF	cyto(18),cyto_nucl(12.5),nucl(5),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCT6	4-alpha-glucanotransferase	Low	7.1	1	65-84	NETFDRKKFQKIPLKRVFHE	cyto_nucl(10.833),cyto(10.5),nucl(9),cyto_mito(6.666),pero(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YK43	Piso0_003015 protein	Low	9.3	1	116-137	MEREQRAKRREAKERQMWNEKF	cyto(10),cyto_nucl(9.333),cyto_mito(7.499),plas(6),nucl(5.5),mito(3.5)	RAKRR (121-125, prob:0.661)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLI6	Piso0_001711 protein	Low	9.5	1	11-31	FDNNNKKKAKVETKQGNDSSK	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMP4	Piso0_001262 protein	Low	5.8	1	647-667	AKEEEKKQAIRQKQEEKNAAE	cyto(21),cyto_nucl(13),nucl(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPY0	Phospho-2-dehydro-3-deoxyheptonate aldolase	Low	9.2	1	347-366	SMLKKLSAAVQKRRELKKKD	cyto(19.5),cyto_nucl(14.833),cyto_mito(11.332),nucl(6)	KRRELKKK (358-365, prob:0.701)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUJ2	ATP-dependent 6-phosphofructokinase	Low	6.3	1	470-489	SELKKVCSRHREKGRRQTTV	cyto(16.5),cyto_nucl(12.333),cyto_mito(9.666),nucl(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0U0	Piso0_004933 protein	Low	8.6	1	429-449	EASPHPPTKKHKGASNPKTHG	nucl(14),cyto_nucl(11.5),cyto(7),mito(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y149	Piso0_005048 protein	Low	8.8	1	833-855	SSSISNGTQKKKKTIKKILGKKK	plas(17),E.R.(4),nucl(2),vacu(2)	KKKKTIKKILGKKK (842-855, prob:0.971)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2Z1	Piso0_005804 protein	Low	5.7	1	191-214	NEIRPIPSYKPKKQKKGTASVLKT	plas(21),nucl(2),mito(2),mito_nucl(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4R7	Piso0_005306 protein	Low	6	1	144-166	LYGPVYIRPKKERKRPYSLITND	extr(9),E.R.(6),nucl(3),cyto(3),cyto_nucl(3),mito(2),plas(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4S6	Piso0_005315 protein	Low	5	1	96-116	QYLEKIKSKKEDIKEEKKANE	mito(11.5),cyto_mito(7),plas(5),E.R.(5),pero(2),cyto(1.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4V1	Piso0_005341 protein	Low	9.2	1	94-114	RLRTRNGRKILARRRAKGRWY	mito(17),mito_nucl(11.833),cyto_mito(10.833),nucl(5.5)	KRKRTFGFLARLRTRNGRKILARRRAKGR (84-112, prob:0.942)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y9G3	Piso0_004680 protein	Low	5	1	698-717	GYYVKRKWFHWWSKYNYSLS	plas(26)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YF55	Piso0_002476 protein	Low	5	1	253-272	NGGIRFFKIKRNNQKVSDEE	plas(13),E.R.(5),mito(4),extr(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YG46	Piso0_002843 protein	Low	8.9	1	27-46	SASGRRRTKRWSFHDSSKPN	nucl(16.5),cyto_nucl(12.833),cyto(8),cyto_mito(5.333)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLB2	Piso0_001633 protein	Low	9.7	1	308-333	NGEISKKPSYRKTRRLHNPKFKEEED	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YN01	Piso0_001376 protein	Low	9.5	1	23-64	FVRNIRKEERQEKREEKQKKKEEKYKKKKWPDGKAKQPEQYS	cyto(12.5),cyto_nucl(10.5),nucl(5.5),E.R.(5),mito(2)	RKEERQEKREEKQKKKEEKYKKKKWPDGKAK (28-58, prob:0.994)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNV4	CCT-alpha	Low	5.9	1	479-498	SQSALPTDTKRKKYKYYGLD	cyto(22.5),cyto_nucl(14.5),nucl(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YVT0	Ribosome-releasing factor 2, mitochondrial	Low	8.9	1	341-366	EDSNRVIKMKKKKSKAHKSNQAISLD	mito(19),mito_nucl(12.333),cyto_mito(11.833),nucl(4.5)	KMKKKKSKAHK (348-358, prob:0.893)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZI7	Cysteinyl-tRNA synthetase	Low	9.3	2	691-714, 748-769	QALLEKERRKQEQNLKNQEKEKER, EEISKSMKKKLVKQFNQQEKLY	mito_nucl(12.666),nucl(12),mito(12),cyto_nucl(7.666),cyto_mito(7.666)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2K3	5-demethoxyubiquinone hydroxylase, mitochondrial	Low	8	1	24-45	LRAAQESKKKRASKKDASEVNY	mito(25.5),cyto_mito(14)	KKKRASK (31-37, prob:0.679)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y698	Piso0_004731 protein	Low	8.9	1	23-43	EESCSYCKKKNIQCTVPPLRV	nucl(16.5),cyto_nucl(12.833),cyto(8),cyto_mito(4.833)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YHP9	Ribonucloprotein	Low	9	1	28-47	AKPLAPKKLNKKVLKTVKRA	cyto(21.5),cyto_nucl(13.333),nucl(4)	KPLAPKKLNKKVLKTVKRASKAKHVKRGVKEVVKALRKGE (29-68, prob:0.99)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YKZ4	1,3-beta-D-glucan-UDP glucosyltransferase	Low	8.4	1	1667-1695	NPSKQFREPILSKREKKRRLSTIIRYMLL	plas(24),nucl(1),cyto(1),cyto_nucl(1),golg(1)	REKKR (1680-1684, prob:0.64)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPG3	Piso0_001174 protein	Low	5	1	381-402	DINNWSKWSKKDKVNTRKFIEI	extr(12),mito(6),cyto(4),vacu(3),mito_nucl(3),cyto_pero(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUU7	Piso0_000218 protein	Low	5	1	94-113	QNHKEVKKGGRRKTTCEKIG	extr(10),mito(6),plas(4),golg(4),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZC6	Piso0_005570 protein	Low	9.7	1	481-503	GISPSVLRRKRARHNPAHRISMI	nucl(19.5),cyto_nucl(12.833),cyto(5),cyto_mito(4.333)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZZ3	Piso0_005795 protein	Low	9.6	1	1217-1242	EALTRMNNTKPKKYNKKYVKTLLTGY	nucl(22),cyto_nucl(13.333),mito_nucl(12.333)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0G3	Piso0_004799 protein	Low	9.6	1	562-586	QHNEWGRQQKRARRFKFNLGRPSLL	nucl(15.5),cyto_nucl(10),mito(5),cyto(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0Y5	Piso0_004983 protein	Low	7.2	1	8-31	TSPIKTPSKTPSKTRKYVSRSAAN	plas(9),nucl(6),mito(3.5),cyto_mito(3.5),E.R.(3),cyto(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2B6	Piso0_005567 protein	Low	7.8	1	255-282	TFSSRKSSCMGCRKRKIKCEFNTELNKC	nucl(12),mito(10.5),cyto_nucl(8.833),cyto_mito(7.666),cyto(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2M9	Piso0_005685 protein	Low	8.8	1	389-411	LSRKSEPTKTEYRRRHNVASERS	nucl(12.5),cyto_nucl(8.5),mito(5),cyto(3.5),E.R.(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y6K2	Isocitrate lyase	Low	5.8	1	21-47	EVRQWWSNPRWNKTKRIYNPEDIVKKR	pero(12),cyto(11),nucl(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y6N2	Piso0_003803 protein	Low	7	2	42-67, 430-450	LAFKSTSSKVRERRRLRLSEEERPLL, SSSDSDKKTKKGKKDDSDDDE	plas(19),E.R.(4),vacu(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YAA2	Palmitoyltransferase PFA4	Low	5	1	69-98	FSPKAGEWRRWCKKCQNYKPERCHHCKTCG	plas(16),E.R.(5),mito(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCC6	Piso0_002339 protein	Low	7.2	1	623-642	IPPTPEEKRNRQMTDRRSNA	plas(17),nucl(6.5),cyto_nucl(4.5),cyto(1.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCK4	Calcium-transporting ATPase	Low	5	1	767-790	DHEVMNKPPRRRNHKILNDAVIKR	plas(20),E.R.(3),golg(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJH2	Serine/threonine-protein kinase TOR	Low	8.7	1	2142-2164	STISVISSKRRPRKLSCRGSDGK	nucl(10),plas(9),cyto(2),pero(2),golg(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPU8	Piso0_000711 protein	Low	8.7	1	77-97	DSARIRLKKKSEKYVTSHKKL	nucl(13),cyto_nucl(10.5),mito(8),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUN4	Glycosidase	Low	5	1	301-322	SSSSSSKSKSKSKSKAKSSTSL	extr(24),mito(1),golg(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUR7	Piso0_000187 protein	Low	6.9	1	127-153	FSGFKIKYVTWRHKQHREKKNSVSSPS	mito(18),nucl(5),cyto(2),extr(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZW0	Piso0_005762 protein	Low	9.2	1	34-66	TSSLKGPGSKPKQAHKTKKSKSKNPLKGAKGES	plas(22),nucl(3)	KGPGSKPKQAHKTKKSKSKNPLKGAK (38-63, prob:0.976)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2H3	Piso0_005626 protein	Low	9.3	1	575-602	IENGLTRKSSKSKQFKKKVDRDLNDTLE	nucl(17),cyto_nucl(12.5),cyto(6),mito(1),E.R.(1),golg(1),cysk(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YB43	Piso0_004293 protein	Low	5.6	1	309-329	IVNREVEKKRKELRNKHGFFY	mito(15.5),cyto_mito(10),cyto(3.5),pero(3),nucl(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEY4	Piso0_002399 protein	Low	8	1	13-42	THTNASRTPSPLRRRKPWKKLLYLKQAYPD	plas(24),pero(1),E.R.