ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCP1	KLTH0B04664p	Low	8.8	1	1-22	MSKGKKFRKIGKTSFQPPKNVV	mito(14),nucl(10),cyto(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF06	KLTH0D11264p	Low	5	1	20-41	AEAKVHKSKVYKSKQHNDGSEL	extr(24),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHM2	Required for respiratory growth protein 8, mitochondrial	Low	9.1	1	14-33	LVALEKTKRIPKKPSCDASP	mito(12),nucl(11),cyto(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHM9	Glycerol kinase	Low	5.7	1	639-659	RTRIFRSKSIDTERRRKWKLW	cyto(19),mito(4),nucl(2),pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI06	KLTH0E08690p	Low	6.5	1	36-75	FYEKTANGKTRRRKLPDYCSQREKKLWKKLQNRAWKDDRC	plas(11),mito(7),nucl(4),E.R.(2),golg(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E249	Protein transport protein SEC31	Low	7.8	1	1113-1135	QKAPIGPPPKHMKRRTHASNDID	nucl(11.5),cyto_nucl(9.833),cyto_mito(5.999),mito(5.5),cyto(5),extr(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E263	KLTH0H02442p	Low	7.5	1	279-303	RSDFKETRKHWRQLERQKKQKWVPT	plas(15),nucl(7.5),cyto_nucl(5),golg(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBE4	KLTH0A01914p	Low	5	1	1378-1399	ISLVLHKKPVRCKKNEMSYVNP	plas(23),E.R.(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCR4	KLTH0B05192p	Low	9.3	1	117-136	VRERSFKKPRGYACKNCCMY	nucl(16),cyto_nucl(12.5),cyto(7),pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJM6	Alpha-1,3-glucosyltransferase	Low	5	1	1-20	MPKALKKRGKSETVKDTRKF	plas(21),E.R.(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJW0	KLTH0F19536p	Low	9.5	1	15-41	IPAKQPPPVNASKQRKTKKFILSKYTI	nucl(17.5),cyto_nucl(12),cyto(5.5),pero(2),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLU5	KLTH0G03630p	Low	8	1	84-103	ALKEPPRDRKKEKNVKHSGN	cyto(22.5),cyto_nucl(12.5),pero(2)	KK (93-94, prob:0.61)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNA9	KLTH0G15510p	Low	6.7	1	168-189	SASLRQDSKKYRRSARQINLEL	cyto(8),cyto_nucl(8),nucl(6),mito(4),pero(3),cysk(1),golg(1),E.R.(1),extr(1),plas(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2V8	KLTH0H08096p	Low	8.7	1	1-20	MARRRNFKKGNRKTFGARDD	nucl(17),cyto_nucl(12.333),mito_nucl(10.333),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF40	KLTH0D12012p	Low	9.6	1	272-294	RQVIKPTPFRKRNKLVKDPINCC	nucl(19),cyto_nucl(15),cyto(7)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHQ0	KLTH0E06116p	Low	9.4	1	13-46	EKPAAMFTCKSCRQRKRKCSREKPACQRCVRLAI	nucl(11),mito(6),plas(6),cyto(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIG1	Mitochondrial import inner membrane translocase subunit TIM50	Low	8	1	85-109	QTSEAGGKRKRKRQTSADIKRERYA	mito(22),cyto_mito(12.833),mito_nucl(12.833)	GKRKRKR (91-97, prob:0.834)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIS2	Phenylalanyl-tRNA synthetase	Low	8	1	420-443	IDDFTHPKTKKRSLCYRINYQSMD	mito(14.5),nucl(10),cyto_mito(9)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIU1	General transcription and DNA repair factor IIH subunit TFB4	Low	9.1	1	315-336	TTKLKKKPVVPGMIQKKRKRIQ	cyto(12),cyto_nucl(9),extr(6),nucl(4),mito(2),pero(2)	KKKPVVPGMIQKKRKR (319-334, prob:0.806)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJR6	KLTH0F18546p	Low	6.1	1	2746-2767	TSQNKKRSSTVQGEKHNREKEQ	E.R.(8),mito(5),plas(5),nucl(3),pero(3),cyto_mito(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKA4	KLTH0F03014p	Low	8.7	1	1-26	MTAARSGKRKVGRRACMLCKLKKLKC	nucl(11),plas(5),mito(3.5),cyto_mito(3.5),cyto(2.5),E.R.(2),golg(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLJ1	KLTH0G01122p	Low	7.4	2	63-90, 258-278	IRKNFRQLSKKYHPDKNQKYRKLYERLN, PSTSRAFSNKRATRNKGPGAT	extr(9),plas(4),E.R.(4),golg(4),mito(3),nucl(1),cyto(1),cyto_nucl(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMN8	KLTH0G10406p	Low	8.2	1	552-571	APVFKQCKCGKNKKVRTLCF	nucl(15),cyto_nucl(13.333),cyto(10.5),mito_nucl(8.333)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNG3	KLTH0G16764p	Low	5	1	576-599	YGSVKTHPASPKPRNRNQTKHMIF	plas(26)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2P3	Pyruvate carboxylase	Low	5	1	950-970	PLRSDVLKNKRRKLTCRPGLE	cyto(18),cyto_nucl(10.333),cyto_pero(10.333),mito(6)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE28	KLTH0C05808p	Low	5	1	610-629	EYVLRRKNVIRQPPLGRHHR	plas(24),mito(1),E.R.(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGS5	KLTH0D07876p	Low	8.8	1	9-31	AYSQQPPQQQQQQQQPQQQPQHG	nucl(14),cyto_nucl(13.5),cyto(9)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI31	KLTH0E09284p	Low	9.1	1	1212-1234	TEEVDDKRGKKRPQIVETHKVED	nucl(14.5),cyto_nucl(10),cyto(4.5),mito(3),plas(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL88	KLTH0F10912p	Low	8	1	34-61	RRNNPDFRKSLKRKLKKHAEEEKQAKER	extr(9),mito(5),plas(5),E.R.(4),cyto(2)	RKSLKRKLKKHAEEEKQAKERAK (41-63, prob:0.945)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN29	KLTH0G13684p	Low	9.8	1	1-23	MTKLEKSRVDKRRRDKVEFDMPA	nucl(19.5),cyto_nucl(14),cyto(7.