ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3GGB3	Cytoplasmic tRNA 2-thiolation protein 1	Low	8	2	16-41, 280-307	ELCHARKAVMKRPKNLQKLCKDCFYK, VLAPKKKKITTSYKTNKKKTHTENEVNA	mito(14),cyto_mito(11.333),mito_nucl(9.833),cyto(7.5),nucl(4.5)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3GGJ4	Histone deacetylase	Low	8.6	1	674-696	RKVMRHTRSYYKKMANAQKQQSI	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(2),pero(2)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3GHD1	Cleavage and polyadenylation specificity factor subunit 2	Low	9.8	1	580-599	EQNDRRKYNGKKSQRHQISK	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3GHY3	Ras GTPase activating protein RasGAP/neurofibromin	Low	8.6	1	2412-2437	TSVHCLQKYFKVRYKHRDRTSISGFF	plas(12),nucl(9),E.R.(2),golg(2)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3GI32	YAP1 binding protein 2 (YBP2)	Low	8.4	1	638-659	ENIAAVKEKHKKYPNSNKFELN	nucl(13),cyto_nucl(12.5),cyto(8),mito(5)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3GIA3	Uncharacterized protein	Low	9.4	1	258-285	IKSEKEKRQNPGQQTQKKRKYLFDKPDE	nucl(12),cyto(9),E.R.(2),mito(1),plas(1),pero(1),cysk(1)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3LQ03	Golgi guanosine diphosphatase	Low	8	1	105-132	VNQSSPKTTKTKPKTKGKPKGSCKEVDY	extr(13),golg(7),E.R.(3),mito(2),vacu(2)	KTKPKTKGKPK (114-124, prob:0.746)
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3LQA4	60S ribosomal protein L44	Low	8.2	1	2-31	VNVPKTRKTYCKGKECRKHTQHKVTQYKAG	nucl(12.5),cyto_nucl(11.5),cyto(9.5),mito(5)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3LRY0	Threonine aldolase	Low	7.3	1	347-370	YQYNQKNPYKYNIKNNKKMYNYDS	cyto(14.5),cyto_nucl(14),nucl(8.5)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3LSJ9	Quinate permease	Low	5	1	29-52	LSESRKRATKSNKKSMFRFRNIFQ	plas(26)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3LTT2	Uncharacterized protein	Low	8.3	1	39-58	TKTFRHQRKVSDNIRKPIRL	nucl(12.5),cyto_nucl(12.5),cyto(7.5),mito(3),pero(2)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3GEV5	Regulator of histone transcription (Fragment)	Low	9.8	1	1305-1328	SLKKVDNYDKKNWQHKPRYRLATI	nucl(16.5),cyto_nucl(10.5),pero(4),cyto(3.5)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3GF20	Protein involved in mannose metabolism and cell wall synthesis (Fragment)	Low	9	1	256-283	QRKEEEEKKRKEEEKKRKEEEEKKKAEE	golg(8),E.R.(7),nucl(3),pero(3),mito(2),cyto_nucl(2),vacu(2),cyto_pero(2)	EEQKRIEDEKKRIEEEKKRIEEEKKRVEEEKKRAKEEAQRKEEEEKKRKEEEKKRKEEEEKKKA (218-281, prob:0.998)
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3GGU6	SSD domain-containing protein	Low	5	1	235-259	CPDCSKSCPKLPRFKDFRKRCTVGK	plas(12),E.R.(8),mito(4),golg(2),cyto_mito(2),mito_nucl(2)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3GGY0	High-affinity glutamine permease	Low	5	1	28-47	ATPKSHWKSFKDSFKRKEVV	plas(27)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3GH22	S4 RNA-binding domain-containing protein	Low	9.7	1	161-181	VDTSKIKRNLLKYKNKIDDYD	nucl(17.5),cyto_nucl(12),cyto(5.5),pero(2)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3GHE1	Mucin-like not chitinase-possible cell wall mannoprotein	Low	8	1	1903-1931	VQLNLKKPFRNVAKKRKTASARRDQANED	plas(10),extr(6),mito(5),E.R.(3),golg(2)	FRNVAKKRKT (1911-1920, prob:0.755)
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3LN58	tRNA-specific adenosine deaminase subunit	Low	7.3	1	257-276	RVNYGKTIRKYNAKKRHHEE	cyto(16),cyto_nucl(13.5),nucl(9)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3LQ13	MYND-type domain-containing protein (Fragment)	Low	9.6	1	713-748	LECGRWEKYPREFSKCRRCKRTKYCSRECQMRAWHC	nucl(17),cyto_nucl(13),cyto(7)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3LQ28	Nuclear pore protein (Fragment)	Low	9.5	1	767-790	IENGQDKTKSKHKKKEVESEKIVP	nucl(17.5),cyto_nucl(12),cyto(3.5),mito(3),extr(3)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3LQS4	G domain-containing protein	Low	8.9	1	341-367	GEDGTARSKHRRRTAKDREYDLKNRLF	nucl(12.5),mito(12),cyto_nucl(7.5)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3LSK8	DUF2415 domain-containing protein	Low	9.9	1	16-36	VVPPHRDRLRNGRYNRCFQNY	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3LVP1	Uncharacterized protein	Low	9.8	1	615-642	VYMSKYQIKPKIKSCFKRTKETSIYKER	nucl(12),cyto(8),cysk(5)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3LW61	Long-chain-alcohol oxidase	Low	5	1	580-603	GPQFKSPRFKSDKPKEQRTLQDKD	cyto(11),cyto_nucl(8.5),pero(5),mito(4),extr(4)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3LY08	Transcription elongation factor 1 homolog	Low	8.3	1	1-22	MGKRKSSAKPQKKIKQTLDVTF	nucl(14.5),mito_nucl(12.333),cyto_nucl(9.166),mito(8)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3LZC9	TruB_N domain-containing protein	Low	7.2	1	47-69	LSTNARWSKQKVQNRVRNLKVKI	cyto_nucl(14.833),cyto(14.5),nucl(10),mito_nucl(6.665)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3GG58	Myo-inositol transporter	Low	5	1	497-522	GFNVKQASKLSKERKKHSKFINQHSA	plas(26)	
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3GG59	Cytochrome c1	Low	8	1	263-288	LLSIWVKRFKWQPIKNRKIRFDPPKK	extr(8),mito(7),cyto(5),plas(3),cyto_pero(3)	PIKNRKIRFDPPKK (275-288, prob:0.767)
UP000002258	Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)	A3GGJ5	Lipoyl synthase, mitochondrial	Low	5.3	1	36-56	SDALDKPKTRRRKTVFTDALN	mito(24),nucl(1),cyto(1),cyto_nucl(1),pero(1),cyto_pero(1)