(1),vacu(1)	RRRKPWK (25-31, prob:0.723)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFH7	2-(3-amino-3-carboxypropyl)histidine synthase subunit 2	Low	9.1	1	488-509	TGTFSSKSRPLRRLKHLQISQE	nucl(17),cyto_nucl(15),cyto(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YKF3	Piso0_003130 protein	Low	5.4	1	623-642	YYKLNDKTPRQKFNRVTNLL	plas(19),E.R.(3),golg(2),nucl(1),mito(1),pero(1),mito_nucl(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YKJ8	Piso0_003176 protein	Low	6.6	1	164-187	MEEYKRFNKVYPKKPNRRMINDLP	plas(21),nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YL88	General transcription and DNA repair factor IIH helicase subunit XPD	Low	9.3	1	688-708	VLADRRFSRKKSQLPKWIAQA	nucl(16.5),cyto_nucl(13),cyto(8.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRD2	Phosphoinositide phospholipase C	Low	9.8	1	146-165	LKVSHKSKKRALFKIDPMYF	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XYZ2	Piso0_005419 protein	Low	5.7	1	812-831	LFHLLRRQMHRQFRKPLILF	mito(21),cyto(3),nucl(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZC4	Mediator of RNA polymerase II transcription subunit 14	Low	8.8	1	1003-1025	NLSFRTNKFYKEKKLYVKLSLKE	nucl(14),cyto_nucl(10),mito(9),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y413	Piso0_005027 protein	Low	5	1	13-35	MGSPKNTRRVRGMRGNQEQQRLI	plas(23),mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y496	Derlin	Low	5	1	271-294	EDSNQERKNARRRNEERVKQHEKI	plas(16),E.R.(4),pero(3),golg(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y5X7	Piso0_004607 protein	Low	8	1	202-222	GKISRRRKMKIRRRIKFIRGI	mito(10),plas(10),golg(4),cyto(1),E.R.(1),vacu(1)	GKISRRRKMKIRRRIK (202-217, prob:0.972)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBT1	Piso0_002137 protein	Low	8.5	1	21-44	LNKVEFNKKGRKYKLVNDNFQRVR	cyto_nucl(14.5),nucl(14),cyto(11)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCC0	Non-specific serine/threonine protein kinase	Low	7.7	1	1173-1194	LKLYKVKITRGKNKQVSKLSKL	nucl(9.5),cyto_nucl(8),cyto(5.5),mito(5),pero(2),cysk(1),golg(1),E.R.(1),extr(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCF1	GlcNAc-PI synthesis protein	Low	8.8	1	419-444	PADNIDKATKWPKKEKKRIIDTHASN	plas(14),mito(5),pero(3),cyto_nucl(2.5),nucl(2)	PKKEKK (430-435, prob:0.681)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YL69	Piso0_001585 protein	Low	5	1	12-33	VTSASLKKKVHSSKQGAKATKY	mito(19.5),cyto_mito(12.5),cyto(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRM8	Piso0_000832 protein	Low	7.7	1	2-24	LPSSSFSKPLRKRPSRTPTSREI	mito_nucl(12.166),nucl(11.5),mito(11.5),cyto_nucl(7.833)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTZ9	Piso0_000437 protein	Low	8.3	1	639-659	SKEYQKSSTNSQKKRNRDGLT	nucl(14),cyto_nucl(12.333),cyto(8.5),cyto_mito(5.666),mito(1.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUA3	Piso0_000549 protein	Low	6.5	1	140-164	IEVLHKPKKYLSRRKQFYIRNSKHD	mito(22),nucl(4.5),cyto_nucl(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUP4	Piso0_000162 protein	Low	6.6	1	79-103	RCTTYTGLRLQRKKKKMLSNDGYNV	mito(9),cyto(8),nucl(4),plas(2),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJF9	Piso0_003571 protein	Low	7.2	1	31-53	YIFYARYITKKPNKYNKLEEPVN	cyto_nucl(8.5),cyto(8),nucl(7),E.R.(4),extr(3),mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNQ4	DNA-directed RNA polymerase subunit	Low	9.7	2	133-166, 399-418	DNLKRMKILKRILEQCKKQRRCVKCNHINGVVKK, TYPEMCTRYNRKKLQRLILN	cyto_nucl(11),nucl(10),cyto(10),mito(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQB2	Piso0_000879 protein	Low	8.1	1	154-179	YSSDVFKKKAKQIRKNMWWKKTKFYF	nucl(9),E.R.(5),cyto(4.5),cyto_mito(4.5),mito(3.5),pero(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YT39	ATP-dependent 6-phosphofructokinase	Low	6.2	1	470-489	SELKKVCSRHREKGRRQTTV	cyto(17),cyto_nucl(12.833),cyto_mito(10.499),nucl(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTG7	GPI ethanolamine phosphate transferase 3	Low	7	2	18-38, 316-340	FLQRQQQSRSRIKQQKFWFTS, SLFMYSKQKRFKFHKKHKSHYDTSD	plas(23),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZ05	Mitogen-activated protein kinase	Low	9.9	1	276-296	DRVFNRHPNRLKRHGGRPINP	nucl(17),cyto_nucl(10.5),mito(7)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y802	Mitochondrial homologous recombination protein 1	Low	7.6	1	74-98	DAQFPRPNWQNRKPSRRNDLWRIMC	mito(13),nucl(7),cyto(4),extr(1),pero(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBU5	Piso0_002152 protein	Low	9.1	1	320-343	GNPHPPRQNQYQQKHGNKNRKMTG	nucl(15.5),cyto_nucl(12),cyto(7.5),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJ76	6-phosphogluconolactonase-like protein	Low	8	1	62-87	TSINGNGKIKKEKKKKAEARFKIALS	cyto(24.5),cyto_nucl(14)	GKIKKEKKKKAEARF (68-82, prob:0.962)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJD8	Piso0_003549 protein	Low	7.8	1	109-128	LDERRIDRPRTSRRNNSDSI	nucl(12.5),cyto_nucl(11.333),cyto_mito(7.499),cyto(7),mito(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YKR5	Piso0_001425 protein	Low	5.3	1	561-585	SSRTWNWLKFWKKKPHPSTRKAFVV	plas(23),nucl(1),cyto(1),cyto_nucl(1),pero(1),golg(1),cyto_pero(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YL82	Piso0_001601 protein	Low	6.6	1	366-388	DGFTRFTRSRKWMRKAVLTIHKQ	plas(15),nucl(4),mito(2),pero(2),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YM62	Piso0_001965 protein	Low	8.6	1	617-645	DLEDKKDSKTTKKPNQKHSKTNSNESNKA	nucl(15),cyto_nucl(10.833),cyto_mito(5.666),mito(5.5),cyto(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YR46	Piso0_000646 protein	Low	9	1	109-130	PSMTWSSKTEQYRKKRLPMEYE	nucl(14),cyto_nucl(10),mito(7),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRP4	Piso0_000848 protein	Low	5	1	27-51	LYLSAKEKASQKKTRKIEGSKEYSE	mito(7),plas(6),cyto_mito(6),cyto(5),E.R.(4),mito_nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZA2	Piso0_005537 protein	Low	5	1	749-769	PGYERKPKTSLREKLNRSLKG	extr(13),E.R.(7),golg(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZU5	tRNA (guanine(26)-N(2))-dimethyltransferase	Low	8.1	1	69-88	NGEVKTKKRKVDSHENKETE	mito(11.5),nucl(11),cyto_mito(8.5),cyto(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y5G7	Piso0_004437 protein	Low	8	1	322-342	DNSKKEPEKDQQKKKGGKKLV	E.R.(11),cyto(6),golg(5),extr(4)	PEKDQQKKKGGKK (328-340, prob:0.807)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y611	GPI-anchored wall transfer protein	Low	8	1	333-358	YISRVSSKRAPQKTPKKKSRTISTTT	plas(16),mito(7),E.R.(2)	RAPQKTPKKK (341-350, prob:0.724)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y6X3	Piso0_003897 protein	Low	5	1	63-86	QEHVRHPHKGHREEKRNLYQSRRV	plas(16),pero(3),mito(2),cyto(2),E.R.(2),golg(2),cyto_mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YC04	Piso0_002212 protein	Low	6.7	1	74-100	EDLKKNDFMKWRKKQINKANTAKIKNN	mito(16),cyto_nucl(6),nucl(5.5),cyto(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFB6	Piso0_002543 protein	Low	9.6	1	192-220	GLTVPKKALKIKKKNKKPVSRKFNSTKYV	mito(13),cyto_nucl(6.5),cyto(6),nucl(5)	PKKALKIKKKNKKPVSRK (196-213, prob:0.976)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNI0	Piso0_001566 protein	Low	8.8	1	413-433	VKEFKRRPNESEKKYNRRLTS	nucl(14),cyto_nucl(10),mito(9),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNM5	Histidine--tRNA ligase	Low	8	1	28-59	GADVKEKPTKGNKNDSKKSKKQDQFLLKTPKG	mito(16.5),cyto_mito(12.333),cyto(7),cyto_nucl(4.833)	KGNKNDSKKSK (37-47, prob:0.644)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPX9	Piso0_000743 protein	Low	8.9	1	200-219	MPPLSVKKERRNPFNRYHGY	nucl(15.5),cyto_nucl(13),cyto(7.5),mito(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQ74	Piso0_000839 protein	Low	5	1	49-74	KNPHSTDKEKRLWKRVQKQAWVHDKC	plas(22),E.R.(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRP2	Piso0_000846 protein	Low	7.8	1	412-435	STEDSFSKYTRRRRWIRTAELVFN	plas(16),nucl(7),cyto(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YSP9	Piso0_000557 protein	Low	5	1	446-469	HLRIDKDFNRRLRREKKEQLSLES	plas(14),mito(10),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YU45	Piso0_000487 protein	Low	9.9	1	200-225	TDKASGKQKALPRKRKVRKAKKCTIL	cyto_nucl(11.833),cyto(10.5),cyto_mito(9.332),nucl(9),mito(6.5)	SGKQKALPRKRKVRKAKK (204-221, prob:0.981)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y567	Signal recognition particle 54 kDa protein	Low	7.6	1	89-110	HEEPPKPKKLSHRQQTTRGAKG	cyto(12),cyto_nucl(12),nucl(10),mito(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YD34	Piso0_002617 protein	Low	5	1	18-40	IAPQKMKNTGKRESSKKNHDGST	plas(14),E.R.