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2H6	Ribosomal protein	Low	6.1	1	54-73	RKGRVYVYCKSNKKHKQRQG	mito(20.5),cyto_mito(11.5),nucl(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E339	KLTH0H10142p	Low	7.8	1	147-168	DDKWNRKTKVESRRDRSQKCGV	mito(18),nucl(7)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E398	Probable metalloreductase AIM14	Low	5	1	35-54	IGARKLIPVRQRNRSKWAKW	plas(16),E.R.(4),mito(3),vacu(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3H1	KLTH0H13530p	Low	5.7	1	30-53	GSTRNYAKRTSSRKNDLKPVTFKI	mito(21),mito_nucl(12.833),cyto_mito(12.333),nucl(3.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBC4	KLTH0A01386p	Low	8	1	460-490	SIHSKSSSDDHRKRKAKVRRRIGLDRPNEVY	plas(19),mito(3),E.R.(2),mito_nucl(2)	RKRKAKVRRR (471-480, prob:0.913)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF81	KLTH0D12936p	Low	8.3	1	286-311	DFLDALKSNKKTRKPPAKQKLEHDEL	extr(8),E.R.(8),golg(5),vacu(2),mito_nucl(1),cyto_mito(1),pero(1),cyto_nucl(1),cyto(1),mito(1),nucl(1),cyto_pero(1)	KKTRKPPAK (295-303, prob:0.709)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF87	rRNA adenine N(6)-methyltransferase	Low	6.6	1	291-311	FTTVIKDKKFLRKCPKELTSS	cyto(11),cyto_nucl(9.333),mito(8),cyto_pero(6.833),nucl(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFF0	KLTH0D14564p	Low	6.1	1	8-31	SGPMSKTINTRKFRRTVRDNLLNV	mito(14),cyto(5),nucl(3),pero(2),plas(1),cysk(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGF3	KLTH0D04862p	Low	7.6	1	457-486	GKWEDYPKRFAKCRRCKRTKYCSRECQLQS	nucl(11.5),cyto_nucl(10.333),cyto(8),cyto_mito(7.833),mito(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGT9	Fructose-bisphosphate aldolase	Low	5	1	321-340	ADKPNKKKYDPRVWVREGEK	cyto(21),cyto_nucl(12.5),pero(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKI9	KLTH0F05082p	Low	9.6	1	89-113	NLPAAKPMTNTRKRRNTPAPLTLSQ	nucl(17.5),cyto_nucl(12),mito(5),cyto(3.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL49	DNA polymerase	Low	9.9	1	44-63	IPSDKFKKQKTVGYKPKDST	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLQ3	KLTH0G02596p	Low	5.8	1	561-580	VEEWEHRKKNDWKRVWGTTV	mito(10),pero(4),golg(4),E.R.(3),nucl(2),plas(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMJ2	KLTH0G09394p	Low	6	1	18-40	NDAQIKKGYRKQALKFHPDKNPS	cyto(20.5),cyto_nucl(12.833),nucl(4),mito_nucl(3.333)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E220	KLTH0H01496p	Low	6.2	1	711-735	LPGSGTFKWMKKKQERQTHAPEQTT	extr(13),mito(6),cyto(4),nucl(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBT1	Golgi to ER traffic protein 2	Low	8.8	1	4-28	ISDAEKRRILREKRQQKFNKGGASS	nucl(13.5),cyto_nucl(11),cyto(7.5),mito(2),pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBX0	KLTH0A05984p	Low	8.8	1	188-213	IDASTPCDRHHHRRKSTAIKFRKALY	nucl(10),cyto(7),cysk(6),mito(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBZ6	Triacylglycerol lipase	Low	5	1	1-23	MDDTKSLKRRTRFRIFKSHLGLA	extr(10),plas(7),E.R.(4),golg(3),mito(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDV5	Ceramide very long chain fatty acid hydroxylase	Low	5	1	329-349	PSYMRKLKKYHMEHHYKNYEL	plas(18),mito(4),E.R.(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE01	KLTH0C05170p	Low	5	1	44-64	WCRFRDSFKRAQKRSVPQGGD	plas(27)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DES3	Phosphoinositide phospholipase C	Low	9.2	1	723-743	AQLLPKPKTLKQKQSSYNFSV	nucl(16),cyto_nucl(12),cyto(6),mito(2),cysk(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJK2	5'-3' exoribonuclease	Low	8.5	1	103-122	GVAPRAKMNQQRARRFRSAR	nucl(12.5),cyto_nucl(10),mito(7),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK63	KLTH0F02090p	Low	5	1	21-40	KYVSKFRKERLREIANKLAG	cyto(9),mito(7),plas(4),mito_nucl(4),pero(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM66	Acyl-CoA desaturase	Low	5	1	29-54	PQLSEASKITKKRKRDPQLVHLLKKV	plas(23),E.R.(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3G2	KLTH0H13288p	Low	9.1	1	322-341	HSESSKKDPPQPKQNSSQGE	nucl(17),cyto_nucl(11.333),cyto_mito(4.666),mito(4.5),cyto(3.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD93	Carboxypeptidase	Low	5.6	1	70-91	LEFVTKPKFKTNRRPDSQWDFV	extr(21),vacu(2),nucl(1.5),cyto_nucl(1.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDW8	KLTH0C04400p	Low	8.3	1	43-67	SSRSTNQSSSTRRRKRRTVTDNMIE	nucl(11.5),cyto_nucl(9.5),cyto(6.5),mito(3),pero(2),E.R.(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG68	Structural maintenance of chromosomes protein 5	Low	9	1	277-301	QVKDHKVRIKQYKREYEKMRKQLKD	nucl(20),cyto_nucl(13.333),mito_nucl(10.833),cyto(5.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGG5	KLTH0D05148p	Low	9.9	1	458-477	QQQHQEQQHHQHHQHHQHQD	nucl(19.5),cyto_nucl(15),cyto(5.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKJ1	KLTH0F05126p	Low	5	1	86-105	ATNSTKERRKWILRLCRENS	mito(22),cyto(3.5),cyto_nucl(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKN5	KLTH0F06160p	Low	8.7	1	274-296	VTISVEKRKQRNKTTKQVRTIEK	cyto(13),nucl(10),mito(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DML8	KLTH0G09966p	Low	5.4	1	37-58	KGYRKWWKCSPKELKPDPKHRS	mito(17),plas(5),cyto(2),nucl(1),pero(1),E.R.