(5),mito(3),pero(2),golg(2),mito_nucl(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDH8	Lysophospholipase	Low	5	1	603-622	QKQPDDCKKCFKKYCWVGNE	extr(26)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDK7	Piso0_002812 protein	Low	9.9	1	60-82	ETEFSLVRRRKKLNPILRRILTE	nucl(18.5),mito_nucl(10.833),cyto(4.5),cyto_mito(3.833)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YE50	Piso0_002105 protein	Low	6.4	1	187-206	FKLSSRWPAKQQKHNSEPVY	golg(7),E.R.(6),extr(5),nucl(4),cyto(2),vacu(2),mito_nucl(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YG38	Piso0_002835 protein	Low	6.6	1	847-866	QSTKDTARWAREQQKRQLML	mito(6),cyto_nucl(6),nucl(5),cyto(5),E.R.(4),plas(3),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YK09	Piso0_002981 protein	Low	9.8	1	20-43	YSILTFTRHSKPKRGHKLGSASAT	nucl(12),mito(10),cyto(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLD9	DNA topoisomerase	Low	8.1	1	19-43	ILSGGKTKVRNSRNKYVKNYDFKFD	mito(14),nucl(8),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YV14	Piso0_000288 protein	Low	5	1	151-179	QDSSPQQPTKSKRQTKLESRKNKVKTSRY	plas(15),mito(5),E.R.(4),cyto(1),pero(1),vacu(1),cyto_pero(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZK8	Piso0_005656 protein	Low	5	1	321-341	QMENIKKFKKRQKMIQKQVKS	plas(19),E.R.(4),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y173	Piso0_005073 protein	Low	9.7	1	92-119	ATENKNTENSKKRKHKNSSLAEKKRMKM	E.R.(7),golg(7),nucl(5),mito(2),cyto(2),pero(2),cyto_mito(2),cyto_pero(2)	KKRKHKNSSLAEKKR (102-116, prob:0.843)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1K9	Piso0_005218 protein	Low	6.8	1	337-358	SKFKAKEDNSHNFRRRNNRTKN	plas(17),nucl(5),cyto_nucl(4),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3A1	Piso0_004747 protein	Low	8.5	1	106-131	SEHQWFKDSKKSKSNPRRNWYHWAGP	nucl(15.5),cyto_nucl(12.333),mito_nucl(9.666),cyto(7)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCQ3	Piso0_002476 protein	Low	5	1	253-272	NGGIRFFKIKRNNQKVSDEE	plas(12),E.R.(6),extr(5),mito(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDK4	Piso0_002809 protein	Low	5	1	124-146	FGLFLRYKRSRMKSNHVKNCASC	plas(17),cyto(3),mito(2),cyto_nucl(2),golg(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YHZ5	Piso0_003395 protein	Low	5	1	740-763	VMKFHKTPGSIRRRRRHEEYEFDI	extr(18),plas(4),E.R.(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLM3	AMP deaminase	Low	9.7	1	169-191	IYPPPPKPTYKSKNKFNQVVRND	nucl(17.5),cyto_nucl(12),cyto(5.5),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YR74	Piso0_000674 protein	Low	5	1	553-584	EKFFRVNPIQTNRKRYWRKRINEYYKVHNYEG	extr(16),E.R.(4),golg(4),plas(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRN6	Piso0_000840 protein	Low	5	1	358-377	YEERQRRKGWKAQHEAQLKD	cyto(14),cyto_pero(9.833),cyto_nucl(8.833),cysk(5),pero(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUK8	Mannosyltransferase	Low	8	1	1-43	MSENRSHRKRIVAKTRKGGSAAGSSKRGSKERYSKKGSYKSLS	plas(21),E.R.(5)	SHRKRIVAKTRKGGSAAGSSKRGSKERYSKK (6-36, prob:0.949)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y716	DNA-directed RNA polymerase	Low	9.3	1	533-552	KTTNQWKRFLRQRKDYNKED	nucl(14),mito(8.5),cyto_mito(6.5),cyto(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y9I5	Piso0_004702 protein	Low	6.5	1	126-150	EPYYEVYRTKPRCRRVKTFGVQPYQ	mito(22),nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2K1	Piso0_005656 protein	Low	7	2	321-341, 626-645	QMENIKKFKKRQKMIQKQVKS, GNSSRSSKSSQTRRSSRSSS	plas(20),E.R.(3),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YB21	Dolichyl-phosphate-mannose--protein mannosyltransferase	Low	5	1	6-26	PVQKGRLPPGRKVKNGKVYTE	plas(22),E.R.(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDI7	Piso0_002792 protein	Low	8.5	1	511-535	ASTRFNKKIDPQQARNQRRRSSTST	nucl(13),cyto_nucl(12),cyto(9),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDQ2	Piso0_002859 protein	Low	9.6	1	643-662	IDSMHKNKKSFKLLAKKIDD	nucl(14),mito(5.5),cyto_mito(4.5),cyto(2.5),plas(2),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFM8	Piso0_002665 protein	Low	7.2	1	83-105	VEQCRNKKSSPRRYDTKKHVYVD	mito(18),nucl(6),cyto(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFN5	Piso0_002673 protein	Low	8.9	1	163-182	FQNARPRRQQRQQQQRQQED	nucl(13.5),cyto_nucl(9),cyto(3.5),mito(3),plas(2),pero(2),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLX7	Piso0_001859 protein	Low	8.1	1	145-166	FGGYWKWWYKRRKENIKMIMSG	mito(13.5),nucl(10),cyto_mito(8.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNY7	Karyogamy protein 5	Low	7.2	1	497-519	LFYGLLRRKKNRLHEQVAKSKTI	plas(7),nucl(6.5),E.R.(6),cyto_nucl(5),pero(3),cyto(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQ82	Uricase	Low	6.6	1	12-31	KANVKFLKVKKNPENPQEQE	cyto(16),pero(5),nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1U0	Piso0_005306 protein	Low	8	1	144-168	LYGPVYIRPKKERKRPYRLVTNDSV	mito(8),extr(6),cyto_mito(6),mito_nucl(6)	KKERKR (153-158, prob:0.661)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3J9	Cystathionine beta-synthase	Low	5.7	1	20-39	VKLNKIPKKHGIKAKVYAKV	cyto(22.5),cyto_nucl(13),nucl(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y5Y3	Piso0_004613 protein	Low	7.8	1	40-60	EKKARHEQDMRAKRRRWTRFV	plas(10),nucl(8),mito(2),cyto(2),cyto_mito(2),golg(1),E.R.(1),pero(1),extr(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCT9	Piso0_002516 protein	Low	9.9	1	79-100	ASFSTTNRKKRSKNEKRTIELN	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJR8	Piso0_002889 protein	Low	6.2	1	386-410	IKDKWKWSYETKHKNPSWRIEKKLF	cyto(7.5),cyto_nucl(6),extr(5),E.R.(5),nucl(3.5),golg(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1G9	Mediator complex subunit 12	Low	8.4	1	399-418	QTYPLSPKTQKPRAPRKFVM	nucl(12.5),cyto_nucl(10.5),cyto(7.5),plas(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBJ3	Piso0_002044 protein	Low	8.4	1	108-130	HQWFKDSRKSKSNPRRNWYHWAP	nucl(15),cyto_nucl(11.833),mito_nucl(9.333),cyto(7.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCW9	Piso0_002547 protein	Low	7.4	1	690-709	KDPNDSRKVLRHTRAYYKKL	cyto(13),cyto_nucl(12),nucl(9),mito(2),cysk(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDV0	Piso0_001247 protein	Low	7.2	1	726-747	GFVYRKLGIHRNHKRREEMSRI	mito(14.5),mito_nucl(12.999),nucl(10),cyto_nucl(7.833)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJI4	Piso0_003596 protein	Low	5	1	13-39	SGSAIRSSKRSHFPFRKKEEARKDEVI	plas(26)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNE2	Alkyl transferase	Low	8.2	1	280-302	EEAYHTTSRKKEKKVPSPEIYAN	nucl(11.5),cyto_nucl(11),cyto(7.5),mito(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZJ1	Chitin synthase	Low	7	2	20-39, 1125-1144	ELSRKKSLVRPERTRIDPNH, IVMKRWREFERDRKNQQGLP	plas(24),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0A4	Piso0_005913 protein	Low	5	1	17-36	REKFDPKTGIKRGLKQRHIS	plas(19),mito(5),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3A4	Piso0_004753 protein	Low	5	1	28-48	NLENESKLRRRLERRHVEMLA	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y441	Piso0_005055 protein	Low	9.6	1	463-483	NMMKKRSQLNLQKQQRDRVSK	nucl(19),cyto_nucl(15),cyto(7)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y968	Piso0_004579 protein	Low	5.6	1	97-118	IEKYKPKSDSIKDKYKNDKAPE	mito(11.5),cyto_mito(7),golg(5),plas(4),E.R.(3),nucl(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YF06	Calcium-transporting ATPase	Low	5	1	767-790	DHEVMNKPPRKRNHKILNDAVIKR	plas(20),golg(3),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YT84	Ribonuclease P	Low	8.8	1	3-27	TDIKTNKQRIKGKHIKHNPNTEQLS	nucl(13.5),cyto_nucl(11),cyto(7.5),mito(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZE3	Small nuclear ribonucleoprotein Sm D3	Low	9.4	1	87-106	KPGDKPKPPVRGPPPKRMKH	cyto(19.5),cyto_nucl(14),nucl(5.5)	GDKPKPPVRGPPPKRMKH (89-106, prob:0.932)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1U9	Piso0_005315 protein	Low	5	1	96-118	QYLEKIKSKKEDIKEEKKAHEKV	mito(11.5),cyto_mito(7),plas(6),E.R.(4),pero(2),cyto(1.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y434	Piso0_005048 protein	Low	8.3	1	831-855	KESSSTSNGTQKRKKTIKKILGKKK	plas(17),E.R.(4),vacu(2),cyto_mito(1),golg(1),cyto_nucl(1),cyto(1),mito(1),nucl(1),mito_nucl(1)	KRKKTIKKILGKKK (842-855, prob:0.965)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y820	Piso0_004305 protein	Low	8.7	1	65-84	DGCVRGPHGRERQRRRRGGQ	mito(11),plas(6),extr(3),nucl(2),cyto(2),cyto_nucl(2),E.R.(2)	RERQRRRR (74-81, prob:0.73)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y860	Piso0_004346 protein	Low	9.2	1	7-30	YDSNVSNSKKKYKQLEKLLETYKE	nucl(15.5),cyto_nucl(11.5),mito(5),cyto(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEU8	Piso0_002362 protein	Low	5	1	63-82	LENKKKIKALEKRQNSARIF	mito(8),E.R.(7),cyto(3),plas(3),golg(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNR8	DNA topoisomerase	Low	8.1	1	19-43	ILSGGKTKVRNSRNKYVKNYDFKFD	mito(14),nucl(8),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRK5	Piso0_000809 protein	Low	9.6	1	78-97	REKLIFKKKVINRNKIHHIA	nucl(13),plas(4),mito(3.5),golg(3),cyto_mito(3),cyto(1.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTB1	Piso0_000185 protein	Low	6.2	1	243-267	GKICFRKCFVSRRPKNSRKFIKGSQ	plas(10),mito(5),nucl(3),E.R.(3),cyto(2),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YVV1	Citrate synthase	Low	5	1	23-42	VKYFSTARRVRKDLKSTLKE	mito(21),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	C7U028	Truncated non-functional cytochrome oxidase 1	Low	5	1	605-624	MSYKKWKEMYMKIKNKEHLT	plas(15),mito(6),E.R.(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1Q1	Piso0_005264 protein	Low	8.2	1	38-59	IWDYKKDCYKKNSKNLEKYNAG	nucl(11),cyto_nucl(9.5),mito(8),cyto(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3X6	Piso0_004990 protein	Low	8.7	1	44-63	EYAPRFKKLRKAFKGRVSVS	mito(21.5),cyto_mito(11.833),nucl(2.5),cyto_nucl(2.333)	RFKKLRKAFK (48-57, prob:0.711)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDS3	Piso0_001219 protein	Low	9.9	1	10-50	GINGKALSSKKRNRVPTSCNLCRQRKIKCDRKLPCSNCIHS	nucl(19.5),cyto_nucl(11.833),cyto_mito(3.333),cyto(3),mito(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEN2	Piso0_002293 protein	Low	7.1	1	787-806	QRSIRKLGFKTKKDPPRSVV	plas(17),nucl(6.5),cyto_nucl(5),cyto(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YGC9	Piso0_003598 protein	Low	8.3	1	498-519	NRNNDTKKIHRTQKYPAQRTNF	nucl(13),cyto_nucl(12),cyto(9),pero(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YIX6	60S ribosomal protein L20	Low	7	1	145-171	TKGLKFPLPHRVQKTKKTFQSKVPSTF	mito_nucl(10.999),cyto_nucl(10.166),mito(10),nucl(9.5),cyto(7.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQZ9	Piso0_001121 protein	Low	9.2	1	430-449	NQEKRFKEWKKALVDKQNTF	nucl(16),cyto_nucl(13.5),cyto(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4Y2	Piso0_005377 protein	Low	9.9	1	176-198	EAATRASLKTKEKKEKKKKCVVL	cyto_nucl(11.666),nucl(10.5),cyto(10.5),mito_nucl(8.499),cyto_mito(8.499),mito(5)	KTKEKKEKKKK (184-194, prob:0.875)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y5K4	Thymidylate synthase	Low	8.7	1	269-289	TRTPRTFPKLRIKEDRKSEIK	nucl(11),cyto(7),pero(6),mito_nucl(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y853	Serine/threonine-protein phosphatase	Low	9.2	1	543-562	ALKQVMKKGRIERKNAQIQH	nucl(16),cyto_nucl(13.5),cyto(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDI4	Transketolase	Low	5	1	40-62	HAVWKRMRFHPKDTKWINRDRFV	cyto(12.5),cyto_nucl(8.5),mito(6),extr(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YG07	Piso0_002803 protein	Low	6.9	1	39-63	ANHAVKNGPRKQQSRKDLQKHVITP	mito(18),nucl(5),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YHR0	DNA-directed RNA polymerase	Low	7.1	1	1145-1164	RAGLIRGKRHQNKTDYNEIL	mito(15.5),mito_nucl(13.166),nucl(9.5),cyto_nucl(6.833)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0A9	Piso0_004741 protein	Low	7.1	1	19-40	LVKKVVKSGKPERTKNLRSSYE	cyto(13.5),cyto_nucl(11),nucl(7.5),pero(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1N5	Piso0_005247 protein	Low	7.2	1	424-446	QYEYSTTTKKRRSSQSDSARDLS	mito(10),nucl(7.5),cyto_nucl(7),cyto(5.5),extr(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y6V6	Piso0_003880 protein	Low	8.7	1	8-28	SKSKSIFGKEKKVTIRRKAEE	nucl(15),cyto_nucl(11.333),cyto(5.5),cyto_mito(5.166),mito(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y8Z2	Piso0_004503 protein	Low	5	1	368-392	PFVPLRWQIKRIRKKVKIFEARLAD	plas(23),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBK2	Piso0_002054 protein	Low	5	1	94-115	RLDYNKSKMRSRRGLRRQDSES	plas(16),mito(6),E.R.(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YC86	Piso0_002297 protein	Low	7	1	734-756	CYIEKNIKKKLAKEQNKKGWYPS	mito(20),nucl(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQQ1	Piso0_001023 protein	Low	7.7	1	14-33	VLPRVRPVFKRYPIRHKTAE	mito(15),nucl(9),cyto_mito(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YR62	Piso0_000662 protein	Low	5	1	105-125	QSLGRRKTSARRTPSRCSGEY	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y145	Piso0_005044 protein	Low	8.4	1	397-419	IYLHSWKYTMKKKNADKPICFEA	nucl(12.5),mito_nucl(11.5),mito(9.5),cyto(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1M3	Piso0_005235 protein	Low	9.4	2	6-29, 119-141	LSKTRPHFPLRRASRKKLFRYFVL, GKYLKYLTKRYLKKNQIRDWIRF	mito(19),nucl(7.5),cyto_nucl(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y430	Piso0_005044 protein	Low	8.8	1	397-419	IYLHSWKYTMKKKNADKPICFEA	nucl(13.5),mito_nucl(11),mito(7.5),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y952	Ribosomal protein	Low	9.5	1	89-110	DLKKLNKNKKLIKKLAKKYNAF	cyto(10),cyto_mito(9.333),cyto_nucl(8.833),mito(7.5),nucl(6.5)	LNKNKKLIKKLAK (93-105, prob:0.759)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YD36	Piso0_002619 protein	Low	8.5	2	2-26, 30-49	IECRGITSKNTKCRRKVLEHQTYCY, HQGAQEKKPTQNKRNGGKAG	mito(15.5),mito_nucl(11),nucl(5.5),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNJ9	Piso0_001585 protein	Low	6.4	1	12-32	VTSTSLKKKVQSSKQGAKATK	mito(19.5),cyto_mito(11.333),nucl(5.5),cyto_nucl(4.333)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YP16	Piso0_001766 protein	Low	9.8	1	746-770	PDSTKLRSRYLKKKNSENLRQLKQF	nucl(19.5),cyto_nucl(14),cyto(7.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPN6	Piso0_000646 protein	Low	7.5	1	32-52	SENSKNSKTTHNENKIQKNST	mito(14),nucl(8),cyto_nucl(6.5),cyto(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTC3	Phosphodiesterase	Low	9.6	1	1-21	MTEVLRLRYRRSERKQTEISG	nucl(16),cyto_nucl(10.5),pero(5),cyto(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y7V7	Piso0_004241 protein	Low	5	1	30-51	NQCVKNCDSKSEKKHKLFDQPS	plas(18),E.R.(5),golg(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YIK6	Piso0_003252 protein	Low	9.3	1	137-156	LLRWLKDRKRIHNTNPKLFD	nucl(16.5),cyto_nucl(11),cyto(4.5),mito(2),pero(1),E.R.(1),golg(1),cysk(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YL06	Piso0_001519 protein	Low	8.7	1	107-128	LSEILRCRWKSRRSLNDFKYEV	nucl(10),plas(5),E.R.(5),cyto(3),mito(2),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRM0	Piso0_000824 protein	Low	5	1	15-35	APIVAGKKAPKIKKNPSNVVA	extr(20),E.R.(3),golg(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRP8	Ubiquitin carboxyl-terminal hydrolase	Low	9.4	1	302-321	RFYWRRDTQKKSKILRRVQF	nucl(17),cyto_nucl(13.5),cyto(8)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUL8	[RNA-polymerase]-subunit kinase	Low	9.2	1	311-334	SDLPQMPSKKKLEKTEPPQKKVKV	nucl(21),mito_nucl(12.833),cyto_nucl(12.333),mito(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZL5	Piso0_005663 protein	Low	5	1	470-497	IESPTVTRFFRRRRWVRRCCRHSTVDTD	plas(20),E.R.(3),cyto(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y330	Piso0_005847 protein	Low	8.7	1	45-65	RLEEKTKRPLKHFKNRALQSD	nucl(12.5),cyto_nucl(10),cyto(4.5),pero(4),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y379	Piso0_005899 protein	Low	8.7	1	489-518	EDKPSKDTAKSKNKEKKEKKNKEVKTDEDK	plas(17),E.R.