(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E271	KLTH0H02618p	Low	6.5	1	101-120	AESKTKTRRRWLPNVIKKGL	cyto(13.5),cyto_nucl(10),nucl(5.5),mito(4),pero(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E364	KLTH0H10714p	Low	7.4	1	78-104	QEDPLKLRKKQLRSANRNKIKQNNFLS	mito(14.5),mito_nucl(13.666),nucl(11.5),cyto_nucl(7.333)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3R8	KLTH0H15796p	Low	7.8	1	155-176	IYCHGCRNEKDHPKRHKEWFMI	nucl(13),cyto_nucl(10.833),mito_nucl(9.833),cyto(7.5),mito(5.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBS8	26S proteasome regulatory subunit RPN2	Low	9.8	1	800-825	VLSTTAKAKARAKKTKKDGKDTVEEK	cyto(17),cyto_nucl(14),nucl(7)	KAKARAKKTKKDGKDTVEEKPRRESKSELKP (806-836, prob:0.964)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC65	KLTH0B00374p	Low	8	1	133-152	RSPSYGRKSLQKRRGGPGRG	extr(18),golg(6),E.R.(3)	RKSLQKRRGGPGRGPGGDKKP (139-159, prob:0.923)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDZ1	KLTH0C04950p	Low	5	1	1-20	MSALNQKYKKPRLQQAETAG	mito(21.5),cyto_mito(12.5),cyto(2.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF34	GlcNAc-PI synthesis protein	Low	6.4	1	370-390	SPMPRNKSWYKMLKNFHERND	cyto(10),cyto_nucl(8.5),mito(8),nucl(5),extr(2),E.R.(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG36	KLTH0D02112p	Low	8.4	1	258-281	CIDIHVLKRPKRARTNRSQAHLDV	mito(14),nucl(11),cyto_nucl(7)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGC0	KLTH0D04070p	Low	6.5	1	7-27	FVSQRSEKKNYGKPKPIPAYF	cyto(8),pero(7),mito(5),nucl(4),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2L3	KLTH0H05896p	Low	5	1	38-57	TKRVPKTSSKLDPDNPNKSK	plas(26)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCH7	KLTH0B03168p	Low	9.2	1	8-34	EAQKTHYTVCPKVKRRRISCEKGIDPF	nucl(19.5),cyto_nucl(12.333),mito_nucl(11.666),cyto(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCQ2	Protein transport protein Sec61 subunit beta	Low	5.7	1	11-30	RTLQKRRQAQSVKEKQQKQT	mito(13),plas(8),nucl(2),cyto(2),cyto_nucl(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ21	KLTH0F12826p	Low	5.9	1	695-717	RISKAYRKSVIGRKYRSKRDVTG	mito(7.5),cyto_mito(6.833),cyto(5),cyto_nucl(4.833),golg(4),nucl(3.5),pero(3),E.R.(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJR9	KLTH0F18612p	Low	8	1	185-209	SLMGKQNKTKKTKSSGKKKKKCVVL	cyto(13.5),cyto_mito(11.833),mito(9),mito_nucl(7.333)	QNKTKKTKSSGKKKKK (190-205, prob:0.952)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJU0	1,3-beta-glucanosyltransferase	Low	5.9	1	442-461	DPSPPKSPSKERERNSAPKP	extr(7),E.R.(5),mito(3),plas(3),pero(3),nucl(2.5),cyto_nucl(2.5),golg(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJU8	KLTH0F19272p	Low	9.7	1	32-52	GLTVTRKQERRNPNLEEKPTT	nucl(18),cyto_nucl(13.5),cyto(7)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL99	Protein arginine N-methyltransferase	Low	6.9	1	31-53	HPITNSRYRERVKKVFQEYRAEV	cyto(11.5),cyto_nucl(11.333),cyto_mito(9.166),nucl(9),mito(5.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMM3	Conserved oligomeric Golgi complex subunit 6	Low	9.5	1	609-631	LPEYHKSKFPQARKEKEVKKHLL	nucl(18),cyto_nucl(14),cyto(8)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEJ0	KLTH0C09636p	Low	5	1	4-28	LQQLEEKKRKLQELRERRRHVQVSN	mito(15),cyto_mito(11.499),mito_nucl(10.499),cyto_nucl(6.666),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEP8	KLTH0C11044p	Low	5	1	28-47	LKDSNLKQRTKRRLYTWDEI	plas(25)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHL9	KLTH0E05434p	Low	5	1	65-84	RYTLWVRRIKLKFKRALEIE	E.R.(11),golg(8),plas(3),extr(2),mito(1),pero(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHP1	Oxidant-induced cell-cycle arrest protein 5	Low	9.4	1	6-32	TLVHSHLHWRNVKRKHWQKDLVAKVVE	nucl(12),mito(11),cyto(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DID3	KLTH0E11616p	Low	5	1	65-85	SHMFKTPKYSYKKKSNWLFSD	golg(9),E.R.(6),mito(4),extr(4),vacu(2),cyto_mito(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK85	KLTH0F02574p	Low	8.1	1	17-43	KSDIIKCNKAIRPRSQRSGKSKRVTGL	nucl(11),cyto_nucl(8.5),mito(8),cyto(4),pero(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKY0	Phosphatidylinositol 3-kinase VPS34	Low	9.6	1	182-201	LTLQQLGKTNRKKRLPKGIF	nucl(18.5),cyto_nucl(13),cyto(4.5),mito(2),golg(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLT3	KLTH0G03256p	Low	9.8	1	158-179	LMYRSTKPPVPKKKNTNRVVAL	nucl(19.5),cyto_nucl(14.5),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM95	KLTH0G07018p	Low	7.9	1	9-31	ESSECASSIRKKRFNSRLPQLGL	nucl(12.5),cyto_nucl(12.333),cyto(9),cyto_mito(5.499),pero(2),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMD7	KLTH0G08008p	Low	8	1	113-139	VVGYNEMKTGRRRRKPKPVKNTYDTFV	plas(17),cyto(3),E.R.(2),golg(2),cyto_pero(2)	GRRRRKPKP (122-130, prob:0.899)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMS3	KLTH0G11220p	Low	8	1	401-425	YTSSSQLSRRRSKKWKRSLASFVER	plas(23),extr(1),E.R.(1),golg(1),vacu(1)	RRRSKKWK (409-416, prob:0.721)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2X5	KLTH0H08602p	Low	9.5	1	114-133	ILYEIKRRNYHEKPEHKGTD	nucl(19),cyto_nucl(15.5),cyto(8)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCM8	KLTH0B04378p	Low	8.6	1	19-41	KASPKATAKKPIRYRFNFMKHMD	nucl(17),mito_nucl(12.833),cyto_nucl(10.333),mito(7.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDK0	KLTH0C01628p	Low	9	1	139-161	RTGFSKVLKKWDKRSHSHTKDFY	nucl(15.5),cyto_nucl(14.5),cyto(8.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG38	Phospholipid-transporting ATPase	Low	7	2	97-119, 1249-1274	SQGIHRAPKKRSGLRNVFRKFNF, VEQFQKAIRRVRQVQRMKKQRGFAFS	plas(22),golg(2),cyto(1),E.R.(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJY8	KLTH0F00396p	Low	9.4	1	80-102	KQIQNWMSNRRRKSRKESIDSLL	mito(14),nucl(11)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJZ5	KLTH0F00572p	Low	6.9	1	2-21	DTHPGKSRPLSKRGSRSCPD	mito(15),nucl(5.5),cyto_nucl(5),cyto(3.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMP3	KLTH0G10516p	Low	8	1	379-407	SATRIIPALQKKHKRRSRRFMRMLYWYSP	plas(23),mito(2)	KKHKRRSRR (389-397, prob:0.82)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN38	Transmembrane 9 superfamily member	Low	7	2	70-89, 512-533	YYYPKFHFCRPEKLEKQRES, GSLIARKKCKWDEHPTKTKQIP	plas(18),E.R.(6),mito(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNL1	KLTH0G17930p	Low	7.1	1	38-57	PLSGKSKESRQKQSQTWDKL	cyto(14),cyto_nucl(13.333),nucl(9.5),cyto_mito(8.999)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E315	KLTH0H09504p	Low	7.2	1	1-21	MLKLRQLQKQKQEQARQNGTI	nucl(7.5),mito(7),cyto_nucl(6.5),cyto(4.5),pero(3),golg(1),E.R.(1),extr(1),plas(1),cysk(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3B5	KLTH0H11968p	Low	8.8	1	398-425	VDSMNRAVHNHRRRRKSNKSESTGDKTV	extr(9),cyto(6.5),cyto_nucl(5),nucl(2.5),mito(2),pero(2),E.R.(2),vacu(2)	RRRK (410-413, prob:0.648)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3E2	KLTH0H12672p	Low	5	1	1186-1210	DTGLNFVNKRRKRLSERKTSNIYTQ	plas(16),E.R.(6),mito(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCD9	KLTH0B02266p	Low	7.6	1	28-51	AYPFYAFKRLGKQHPKKHDSNLKY	mito(17),nucl(7),cyto(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEF7	KLTH0C08800p	Low	5	1	698-721	GRWTKLGCWRYKPQRWKRVAWFIY	plas(18),mito(4),E.R.(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFB8	KLTH0D13816p	Low	9.9	1	72-92	APASKDPTKKNKKTSRPAFNS	mito(21),nucl(5)	KDPTKKNKK (76-84, prob:0.683)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKD8	Protein SOP4	Low	5	1	243-265	KDDRLEKQKRKYADQKRVGEQAQ	mito(15),plas(5),E.R.(4),cyto(1),pero(1),vacu(1),cyto_pero(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKN3	KLTH0F06094p	Low	9.6	1	68-87	VTTKTLSKKRAKKIERNMRY	mito(16.5),cyto_mito(11),nucl(6),cyto(4.5)	KKRAKK (75-80, prob:0.696)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMA5	KLTH0G07238p	Low	8	1	652-676	EGEKIREAKRQMKRKDREMKQAVDN	mito(25),mito_nucl(13.833),cyto_mito(13.333)	IREAKRQMKRK (656-666, prob:0.731)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E216	DNA ligase	Low	6.5	1	553-572	HYEPSKRSRNWLKLKKDYLQ	mito(15.5),mito_nucl(12.999),cyto_mito(10.332),nucl(8),cyto_nucl(6.999)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E310	Aspartyl-tRNA synthetase	Low	9.6	1	73-104	GQPLSKKALKKLQKEQEKQRKKEEKARQLAEE	cyto(13),cyto_nucl(11.166),cyto_mito(8.666),nucl(8),mito_nucl(6.166),mito(3)	KKALKKLQKEQEKQRKKEEKARQ (78-100, prob:0.912)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDI1	KLTH0C01166p	Low	6.2	1	278-297	LVICTLQQDRKEKRRRNNSM	mito(16),cyto(4.5),cyto_nucl(4.5),nucl(3.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFB3	KLTH0D13706p	Low	9.6	1	222-242	GQRSRSFTGHRKNMPKLKKSE	nucl(15.5),mito_nucl(9.5),cyto(9)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH78	Phospholipid scramblase	Low	7	1	10-30	WYSPLPRVVRHRPVPRAGRTT	mito(13),nucl(5),pero(4),cyto(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DID1	KLTH0E11572p	Low	9.1	1	213-239	LQPPQNNKKKEAKKETKKEAKKPSAEK	cyto(13.5),cyto_mito(11.833),cyto_nucl(10.166),mito(8),nucl(5.5)	NKKKEAKKETKKEAKKPSAEKPKAAAEAEKPAEQPKKPKH (219-258, prob:0.996)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIT9	Exocyst complex component EXO84	Low	9.5	1	14-38	KQISSPTKTKTRSRSPANGKFKSNP	nucl(17),cyto_nucl(11.5),mito(5),cyto(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL64	Protein farnesyltransferase subunit beta	Low	5.7	1	416-435	ILKCCQSKERPGLRDKPGKS	cyto(13.5),cyto_nucl(8.5),mito(7),nucl(2.5),pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM44	KLTH0G05874p	Low	9.8	1	24-46	AKTTRGRGRRALRRAARRARSGS	mito(16),cyto_nucl(6.5),nucl(6),cyto(5)	GRKLARAPAAGKTPKRASAAKTTRGRGRRALRRAARRARSG (5-45, prob:0.997)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNS4	KLTH0G19426p	Low	7.9	1	637-660	RLFSAKESLRRRERQNIQNENIKR	nucl(10.5),cyto_nucl(9),mito(8),cyto(4.5),pero(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2B6	KLTH0H03630p	Low	5	1	290-310	ELYFIGLKKKHKVDKLKVFSE	mito(22),mito_nucl(12.333),cyto_mito(11.833)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E327	KLTH0H09768p	Low	5	1	1-23	MGWVKSPIHKRAHQNKRYNTATM	mito(26.5),cyto_mito(14)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDE4	KLTH0C00352p	Low	7.8	2	80-99, 513-533	TWSQKEERKVRWKNDWYVTF, FAKFYYIWRNKQKDNKWSTLS	plas(20),E.R.