(3),golg(3),nucl(2),vacu(2)	TAKSKNKEKKEKKNKE (496-511, prob:0.947)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4X6	Piso0_005371 protein	Low	5	1	310-338	TISRYWNHAKMRNMRRRSRKDSNLPVEVH	plas(19),E.R.(4),mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y955	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase	Low	6.5	1	48-70	AIYLKVGKKRSSYRRRLVLASKK	extr(7),E.R.(6),nucl(4),mito(3),cyto_nucl(3),cyto(2),plas(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCF9	Vacuolar fusion protein MON1	Low	8.6	1	661-680	SLNIIRWCQKYKKRLFIGDG	nucl(14.5),cyto_nucl(12.833),cyto(8),cyto_mito(4.999)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFD6	Dolichyl-phosphate-mannose--protein mannosyltransferase	Low	5	1	6-28	ADYSQRRQLRSRTKLTSDKKDED	plas(26)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YHN0	Piso0_003269 protein	Low	5	1	23-50	KRNYCPTPSWKARCNGRKIQHRCFHSSR	mito(16.5),cyto_mito(11),extr(6),cyto(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YL14	Piso0_001527 protein	Low	6	1	27-53	VSCVPYDTKKSKSKNKGSSTNDKNKYA	mito(18),cyto(5),cyto_nucl(5),nucl(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLU4	Trimethylguanosine synthase	Low	9.5	1	25-49	MHNYYTLPKKCKKYWDKRYSLFSKF	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMF2	Piso0_001315 protein	Low	8.4	1	363-383	CMNLIESKKRKEKSQYAKFFG	nucl(12.5),cyto_nucl(11.5),cyto(9.5),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMK8	Piso0_001217 protein	Low	5	1	503-528	FGVRYSSKLRRERKLEEKSSVKKNAR	plas(26)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YT14	Atypical serine/threonine protein kinase BUD32	Low	7.8	1	44-71	ESSYIIKYRPRKPYRHPKIDKSITKSRT	nucl(13.5),mito_nucl(11.666),cyto_nucl(9.833),mito(8.5),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0Y6	Piso0_004984 protein	Low	6.1	1	1145-1166	VSNTNNKKNTHKLSEKIHKFNL	E.R.(8),extr(5),cyto_nucl(4),nucl(3.5),cyto(3.5),golg(3),plas(2),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1H8	Piso0_005184 protein	Low	5	1	504-525	ALFFCCCYRKKRNEEKSEPDLE	extr(11),E.R.(5),golg(5),vacu(3),cyto(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y314	Piso0_005831 protein	Low	8.8	1	171-193	IGFSKVVKKWDKRSKSHTKELFI	nucl(14.5),cyto_nucl(13),cyto(10.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y6N9	Elongation of fatty acids protein	Low	8	1	60-79	LSNKIVRQRQLRKAAQEKKV	plas(16),E.R.(7),golg(3)	LRKAAQEKKVDSKSKLGKKEMKR (70-92, prob:0.842)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y930	Piso0_004541 protein	Low	9.3	1	51-81	SKMPSKPLELKTKPRKPSKKSAFKSDNKIES	mito(21.5),mito_nucl(14),nucl(5.5)	SKPLELKTKPRKPSKKSA (55-72, prob:0.911)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCZ4	Piso0_002575 protein	Low	8.3	1	119-142	RWSCKDLQQKTPKRENKNDFKFCC	nucl(12),mito(12),mito_nucl(12)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YIW3	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial	Low	6.6	1	124-149	GWDHYVQEPKKKHFRKKEYAMNFYHS	mito(16),mito_nucl(12.333),nucl(6.5),cyto_nucl(6.166)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQW6	Piso0_001088 protein	Low	6.8	1	16-42	IKAFSVRSSRRYRKRLVVKTKAFWRNP	mito(17),nucl(6),cyto_nucl(6),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YVM8	Diphosphomevalonate decarboxylase	Low	5	1	13-35	NIATLKYWGKRDKKLNLPTNSSI	extr(12),mito(4),cyto(4),cyto_mito(4),golg(3),mito_nucl(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y046	Piso0_005853 protein	Low	5	1	418-438	RDEAKCKQKYGKEWEQYQKMV	plas(21),E.R.(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y2N0	Piso0_005686 protein	Low	5	1	34-59	YPNSKGENTKYKKVKRKVPEGLSKND	plas(13),mito(5),E.R.(5),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3X0	Piso0_004984 protein	Low	9.1	2	74-93, 1159-1183	ESLKRLIMKNTKKLHKPVIH, HVNNTNNKKKTHKLSEKIHKFNLNP	nucl(6),extr(5),E.R.(5),cyto(3),pero(3),golg(3),cyto_pero(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y6G1	Dolichol kinase	Low	5	1	1-24	MPPSKKRSERRSKQTKQTGSSRST	plas(26)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YB13	Piso0_004262 protein	Low	8.2	1	2-27	AENRGSKIDNDRKGRKKSSEKCICTQ	nucl(10.5),cyto_nucl(8.5),mito(8),cyto(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDR4	Piso0_002871 protein	Low	9.9	1	206-225	LEEKKNKIKKQKHEFDKARE	nucl(20),cyto_nucl(15),cyto(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFE7	Piso0_002575 protein	Low	8.2	1	119-142	RWSCKDLQQKTPKRGNKNDFKFCC	mito(11),nucl(8),cyto(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YI42	Piso0_003443 protein	Low	9.3	1	34-55	MLPPGSRRCKIRPPRRFLGSGN	nucl(17.5),cyto_nucl(12.333),cyto(6),cyto_mito(4.833)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJV1	Piso0_002922 protein	Low	8	1	289-320	AKFFKNVRLGKKPSSKKPSSKKINKKPQHDEL	extr(11),E.R.(9),golg(5)	SRKEAKFFKNVRLGKKPSSKKPSSKKINKKP (285-315, prob:0.986)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPV4	Piso0_000717 protein	Low	8	1	26-46	IFLFVYFRKRQRRVYEPRVVV	plas(15),E.R.(7),mito(2),vacu(2)	KKRP (274-277, prob:0.638)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YR60	Piso0_000660 protein	Low	6.6	1	145-169	EDQPEQHQKGKSKKNKNKSSYLTSA	extr(6),mito(5),nucl(4),pero(4),golg(3),cyto_pero(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y082	Piso0_005890 protein	Low	8	1	304-326	GPSSEKRTHVLKKNPLRNKQVLL	mito(18.5),cyto_mito(11.5),cyto(3.5),pero(3)	KVIKSKKLRAGKGKLRGRRFTQR (181-203, prob:0.981)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3W5	Piso0_004974 protein	Low	9.6	1	89-108	VALLRCLWRITQKKKRPRAW	mito(12),cyto(7),nucl(4),pero(2)	KKKRPR (101-106, prob:0.699)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y6M7	Piso0_003798 protein	Low	8	1	167-190	RDSTKRLQKIYKERKKIVSNFNSL	nucl(14),cyto_nucl(13.833),cyto(10.5),mito_nucl(8.999)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y789	Piso0_004013 protein	Low	8.4	1	177-200	VVPFTRIFRFRKHRKVPEAKPGIG	mito(15),plas(6),E.R.(2),nucl(1),cyto(1),extr(1),cyto_nucl(1),vacu(1)	FRKHRKVPEAKPGIGSSTEKEEIKKLKKPRL (186-216, prob:0.91)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y9F3	DNA helicase	Low	9.7	1	861-883	EEYYKERKLCFKVLKRLVKDRIL	nucl(17.5),cyto_nucl(13.5),cyto(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YAP4	Fe-S cluster assembly protein DRE2	Low	7.5	1	214-238	IVPKKCELPNGKRRRRACKDCTCGL	cyto(16),cyto_nucl(14),nucl(10)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDM9	Piso0_002835 protein	Low	6.9	1	847-866	QSTKDTARWAREQQKRQLML	mito(7),nucl(6),cyto_nucl(6),cyto(4),E.R.(4),plas(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YG24	Piso0_002820 protein	Low	6.8	1	37-59	AYNTNRIKKRLGCEQPKRYLKSS	mito(8),pero(7),nucl(5.5),cyto_nucl(5.5),cyto(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLN2	Piso0_001760 protein	Low	8.2	2	313-333, 358-382	QSYTKDHKKIRLMEKKDNLEE, ELIWRQHLEKHKRMHLKNNDVKSLK	mito(14.5),mito_nucl(10.666),cyto_mito(10.333),nucl(5.5),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMH1	Piso0_001336 protein	Low	7.5	1	3-23	LCRTRLQEERKQWRKDHPFGF	mito(13),nucl(7.5),cyto_nucl(5.5),pero(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0L9	Piso0_004857 protein	Low	9.5	1	12-31	IKKLASRVKNIYKSKNQDGS	nucl(16.5),cyto_nucl(11),mito(5),cyto(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y129	Piso0_005027 protein	Low	5	1	9-38	SVGRMGSPKNTRRVRGKRGNQEQQRLIDRE	plas(24),mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEV2	GlcNAc-PI synthesis protein	Low	8.7	1	419-444	PADNIDKVTKWPKKKKKRIVDTNALN	plas(13),mito(5),pero(3),cyto_nucl(2.5),nucl(2),E.R.(2)	KWPKKKKKR (428-436, prob:0.89)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YF87	4-alpha-glucanotransferase	Low	6.7	1	65-84	NESFDRRKFQKIPLKRVFHE	cyto(10.5),cyto_nucl(9.833),nucl(7),cyto_mito(6.666),pero(5),vacu(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLU8	Piso0_001830 protein	Low	9.2	1	468-491	SIVLRSPKRIHWEKCQQTRFREIQ	nucl(17),cyto_nucl(14),cyto(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YN89	Altered inheritance of mitochondria protein 11	Low	7.5	1	15-34	ASSSDEYKQRRKRQMGIFMA	nucl(8.5),mito(8),cyto_nucl(7.5),cyto(5.5),plas(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YST8	Piso0_000597 protein	Low	9.1	1	65-87	SDEPYEKIKKQNGKPYRLKPLSK	nucl(15.5),cyto_nucl(11.5),cyto(6.5),mito(2),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YT44	Piso0_000114 protein	Low	8	1	588-611	TSNTDGSKRDNKRFLNKRNWSDLV	nucl(10.5),cyto_nucl(7.5),mito(4),cyto(3.5),plas(3),E.R.