(4),nucl(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF38	KLTH0D11968p	Low	8.8	1	175-201	VIKKTDLKCCYCKKNFKNRFSELKLHL	nucl(10),cyto(8),mito_nucl(8)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJQ6	Putative transferase CAF17, mitochondrial	Low	7.2	1	397-421	LSPFSSSVIPRKQRRQRPAGSLLCF	mito(17),nucl(6),cyto(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK42	KLTH0F01606p	Low	5	1	78-98	PDDSSKHKTLKQNIKPRHVLM	plas(26)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL38	KLTH0F09702p	Low	9.3	1	8-33	VKSKNPCSVCTKRKVKCDRLVPCSNC	nucl(14.5),cyto_nucl(9),mito(7),pero(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN15	KLTH0G13376p	Low	7.5	1	183-204	QSSHNFKRKAVRIKQRMWWQNV	cyto_nucl(13.5),cyto(12.5),nucl(9.5),E.R.(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E1X5	KLTH0H00418p	Low	5	1	89-113	VKSYHPLPPKKLQKRLPVPDRPVDS	extr(19),golg(3),E.R.(2),mito(1),plas(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBC5	KLTH0A01408p	Low	9.4	1	152-176	WWDQYSRYCIRRKRKWQDLLEKSGL	nucl(16.5),cyto_nucl(10.5),cyto(3.5),mito(2),plas(1),pero(1),golg(1),cysk(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBQ2	Isocitrate lyase	Low	5	1	25-49	EIEKWWSQPRWKHTKRIYSAREIAA	cyto(9),pero(9),cyto_pero(9)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCT7	Adenylyl cyclase-associated protein	Low	9.9	1	352-380	TPSARTPPPKPKKPTTLKTKKPARKELVG	cyto_nucl(13.166),cyto(13),nucl(10),cyto_mito(8.332),mito_nucl(6.832)	ARTPPPKPKKPTTLKTKKPARK (355-376, prob:0.947)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCZ3	KLTH0B07018p	Low	8	1	373-401	VEKKMAVKRNLSKKNTKNDAKGRTKDAKG	cyto(11.5),cyto_nucl(6.5),mito(6),extr(3),plas(2),pero(2),E.R.(2)	KMAVKRNLSKKNTKNDAKGRTKDAKGNRKD (376-405, prob:0.902)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEZ8	KLTH0D11088p	Low	9.8	1	322-341	KKTGCTKSPRSRQLHSNRQN	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGS6	KLTH0D07898p	Low	9.8	2	18-51, 104-127	QQDTGRPRIRVRKACGTCKRRKVKCNGQQPCAGC, SPWQRFSPGKYRFHRRHQNLVPYY	plas(10),nucl(7),mito(5),pero(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIR6	DNA polymerase alpha subunit B	Low	7.9	1	110-129	PKTPTLKKRRVDQTPTQSNI	cyto_nucl(13.833),nucl(13),cyto(9.5),mito_nucl(9.165)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIR7	KLTH0E14630p	Low	9.2	1	860-883	VSGTPQKSEKSSRKKIKGVLSPLG	plas(10),E.R.(8),nucl(3.5),cyto_nucl(3),mito(2),cyto(1.5)	SEKSSRKKIKGVLSPLGKLKKKFP (867-890, prob:0.913)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKE1	KLTH0F03916p	Low	9.6	1	117-136	NDPAILRKWRYKQPPDPALR	nucl(12),plas(7),cyto_nucl(7)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKF7	KLTH0F04312p	Low	6.6	1	118-140	QVNKAPKQRRRTFRAHGRINKYE	mito(17),nucl(5),cyto(5),cyto_nucl(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKX9	KLTH0F08382p	Low	6.5	1	633-655	ESNEKFDNKRFRSPNRGENPRID	mito(15),cyto(7),nucl(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E242	T-complex protein 1 subunit delta	Low	5	1	5-24	ASTNSTFKNREKPQEVRKAN	mito(16),cyto(6.5),cyto_nucl(4.5),pero(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCY4	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial	Low	5	1	420-442	DKELVTNEKRNRRTKPHTCYEAT	mito(16.5),cyto_mito(9),plas(8)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDC6	KLTH0B10142p	Low	5	1	24-43	SLKHKRCITLDRPKINKVKL	plas(26)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE97	3-deoxy-7-phosphoheptulonate synthase	Low	7.3	1	1-21	MTDLQKKKFHRHIRRDAAVLL	mito(17),nucl(7),cyto_nucl(7)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DET4	KLTH0D09592p	Low	7.9	1	452-474	IVRGCKPQWKPYKTKRARDVIRI	nucl(12),cyto_nucl(11.333),cyto(8.5),cyto_mito(6.666),mito(3.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGF9	Protein SSH4	Low	9.8	1	477-507	GAEEVRPLKPRSNKKKNRKKNRKRGAKRGFK	nucl(6),cyto_nucl(5.5),golg(5),E.R.(4),mito(3),cyto(3),plas(3),vacu(3)	PLKPRSNKKKNRKKNRKRGAKRGFK (483-507, prob:0.999)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHQ3	KLTH0E06182p	Low	9.9	1	142-167	QLASEPKPVKKQKRRLRPRKALISLT	mito(21),nucl(5)	PKPVKKQKRRLRPRK (147-161, prob:0.965)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLU3	KLTH0G03586p	Low	8.4	1	588-612	LFSGKKRPASSIKQNENKKNSQSKS	nucl(12.5),mito_nucl(12.5),mito(11.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMI7	KLTH0G09262p	Low	7.1	1	827-848	ANLFHILRRQQHRQFRKPLILF	mito(17),nucl(6.5),cyto_nucl(5),cyto(2.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN65	KLTH0G14520p	Low	9.4	1	8-37	IAIVNDDKCKPKKCRQECKRSCPVVKTGKL	nucl(12),plas(8),cyto(3),mito(1),E.R.(1),golg(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBC0	KLTH0A01298p	Low	8.7	1	153-185	RWSAIRRKTSQQRLEGKKIKSDKKKLRRKVTDY	mito(20),nucl(2),cyto(2),cyto_nucl(2),pero(2),cyto_pero(2)	RKTSQQRLEGKKIKSDKKKLRRK (159-181, prob:0.963)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC86	KLTH0B00990p	Low	8.1	1	6-27	EASAALRKRKNLKRGINFTLMV	nucl(13.5),mito_nucl(12.166),mito(9.5),cyto_nucl(8.833)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCV9	KLTH0B06204p	Low	9.8	1	336-361	GYGHPNPPNDKNRRHRNKYAQGQGMD	nucl(12),cyto(6),pero(4),mito(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD90	KLTH0B09262p	Low	9.3	1	11-38	AERAARACLNCRRRKVKCSGQSPCANCR	nucl(14.5),cyto_nucl(10),mito(5),cyto(4.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGM8	KLTH0D06600p	Low	7.8	2	13-37, 299-320	VHCIQITKRSRYKHKAPACCKRSEH, KSIYDYVKVKRKERRYLTQEQV	mito(8.5),plas(8),E.R.(6),mito_nucl(6),nucl(2.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIP8	Vesicular-fusion protein SEC18	Low	7.4	1	649-671	LQVLKVYLKRKPPKDRRLLLIST	cyto_nucl(12),cyto(11),nucl(9),mito(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL09	KLTH0F09042p	Low	5	1	479-499	VYYALMWRRNRTRNQKYGELT	plas(26)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E1X8	KLTH0H00506p	Low	9.1	1	93-113	QFETRKRSRGRGKNFCYNKNY	nucl(15.5),cyto_nucl(12.5),cyto(6.5),pero(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBP3	KLTH0A04268p	Low	9.7	1	28-48	EAPKHPKTYRSVKYPYRNITF	nucl(17),cyto_nucl(13.5),cyto(6)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC44	Nucleolar GTP-binding protein 2	Low	9.7	1	1-23	MGTGKKEKQRRVRQNDTRDGNLR	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDU2	KLTH0C03806p	Low	5	1	503-525	IEDWWTRRRERSVRIKLDEKHQE	plas(27)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE42	KLTH0C06116p	Low	6.9	1	1-25	MIRDPLSRKRTPRFFKKTPTIQFLK	mito(16),cyto(6),nucl(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEP7	Palmitoyltransferase PFA4	Low	5.5	1	73-98	IHQWKNYCKKCDNYKPERTHHCKTCK	E.R.(7),golg(6),extr(5),cyto(2.5),cyto_nucl(2.5),pero(2),nucl(1.5),mito(1),plas(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFY5	Eukaryotic translation initiation factor 3 subunit B	Low	7.9	1	633-653	LLTNGEKKKVRKNLREWSAQF	cyto_nucl(14),cyto(13.5),nucl(11.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH90	KLTH0E02310p	Low	8	1	494-514	LRSKLAAKRRRGENASRSRHE	plas(14),E.R.(6),mito(2),extr(2),vacu(2)	KVLRSKLAAKRRRGEN (492-507, prob:0.86)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMQ1	KLTH0G10714p	Low	8	1	1-25	MRAWTSKAARPKRARKRGLFVCLAL	extr(9),golg(6),plas(5),E.R.(4),vacu(2)	KAARPKRARKR (7-17, prob:0.856)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2D2	Aurora kinase	Low	7.3	1	339-362	EDSKEMTYKRIKRRDLKFPDHISS	mito_nucl(11.166),nucl(10.5),mito(10.5),cyto_mito(8.833),cyto(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC48	KLTH0A07766p	Low	8.5	1	1-41	MRVTSKRSRGGCRNCKRSKIKCDERKPKCGHCIRKGKDDCT	plas(11),nucl(9),mito(4),E.R.(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG67	Glutamyl-tRNA synthetase	Low	7.8	1	24-43	FTSKKSILSKKPVKDIQPKT	mito(18),nucl(7)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH99	KLTH0E02530p	Low	9.1	1	3284-3307	FEEYIKRLRYWRNRLENKLDRAPK	nucl(16.5),cyto_nucl(15),cyto(8.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHN8	KLTH0E05852p	Low	7.8	1	29-48	SCGGRDKRKGCERGARFRGR	cyto_nucl(16.5),cyto(12.5),nucl(11.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DID4	Alkaline phosphatase	Low	8	1	1-28	MEKASLMGKRPIKRRNKYRKLSHYAFAL	mito(8),golg(7),extr(4),mito_nucl(4),vacu(3)	KRPIKRRNKYR (9-19, prob:0.808)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKT5	KLTH0F07348p	Low	7.7	1	29-48	SYLERRLRTRHSSKKSDSLF	plas(12),nucl(8.5),cyto_nucl(7),cyto(4.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKX0	Ubiquinone biosynthesis protein COQ4, mitochondrial	Low	8	1	302-327	PPDLRAIRRERAQQRKQFKLKYERHE	mito(17.5),cyto_mito(12.333),mito_nucl(11.666),cyto(5)	RAIRRERAQQRK (306-317, prob:0.674)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMW8	KLTH0G12276p	Low	5.6	1	767-788	ALKEWQKKKSGPHPGRPQPNSI	cyto(11.5),cyto_mito(8),extr(6),mito(3.5),nucl(2),E.R.(2),golg(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2M8	KLTH0H06248p	Low	9.7	1	15-41	RGGFGGRNKGRQQRRGRRDQEEKGWTP	cyto(11.5),cyto_nucl(9),mito(7),nucl(5.5)	RGGFGGRNKGRQQRRGRR (15-32, prob:0.842)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDS9	DNA helicase	Low	8.1	1	764-789	DDNNERSPTKSPRKRQRVRNATAAAR	nucl(11.5),cyto_nucl(10),mito(8),cyto(7.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGE7	KLTH0D04708p	Low	5	1	375-398	CYDSVIKFSRKNKKLRFNVKDFMD	mito(25.5),cyto_mito(13.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHB2	KLTH0E02882p	Low	5	1	42-61	SGSTKIVKKRRDKSVPEFVP	plas(13),cyto(4.5),cyto_nucl(3.5),mito(3),E.R.(2),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIE6	Very-long-chain 3-oxoacyl-CoA reductase	Low	7	2	2-21, 340-359	AFPWHLSKKQRPTKAEEMSF, YTFHKSIRTRALRKAARQAK	mito(12),cyto(6.5),extr(4),cyto_nucl(4),plas(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIX5	KLTH0E15928p	Low	6.6	1	269-292	LIMCHLHEQKKRNRGKNNPFSAAN	mito(14),cyto(5),nucl(4),cysk(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIX7	KLTH0E15972p	Low	8.2	1	247-267	TKGYPKYETRRNKRANRAGTR	nucl(14.5),cyto_nucl(13.833),cyto(10),cyto_mito(6.499)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKB7	KLTH0F03300p	Low	9.1	1	2-34	DDKGNSRKALRSCVRCRKNKIKCDLQEKRPGSC	nucl(15.5),cyto_nucl(13.5),cyto(8.