(2),pero(1),golg(1),cysk(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YU23	Piso0_000464 protein	Low	5	1	1-23	MLNKIKFRSPRFPPKHFRNSVLL	E.R.(8),golg(8),extr(3),vacu(3),mito(2),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUN0	Maintenance of mitochondrial morphology protein 1	Low	9.2	1	408-431	FQVVKLPSLWPRRKNTREPLGSSS	nucl(16),cyto_nucl(11),cyto(4),golg(3),mito(1),plas(1),cysk(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZT4	Piso0_005736 protein	Low	7.7	2	149-168, 1347-1374	FEKCSTSKSHGPQCKKYHFY, SWDPKPCPGKLKQFKKKHSIKMSTFTKI	E.R.(9),extr(7),golg(3),vacu(3),nucl(2),cyto(1.5),cyto_mito(1.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y098	Piso0_005907 protein	Low	5	1	507-527	PLLFYRFGKRLRQKSKFALKL	plas(27)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y220	Piso0_005390 protein	Low	7	2	10-32, 644-663	DFYYPSQKTKEYKKLRQEVTNEY, NIEHKIYKGRPKINYRYYNW	plas(14),mito(7),E.R.(4),mito_nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y8K5	Piso0_004356 protein	Low	9.6	1	188-213	NSCNICSRCIKREQKRASRRKTVFTG	nucl(16.5),cyto_nucl(11),cyto(4.5),E.R.(2),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCQ4	Autophagy-related protein 15	Low	5	1	137-156	RSPKEKSRAVRLKHRHEPNF	extr(12),golg(8),mito(2),E.R.(2),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJG4	Piso0_003576 protein	Low	7.8	1	66-85	LSNACKRTQRHGDQHSKLTT	cyto_nucl(11.833),nucl(11.5),cyto(9),cyto_mito(6.499),mito(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YN93	Piso0_001472 protein	Low	9.7	1	20-44	LTPKTGCWKVSKKDKSKEAMKENAV	nucl(17),cyto_nucl(12),cyto(5),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQG9	Vacuolar protein sorting-associated protein 29	Low	9.1	1	17-36	SIPSKFKKLLCPNPKSVPHN	nucl(15.5),cyto_nucl(13),cyto(9.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YVH2	Piso0_000454 protein	Low	7.6	1	69-92	KSDTVNAKRNKSNKKQKLAIQGLS	mito(10.5),nucl(9.5),cyto_mito(7.333),cyto_nucl(6.833),cyto(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZC3	Piso0_005567 protein	Low	8.3	1	255-282	TFSSRKSSCMGCRKRKIKCVFNTELNKC	nucl(14.5),cyto_nucl(10.833),mito(7.5),cyto_mito(6.499),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZC8	Piso0_005572 protein	Low	6.4	1	340-359	AVAKFQKRFRHEIQKRRMAV	mito(13),plas(6),nucl(4),cyto(1),extr(1),pero(1),golg(1),cyto_pero(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y013	Piso0_005818 protein	Low	9.9	1	202-223	LSEHSPRDKKLRSRIVKPDYYI	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y025	Piso0_005831 protein	Low	8.5	1	169-192	ETGFSKVVKKWDKRSKSHTKELFI	nucl(13),cyto_nucl(13),cyto(11)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDH4	Endonuclease III homolog	Low	9.2	1	1-23	MSYSAPRRSKRRLKHIEVSTSGS	mito(15),nucl(11)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDN7	Piso0_002843 protein	Low	9	1	151-172	PSSTDPKVHKFRRKIVKNCIND	nucl(17),cyto_nucl(12.333),cyto(5.5),cyto_mito(4.666),mito(2.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YHG7	Piso0_003202 protein	Low	7.3	1	25-50	VSGGHKSKGYAKKIPPHFKVDKRTLS	mito(14),nucl(8),cyto_nucl(7.5),cyto(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPJ6	Amidase	Low	5	1	8-40	KSSDPVKFKEWKPKIEKYKTKLKENTKKEWEVS	cyto(16.5),cyto_nucl(9.5),pero(6),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YT76	Maintenance of mitochondrial morphology protein 1	Low	9.9	1	408-431	FQVVKLPSLWPRRKNTREPLGSSS	nucl(17),cyto_nucl(10.5),golg(3),mito(2),cyto(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YVJ9	Piso0_000484 protein	Low	8.8	1	388-410	SSESQQRNDKKHRLLPQFKRALA	nucl(15.5),cyto_nucl(14.5),cyto(10.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y8Y4	Piso0_004495 protein	Low	6.6	1	30-49	LSNNKKVLYKRKKHFLSDLK	plas(21),nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YGK6	Piso0_002884 protein	Low	7.7	1	200-223	QAANMKRRTNFRKLPKQQQRLCHE	nucl(8.5),cyto_nucl(6),mito(5),plas(4),golg(3),cyto(2.5),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJQ2	Type II protein arginine methyltransferase	Low	9.7	2	17-41, 71-90	KVFYRTLFSKFKKKPSPSESKTPES, APKNAERKPHPLQKNNSYSS	mito_nucl(12.666),nucl(12.5),mito(11.5),cyto_nucl(8.833)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCD0	Piso0_002343 protein	Low	9.8	1	2-69	SVGETKGHSRHQRIKFKAHRTRNNNPCDSCRSRKRCCERINEEHCALCIKASKKCTFRYTKDKYFRYD	nucl(18.5),cyto_nucl(10.833),mito(3.5),cyto_mito(3.333),cyto(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCW8	Lipoyl synthase, mitochondrial	Low	6.2	1	26-50	DSAEHSGKPKTRRRKTVFSDSLNKG	mito(18.5),mito_nucl(12.333),nucl(5),cyto_nucl(4.333)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDW4	Piso0_001262 protein	Low	5.8	1	647-667	AKEEEKKQAIRQKQEEKNAAE	cyto(21),cyto_nucl(13),nucl(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFE9	Dolichyl-phosphate-mannose--protein mannosyltransferase	Low	5.4	1	1-22	MSQSLRKRGTKKSNVSNVTNQE	plas(20),E.R.(4),nucl(1),mito(1),vacu(1),mito_nucl(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNL4	Piso0_001604 protein	Low	8	1	1118-1140	GGLTSIRSRKKKSAQQEKMISPS	plas(10),E.R.(8),mito(3),vacu(2),cyto_mito(2),mito_nucl(2)	KRRKHRR (1234-1240, prob:0.749)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPP9	Piso0_000660 protein	Low	6.5	1	143-170	RSDDQPEQHQKNKSKKSKNKSSYLTSTT	extr(6),nucl(5),golg(4),mito_nucl(4),mito(3),cyto(3),pero(3),cyto_mito(3),cyto_pero(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRB7	Piso0_000717 protein	Low	5	1	25-45	ILLFVYFRKRQRRVYEPRLVV	plas(15),E.R.(8),mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRW2	Piso0_000919 protein	Low	9.7	1	82-115	LDSVLRKRRLKMKKHKLRKRRREQRALKKRLGKI	mito(19.5),mito_nucl(13.833),nucl(7)	RKRRLKMKKHKLRKRRREQRALKKRLGKI (87-115, prob:0.999)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZ12	Piso0_005444 protein	Low	5	1	12-31	HVSNEGRSRRRNSQRSSSVG	plas(22),E.R.(2),mito(1),pero(1),golg(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y9P6	Piso0_003851 protein	Low	9.8	1	34-56	SDDNYQVSKRTPRRNRPFNDWAL	nucl(20),cyto_nucl(14.5),cyto(7)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y9T3	Piso0_003891 protein	Low	8	1	674-695	ESVLRECSKKEIRKKLLLHFNS	cyto_nucl(13.5),cyto(12),nucl(11)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDS5	Piso0_001221 protein	Low	5	1	2-25	NSIHTMKKISRRVIRKLTTKQGLL	plas(26)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEN6	Piso0_002297 protein	Low	7.3	1	734-756	CYIEKNIKKKLVKEQSKKDRYLT	mito(17),nucl(7),cyto_nucl(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YIG6	Piso0_003209 protein	Low	9.9	1	4-27	AAYDKRLSRAKHSRRETNSKSLSN	nucl(18),cyto_nucl(13.5),cyto(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YII5	Piso0_003229 protein	Low	8	1	37-56	IKNTKARRRMGSRNSPQRLR	extr(11),mito(7),plas(4),cyto_mito(4)	KARRRMGSRN (41-50, prob:0.729)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YKW1	Piso0_001472 protein	Low	9.9	1	17-44	SSEITPKTSRWRISKKDKIKEAVKENSL	nucl(18),cyto_nucl(11.5),cyto(3),pero(2),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZM4	Exonuclease 1	Low	8.5	1	554-575	STYISKKSTRTVTKRKVLAPKD	cyto_nucl(14.5),nucl(13.5),cyto(10.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0Z4	Piso0_004992 protein	Low	7.2	1	117-137	SLKQNLKKLKHDKTSKSFPKF	nucl(6),pero(6),cyto(4),E.R.(4),mito(3),plas(1),extr(1),golg(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMH3	Piso0_001338 protein	Low	9.6	1	1-21	MSSKVGSSSKKKNAPPENHDT	nucl(18),cyto_nucl(12),mito(5),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQ81	Piso0_000846 protein	Low	7.6	1	412-435	STEDSFSKYTRRRRWIRTAELVFN	plas(16),nucl(7),cyto(1),E.R.(1),golg(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YSB2	Mannosyltransferase	Low	5	1	467-488	STLQTNVKSFKKKQNKVFIVSP	plas(18),E.R.