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKP0	KLTH0F06270p	Low	8.3	1	391-414	LSIRISIKRAVRLRRKKSQASILG	plas(12),mito(6),extr(2),E.R.(2),vacu(1),golg(1),pero(1),cyto_nucl(1),cyto(1),nucl(1),cyto_pero(1)	RAVRLRRKK (399-407, prob:0.705)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLC9	Valyl-tRNA synthetase	Low	9.8	1	98-122	AASKQAAAPKKEKKKKEVEPIPEFV	mito(14.5),cyto_mito(11.5),nucl(7),cyto(5.5)	KEIEKERKKAEKLLKFAAKQAKKTEAASKQAAAPKKEKKKK (73-113, prob:0.988)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNG9	KLTH0G16940p	Low	5	1	333-356	QLSPMYWIKNKKKQEISEREKDEL	plas(20),E.R.(6)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3J9	KLTH0H14190p	Low	6.2	1	349-371	ISPKPNHIRIKLRPKSRRLFHIY	cyto(9),mito(5),nucl(3),plas(3),pero(3),E.R.(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCL6	KLTH0B04070p	Low	8.6	1	1171-1192	CYPVDKSTRKPIKDPNHPIIKR	nucl(12),cyto_nucl(9.5),extr(7),cyto(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE95	Ubiquitin carboxyl-terminal hydrolase	Low	9.7	1	71-94	FLLKVSKIRKPEQKQPIEKKLKLE	nucl(18.5),cyto_nucl(14),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEL3	KLTH0C10186p	Low	5.8	1	137-157	EEYPERCKRTRKWFSFKEAKE	mito(17.5),cyto_mito(11.5),cyto(4.5),nucl(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFA4	KLTH0D13508p	Low	8.9	1	42-63	DWIWNDRCKKRWLKSDQGDPLA	nucl(14.5),cyto_nucl(12),cyto(8.5),pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFG7	KLTH0D14960p	Low	6.9	1	1-20	MTESYKKRKVPSKEDGARSF	plas(17),nucl(5),E.R.(2),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFH0	Ribose-phosphate diphosphokinase	Low	7.1	1	89-110	IPQFPYSKQCKMKKHRGAITAR	cyto(14),cyto_nucl(12),nucl(8),mito(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH84	KLTH0E02134p	Low	5	1	6-32	CTKTLKFKTSLARKVRHQRPNCKLGMQ	mito(17.5),mito_nucl(10.5),cyto_pero(4),cyto(3.5),pero(3.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHF8	KLTH0E04004p	Low	7.8	1	48-67	GPPSIKRRSNRVKYSSPEKI	nucl(13),mito_nucl(12.833),mito(11.5),cyto_nucl(8.333)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3T8	KLTH0H16236p	Low	9.7	1	12-71	SIISCQQCRERKVRCSRHIPRCRSCDKREYVCRYPQTHRKTSTKLTKKRRSENTRFYGFS	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(2),pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC02	KLTH0A06754p	Low	7.3	1	1-25	MATLVPPPSKKQKRQAQQPRQVDLI	mito_nucl(10.833),mito(10.5),nucl(10),cyto_nucl(6.333),pero(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF29	KLTH0D11770p	Low	9.2	1	62-82	DQVKRFRAKFAPKKSKLLARR	plas(6),E.R.(5),cyto(4.5),cyto_nucl(4.5),nucl(3.5),golg(3),vacu(3)	RAKFAPKKSK (68-77, prob:0.708)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGF4	KLTH0D04884p	Low	9.8	1	179-202	RKIEEARVRERSKKERKTVVKTLD	plas(13),E.R.(6),nucl(5),mito(1),cyto(1),vacu(1),cyto_mito(1)	ERSKKER (188-194, prob:0.662)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH92	KLTH0E02376p	Low	8.3	1	163-182	GGPGCSKVFKPKRERTSHNV	plas(11),nucl(9.5),cyto_nucl(5.5),E.R.(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIE7	KLTH0E11924p	Low	5.8	1	239-258	LPDFKPKFPKWHPKDLQQVV	cyto(12.5),cyto_pero(10),pero(6.5),mito(4),nucl(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCH5	KLTH0B03124p	Low	8.9	1	857-876	EAMRNHYRRARKAIPSPIKF	nucl(15),mito_nucl(12.5),mito(8),cyto(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCM5	KLTH0B04312p	Low	9.1	1	17-36	EYDSRSSYRRDTRGPRRFDR	nucl(14.5),cyto_nucl(11),cyto(6.5),pero(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE22	KLTH0C05676p	Low	5	1	48-74	PRKPHLPCKVFRTHRHHDTRIEWRRRS	extr(17),golg(5),mito(2),E.R.(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEB4	KLTH0C07810p	Low	9	1	15-43	KQPHIFTNPKTKANRRTKRWYKNVGLGFK	nucl(10),cyto(8),mito(7)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEI5	KLTH0C09504p	Low	5	1	2-22	SSTYTLRQRRQQCAPNKGKAG	plas(24),pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF09	Trimethylguanosine synthase	Low	9.3	1	8-40	ELEHFVHLGKRKYRRERRALKKLFRTNEHRVEP	mito(11),cyto(10.5),cyto_nucl(8),nucl(4.5)	KRKYRRERRALKK (17-29, prob:0.888)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGB6	Phosphatidylethanolamine N-methyltransferase	Low	8	1	1-22	MIKERKPSKSRAPGKGHKQIPG	plas(21),E.R.(4)	ERKPSKSRAPGKGHK (4-18, prob:0.843)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ97	KLTH0F14674p	Low	5	1	795-816	RDLRNKTKLKAVRKQERQLSKG	plas(15),E.R.(8),mito(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJZ9	KLTH0F00660p	Low	9.9	1	7-26	APKNSIEHSRKRKSNASLKA	nucl(19.5),mito_nucl(13.5),mito(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLP7	KLTH0G02442p	Low	9.3	1	76-98	GRVNLLRYKKWQQSKPQRVSDAA	nucl(16),cyto_nucl(11),mito(6),cyto(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNQ0	KLTH0G18898p	Low	8.6	1	67-87	SQRSALIKCLHRRKAHKDVVL	nucl(13.5),mito_nucl(13),mito(11.