(6),mito(1),pero(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4E8	Piso0_005173 protein	Low	8.3	1	1-24	MATLIPPPSKKQRKEAQNVRDVDI	nucl(13.5),cyto_nucl(9.833),cyto(5),cyto_pero(4.833),mito(4),pero(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y500	GPI ethanolamine phosphate transferase 1	Low	5	1	978-999	VSESPISSRVKRRTRASKLSSS	plas(12),E.R.(6),mito(4),golg(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBJ7	Piso0_002049 protein	Low	9.2	1	106-131	SEHQWFKDSKKSKSNPRRNWYHWAPP	nucl(15.5),cyto_nucl(11.5),cyto(6.5),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEZ2	Piso0_002407 protein	Low	9.3	1	360-389	AEQLKKSQAKASKKSKVSKKRQAGNILEAT	cyto(12),cyto_mito(11.5),mito(9),nucl(5)	KERAEQLKKSQAKASKKSKVSKKRQA (357-382, prob:0.965)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRU5	Casein kinase II subunit beta	Low	8.1	1	205-229	NYSKLNRWRELQRRKVEKRLLNAKP	cyto_nucl(13.5),cyto(13),nucl(12)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YUH2	Methionine--tRNA ligase	Low	6.9	1	1-20	MMFKRLKRQLVQCRRYSSKS	mito(16.5),mito_nucl(12.833),nucl(8),cyto_nucl(5.833)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0K1	Piso0_004838 protein	Low	8	1	71-101	NERREALQRKVERQRRARNMRKEHTKHSRED	mito(25)	RKVERQRRARNMRKEHTKHS (79-98, prob:0.856)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1X4	Piso0_005341 protein	Low	9	1	94-114	RLRTRNGRKILARRRAKGRWY	mito(20.5),mito_nucl(12.5),nucl(3.5)	KRKRTFGFLARLRTRNGRKILARRRAKGR (84-112, prob:0.943)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y9J1	ATP pyrophosphate-lyase	Low	9.7	1	1-20	MSFLRRDKSKSNIKNLNNTT	nucl(19.5),cyto_nucl(12.833),cyto(5),cyto_mito(4.333)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YBB7	Piso0_001965 protein	Low	8.6	1	618-646	LEDKKDSKTTKKPTQKHSKTNSNESNKAS	nucl(15.5),cyto_nucl(10.833),cyto_mito(5.833),mito(5.5),cyto(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCW5	Piso0_002543 protein	Low	9.8	1	192-220	GLTVPKKALKIKKKNKKPVSRKFNSTKYV	mito(13),cyto_nucl(7.5),cyto(7),nucl(6)	PKKALKIKKKNKKPVSRK (196-213, prob:0.976)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEJ2	Piso0_002252 protein	Low	5	1	542-565	IIPSFIWGKTWRRKTKRLYLELVE	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YJ92	Piso0_003503 protein	Low	7.3	1	744-763	QESPKKIGNVFRKRPRNSID	plas(7),E.R.(7),nucl(6),golg(3),mito_nucl(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YKQ1	Piso0_001407 protein	Low	6.5	1	334-356	MQKRLEHLKQNCKKNGRFDKEFC	cyto(10),cyto_nucl(8.833),cyto_pero(8.333),nucl(6.5),pero(5.5),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLR2	Piso0_001792 protein	Low	9.3	1	524-548	AEKEKEDKGKDTKKDHKPVHEHEAV	nucl(18),cyto_nucl(14.5),cyto(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMH6	Piso0_001341 protein	Low	8.1	1	490-512	DITSDKSSKQPFRKSRQSSGNGY	mito(13),nucl(8),cyto(5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZ38	Signal recognition particle 54 kDa protein	Low	8	1	89-110	HEEPPKPKKLSHKQQTTRGAKG	cyto(13),cyto_nucl(13),nucl(11)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZK0	Piso0_005648 protein	Low	9.2	1	676-702	EADKIWKAKKEMYRKNHAKRRTSSIEE	nucl(15.5),cyto_nucl(12.5),cyto(8.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y7B5	Piso0_004040 protein	Low	5.5	1	59-78	LLVVRRWRRRQVERCSSPNR	mito(11),extr(7),cyto(5.5),cyto_nucl(4),nucl(1.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YAP0	Piso0_004207 protein	Low	9.9	1	157-181	SWPLAKSQGRIERRKRVQMWLRNEF	nucl(17.5),cyto_nucl(9.5),mito(9)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YAS6	Piso0_003702 protein	Low	8	1	443-465	KPLSKNQRKRLAKKAAKKRVSKS	plas(20),E.R.(4),mito(1),pero(1),golg(1)	SKNQRKRLAKKAAKKRV (446-462, prob:0.967)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YB03	Piso0_004252 protein	Low	5	1	816-835	SDSWKDKCLRVPWKVRQFLI	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YE12	Piso0_002066 protein	Low	9.8	1	691-722	CGKWERYPREFSKCRRCKRTKYCSRECQMRAW	nucl(19.5),cyto_nucl(14.5),cyto(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YGI1	Piso0_003652 protein	Low	8.5	1	855-874	IDSHCKHNNKPDKDKRGFVS	nucl(15),cyto_nucl(12.833),cyto(8.5),cyto_mito(6.166)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YGM7	Piso0_002905 protein	Low	5	1	17-42	IDPNEHKHSHDDKHKDKRDSKDVQVE	plas(26)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLA9	Piso0_001629 protein	Low	7.4	1	7-36	RIAIVSTDKCKPKKCRQECRRSCPVVKTGK	nucl(9.5),cyto_nucl(7.833),mito(7.5),cyto_mito(6.833),cyto(5),plas(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YM17	Mediator of RNA polymerase II transcription subunit 13	Low	8.1	1	1432-1452	VTNVKSWYCKNQKKNDNDIFD	nucl(10.5),cyto_nucl(8.5),mito(7),cyto(5.5),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YN28	Piso0_001403 protein	Low	6.8	1	614-637	KEFVAKMSKKLKKHSSASRDAQEK	mito(10.5),cyto_mito(9.666),cyto_nucl(8.833),nucl(8),cyto(7.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRJ6	Piso0_000800 protein	Low	9.6	1	870-893	LLSLRNPRIKKHYRSNSNKGPEDY	nucl(19),cyto_nucl(14.5),cyto(8)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZE2	Piso0_005588 protein	Low	9.2	1	12-41	RNRVPVSCLICKRRKVKCDKVKPACGGCVK	nucl(11),mito(9),cyto(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZN7	Piso0_005686 protein	Low	5	1	36-59	DSKGENTKYKKVKRKVPEGLSKND	plas(12),mito(5),E.R.(5),cyto(2),pero(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3K7	DNA-directed RNA polymerase subunit beta	Low	9.4	2	3-25, 1094-1117	AKFRTLEREKRFQNPPKEKPTFQ, SAASVRCRRCSKKLEYYTQKGQYV	cyto_nucl(11.333),cyto(11),nucl(10.5),cyto_pero(7.833),pero(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEZ8	FXNA-related family protease 1	Low	6.1	1	747-772	CHSFNTKKVNKFSKKHANKKSHAMMN	golg(7),mito(5),cyto_nucl(3.5),nucl(3),plas(3),E.R.(3),vacu(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YG17	Piso0_002813 protein	Low	9.8	1	65-89	AEIARIRKARQEKRRRLEEKAKELG	mito(13.5),cyto_mito(9.5),nucl(6),cyto(4.5)	RIRKARQEKRRRLEEK (69-84, prob:0.879)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YH97	tRNA (guanine(37)-N1)-methyltransferase	Low	9.6	1	348-377	LNWANNVKKVEKKKPRKKRRVDPSNAPPTE	mito(17.5),mito_nucl(12.833),nucl(7),cyto_nucl(5.333)	KKVEKKKPRKKRR (355-367, prob:0.986)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YL92	Piso0_001612 protein	Low	8.2	1	154-178	LDLDRHKRTYKKYADKKDRTPKDEE	nucl(11),cyto(8.5),cyto_mito(8),mito(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRP5	Piso0_000849 protein	Low	5.9	1	211-231	ASSPRFGQRPSGKKKWFNFFF	plas(14),mito(7),nucl(2.5),cyto_nucl(2.5),E.R.(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YT07	Piso0_000070 protein	Low	9.9	1	130-149	KQDFIKTLKHRRYINKKLSS	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4R0	Piso0_005299 protein	Low	9.2	1	196-216	TEKPEREKKLKPLPKGQQTLN	nucl(18.5),cyto_nucl(14.333),cyto(7),cyto_pero(4.499)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y996	Autophagy-related protein 2	Low	9.6	2	353-383, 1327-1347	ASFTRLFKLKNLRKRKQRSSNQLNKYNPRFP, CSSTKNYKNLRLRRSKTHKVV	nucl(8.5),cyto_nucl(6.5),E.R.(6),mito(4),cyto(3.5),extr(2),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y9V9	Piso0_003917 protein	Low	9.9	1	1178-1199	SSFIKGFGRSRKKKSSDQGYTS	nucl(17.5),cyto_nucl(10.5),plas(3),cyto(2.5),vacu(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YG49	1,3-beta-glucanosyltransferase	Low	5	1	519-542	SDNSGKTLHSEKKNKTKLKSQAIT	extr(17),cyto(4),E.R.(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YME0	Piso0_001303 protein	Low	5	1	60-80	HTSNSMGRRKRSLRKVTSSGE	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNL2	Piso0_001601 protein	Low	6.4	1	366-388	DGFTRFTRSRKWMRKAVLTIHKQ	plas(15),nucl(4),golg(3),pero(2),mito(1),cyto(1),E.R.(1),cyto_mito(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YP01	AMP deaminase	Low	9.7	1	169-191	IYPPPPKPTYKSKNKFNQVVRND	nucl(17.5),cyto_nucl(12),cyto(5.5),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YVP9	Acyl-CoA desaturase	Low	8.1	2	10-31, 42-66	GLPYNLRDRKHRIKLSSNGADS, QASHMKSNINHRKKRNIIFQYNYTN	plas(21),nucl(3),cyto(1),golg(1),vacu(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1F1	DNA polymerase	Low	9.4	1	1494-1513	YYQKHVFKMRSKDGEHKQKL	nucl(17),cyto_nucl(13.5),cyto(8)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y389	Piso0_005916 protein	Low	5	1	29-49	NLENESKLRRRLERRHVEMLA	plas(27)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3C6	Piso0_004776 protein	Low	5	1	2-21	SEPVKTELKNRGHRNRSWAE	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDP0	1,3-beta-glucanosyltransferase	Low	5	1	519-542	SDNSGKTLHSEKKNKTKLRSQAIT	extr(16),cyto(5),E.R.(3),cyto_pero(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFB9	Lipoyl synthase, mitochondrial	Low	6.9	1	26-50	DSAEDSGKPKTRRRRTVFSDSLNKG	mito(19),nucl(5.5),cyto_nucl(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMD0	Piso0_002036 protein	Low	9.1	1	251-270	KENVRRERLARQKKDRELLS	nucl(15.5),cyto_nucl(13.5),cyto(6.5),mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNE4	Piso0_001527 protein	Low	6.6	1	27-52	VSCVPYDTKKSKSKNKGSSTNDKSKY	mito(14),cyto_nucl(7.5),cyto(6.5),nucl(5.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNW5	Piso0_001711 protein	Low	9.2	1	11-31	FDNNNKKKAKVETKQGNDSSK	nucl(15.5),cyto_nucl(12),cyto(7.5),pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YR93	Piso0_000693 protein	Low	7.6	1	215-235	LSLSQDKKKIIRKIWKASDVD	mito_nucl(12.166),nucl(11.5),mito(11.5),cyto_nucl(8.833)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRQ7	Piso0_000862 protein	Low	5	1	1023-1053	GSECWKWIKRIYFRRKAKNPKNPEHELERND	plas(24),golg(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YRY1	Vacuolar protein sorting-associated protein 29	Low	9	1	17-36	SIPTKFKKLLCPNPKSVPHN	nucl(14.5),cyto_nucl(12.5),cyto(9.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZ65	Piso0_005499 protein	Low	6.4	1	394-414	SSVSSNCERKKQKHEARLGYI	plas(15),nucl(4),mito(3),E.R.(2),vacu(2),cyto_mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y696	Piso0_004729 protein	Low	7	2	28-50, 430-451	IQTEHKHELKKHLKKRHVSCIAL, RFYFGLKKQKINRKENHTYRSP	plas(26)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YA32	Piso0_003990 protein	Low	8.3	1	158-183	EKPATAKKQRLTSRQRGRLLRQKTIL	nucl(12),mito(12),mito_nucl(12)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFG3	Piso0_002591 protein	Low	9.5	1	68-91	NLSQENSTRRRSKRKAASDGPVSP	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YPQ1	Piso0_000662 protein	Low	5	1	105-125	QSLGRRKTSARRTPSRRSGEY	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YSD0	Piso0_001090 protein	Low	8	1	96-129	LAEKVEKVSRQQRKQKKNRDKKIFGTQRRAAKKA	mito(19),cyto(6)	SRQQRKQKKNRDKKIFGTQRRAAKKAAKRN (104-133, prob:0.979)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8XZE6	Piso0_005592 protein	Low	6.3	1	18-39	HIFTNPKAKANKKTQRWYKDVG	mito(14),cyto(8.5),cyto_nucl(7),nucl(4.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0L2	Cystathionine beta-synthase	Low	5	1	20-39	VKLNKIPKKHGIKAKIYAKV	cyto(23.5),cyto_nucl(13.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y244	Piso0_005491 protein	Low	9.8	1	1-23	MQAERRKTKAKYGPPPVKRPGYS	nucl(17.5),cyto_nucl(11.5),mito(3),cyto(2.5),cysk(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y3X8	Piso0_004992 protein	Low	7.1	1	277-296	ISFFKDYKANKKHKYYDPDN	nucl(6),E.R.(5),mito(3),cyto(3),extr(3),pero(3),cyto_mito(3),cyto_pero(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y5P4	Piso0_004521 protein	Low	7.4	2	40-59, 263-282	EKENKEKSKRPPDNDFAQQR, AWKTDKDRFKKTKYKPSDVV	plas(22),vacu(2),nucl(1),cyto(1),cyto_nucl(1),golg(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y6I7	Piso0_003758 protein	Low	9.5	2	79-100, 288-307	KFLADGKQTKKDQKPSGKASIF, STPRRTFKRDYESKRKHFGV	plas(16),nucl(7),mito(1),cyto(1),golg(1),vacu(1),cyto_mito(1)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y6P2	Piso0_003813 protein	Low	9	1	7-31	AKASNNQSRSRSRSRNRNSASAPRS	nucl(14),cyto_nucl(10),mito(7),cyto(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y9K0	Piso0_004717 protein	Low	5	1	482-508	IIYFNYWYRNKKKDEFRKKTNTETEFI	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YHS5	Piso0_003314 protein	Low	6.1	1	9-31	VHCARAPFKWRVRYPRCKKAPYT	mito(19),nucl(3),cyto(2),pero(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YLZ5	Piso0_001894 protein	Low	8	1	421-449	DGNTKKLADDKKKGGKKGKRDSSAPKLAL	extr(24),golg(2)	DDKKKGGKKGKRDS (429-442, prob:0.965)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YNM2	Piso0_001612 protein	Low	7.8	1	156-176	LDRHKRTYNKYADKKEKTPKD	nucl(10),mito(9.5),cyto_mito(9),cyto(7.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQM1	Piso0_000992 protein	Low	5	1	670-690	VTSAQKLQRKKILNSCKDRVD	cyto(27)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YSS9	Piso0_000588 protein	Low	8	1	30-59	EGLDEEKRGRRRGRPDRKHADRSRSRSLSV	plas(23),golg(2)	KRGRRRGRPDRKHADRSRSRSLSVRR (36-61, prob:0.983)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YV00	Piso0_000274 protein	Low	9.5	1	505-531	PAAVPSSSSRPSKKKKNKKKSSKKKKN	cyto_nucl(6),E.R.(6),nucl(5),cyto(5),extr(4),pero(3),golg(2),vacu(2)	RPSKKKKNKKKSSKKKKN (514-531, prob:0.999)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YVP6	Piso0_000534 protein	Low	6.6	1	371-393	ATESITKSKKKKHMDTNDQTFKD	E.R.(7),nucl(5),extr(4),mito_nucl(4),mito(3),cyto(2),pero(2),vacu(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y0M1	tRNA(His) guanylyltransferase	Low	9.9	1	225-246	QELSKRQLQRLEKQRRKANIST	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y1B7	Sterol 3-beta-glucosyltransferase	Low	9.7	2	111-130, 184-204	EEKKQETTRRRSSEDRDKPE, QYPSKISLDKRSKRTPFQQSV	mito(13),nucl(7),cyto(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y6J8	Piso0_003769 protein	Low	9.2	1	490-512	SENHRSAKKKTTNYQGNNNNARA	nucl(16),cyto_nucl(14),cyto(8)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YCW0	Piso0_002537 protein	Low	9	1	38-60	TLVWDKEKPRKLRPFVGKRTFNP	nucl(10),cyto(7),E.R.(4),cyto_pero(4)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YDK8	Piso0_002813 protein	Low	9.7	1	65-89	AEIARIRKARQEKRRRLEEKAKELG	mito(15.5),cyto_mito(10),nucl(6),cyto(3.5)	RIRKARQEKRRRLEEK (69-84, prob:0.878)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YE86	Piso0_002143 protein	Low	6.7	1	203-222	QEPKEPKYWKQNSPKLKTKV	cyto(6.5),cyto_nucl(6.5),nucl(5.5),extr(4),golg(4),mito(3),E.R.(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEQ4	Piso0_002316 protein	Low	9.2	1	33-53	LKLPVNRQKRIRTPYGNIKAT	nucl(15.5),cyto_nucl(11.5),cyto(6.5),mito(3)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YFM0	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase	Low	9.4	1	1-23	MQNRPLRKKKKSISRQALQSNGL	mito(18.5),cyto_mito(11.333),nucl(5.5),cyto_nucl(4.833)	RKKKK (7-11, prob:0.716)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YMT3	Piso0_001303 protein	Low	5	1	60-80	HTSNSMGRRKRSLRKLTSSGE	plas(25)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YSW4	Piso0_000025 protein	Low	7.1	1	18-45	DVSRGSTSKIHKSRRPPNTAFRQQRLKA	plas(16),nucl(6),mito(2),cyto(2),cyto_mito(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YTK7	Piso0_000288 protein	Low	5	1	151-179	SDNSPQQPTKSKRQTKLESRKNKVNTPRY	plas(13),E.R.(5),mito(3),cyto(2),pero(2),cyto_pero(2)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8Y4K1	Piso0_005235 protein	Low	8.3	1	75-94	YLKYLTKRYLKKNQIRDWIR	nucl(12.5),cyto_nucl(11),cyto(8.5),mito(6)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YEI1	Non-specific serine/threonine protein kinase	Low	9.2	1	5-26	YTADLKQHRKAPPPPVRSKTEP	nucl(21),mito_nucl(12.833),cyto_nucl(12.333),mito(3.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YK91	Piso0_003064 protein	Low	8.6	1	913-933	SLSVGNRKGKRGNRNAHMKMQ	nucl(11.5),plas(8),cyto_nucl(7),mito(2),pero(2),cyto(1.5)	
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YL95	Histidine--tRNA ligase	Low	8	1	28-59	GAEVKEKPTKGNKNESKKSKKQDQFLLKTPKG	mito(15),cyto_mito(13.333),cyto(9.5),cyto_nucl(6.166)	KPTKGNKNESKKSKK (34-48, prob:0.746)
UP000005222	Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695)	G8YQ57	Piso0_000821 protein	Low	9.8	1	241-268	CNTTSSRLQSCKRYRKKLEDRNAQPAAP	nucl(17.5),cyto_nucl(12.5),cyto(6.5)