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCF8	AP complex subunit beta	Low	9.9	1	20-43	QQTNIKKHRASATKRKDALRKIIA	nucl(20.5),cyto_nucl(15),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGX8	KLTH0D09130p	Low	8.8	1	329-354	FNSLKLKHTGKKLVNKFKFRRSSSGS	nucl(15),cyto_nucl(12),cyto(7),extr(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH27	KLTH0E00858p	Low	9.9	1	301-324	YVCPIPTVVIRRKLKRSKKKGFEE	cyto(12.5),cyto_nucl(10),nucl(6.5),mito(6)	RRKLKRSKKKG (311-321, prob:0.918)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHD0	KLTH0E03344p	Low	7.7	1	1-23	MRNQSKCHSLKIKKGRLNQTIID	mito(15),nucl(7),cyto(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK56	KLTH0F01936p	Low	9	1	79-100	FEAEKERERKTQTQKQKELELQ	nucl(14.5),cyto_nucl(11.5),cyto(7.5),pero(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLM6	Clathrin heavy chain	Low	7.8	1	135-155	GDTSRKPSKLTQRHANLNNAQ	cyto(13.5),cyto_nucl(13.5),nucl(10.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLN9	KLTH0G02266p	Low	5	1	493-512	NQYIKITRRRKPTPEDRLLG	plas(27)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN17	tRNA (guanine(26)-N(2))-dimethyltransferase	Low	9.7	1	69-88	QAKQEKSRGKGKKRGLEHGE	mito(16.5),mito_nucl(12),nucl(6.5),cyto(4)	EKSRGKGKKRGLEHGEEASKKRK (73-95, prob:0.961)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNH8	Calcium-transporting ATPase	Low	5	1	916-938	IADELRKLYYRKKRANDSYYYSA	plas(23),golg(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2G2	KLTH0H04686p	Low	9.3	1	672-694	AQTPPITPRPRTKQPSKPLVLTK	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2Q5	KLTH0H06864p	Low	9	1	44-64	ISQAKRPKHSGRAVRERERDV	nucl(15),cyto_nucl(10.5),mito(8),cyto(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E304	Uricase	Low	7.8	1	12-34	GKDNVKFLKVKKDKTNPKVHEIM	cyto(13),nucl(7),pero(3),mito(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E332	KLTH0H09900p	Low	9.4	1	301-324	APSDCWKVSKPVKNGKSKPSKVHA	nucl(18),cyto_nucl(12.833),cyto(5.5),cyto_mito(4.666)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E353	Mitochondrial import inner membrane translocase subunit TIM54	Low	7	1	56-76	IVYDKQQQKKIVKKWCKTVEP	cyto_nucl(8.833),cyto(8.5),nucl(8),mito_nucl(7.833),mito(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E367	KLTH0H10780p	Low	5	1	295-314	YMLICKFQIRQWRKSCQKKN	cyto(16.5),cyto_nucl(10.5),mito(5),plas(2),extr(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCM9	KLTH0B04400p	Low	6.4	1	385-414	NQRRRVLGKFKDFKKYKKINNRPYSELPTH	plas(11),nucl(4),cyto(3.5),E.R.(3),cyto_mito(3),pero(2),golg(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE33	KLTH0C05918p	Low	9.7	1	2-32	AASLPHPKIVKKHTKKFKRHHSDRYKRVSEN	mito(15.5),mito_nucl(11.5),nucl(6.5),cyto(5)	KIVKKHTKKFKRHHSDRYKRVSENWRKQKG (9-38, prob:0.941)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHL7	KLTH0E05390p	Low	5	1	315-334	LISEQLKKEKARRMQRFSVF	mito(11),plas(11),extr(2),E.R.(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHX3	KLTH0E07854p	Low	7.1	1	7-42	LASGVIKKKRSKVSRACNNCRRRKIKCTGANPCLNC	plas(18),nucl(6),mito(1),cyto(1),golg(1),cyto_mito(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI02	KLTH0E08602p	Low	6.6	1	377-399	TEDSFSKYTRRRRWIRTAELLRG	plas(18),nucl(4.5),cyto_nucl(3.5),cyto(1.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKR1	KLTH0F06776p	Low	8.7	1	576-595	EEESRRTSRRSQRRMAPLGE	nucl(13.5),cyto_nucl(12.5),cyto(8.5),mito(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKY3	KLTH0F08470p	Low	9.9	1	5-24	GRNKIPCKYFQQGRCKKGNS	nucl(17.5),cyto_nucl(11.5),mito(7)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNB6	KLTH0G15664p	Low	8	1	251-279	GVLTRDYRHVERKKPGKKKARKMPTWVKR	mito(23),cyto(3)	VERKKPGKKKARKMPTWVKR (260-279, prob:0.993)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2Q0	Genetic interactor of prohibitin 7, mitochondrial	Low	8.2	1	23-43	SQSRSPPRSLLQRQAKRRGEA	mito(10),nucl(9),plas(4),cyto(1),pero(1),E.R.(1),golg(1),cyto_pero(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E337	KLTH0H10032p	Low	9.1	1	458-498	ISSISAKRKQQQQQQQQQQQQQHFFRQQRQQQRQPPPAPND	mito(12),nucl(11),cyto(1),plas(1),extr(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDH9	KLTH0C01122p	Low	9.4	1	27-46	VERSLQMQKHKEKKEIKLLL	nucl(16.5),cyto_nucl(13.5),cyto(7.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDX5	KLTH0C04554p	Low	8.8	1	212-231	VYEGHYRKCKRREDLEEWFL	nucl(13),cyto_nucl(9.5),mito(6),cyto(4),cysk(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE43	KLTH0C06138p	Low	7.1	1	1-24	MKSFANKSKSRRPKFLFNLKINEL	mito(12),mito_nucl(11.999),nucl(9.5),cyto_nucl(8.166),cyto(3.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG95	KLTH0D03454p	Low	9.1	1	1097-1116	SDARRNSKTRSLGRKNTKMW	nucl(20.5),cyto_nucl(12.833),mito_nucl(12.666),mito(3.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGF7	KLTH0D04950p	Low	9	1	606-626	MRQQHRKSLLHTKKQHQREND	nucl(16),cyto_nucl(14),cyto(10)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHP2	KLTH0E05940p	Low	5	1	428-449	LGFILWYRRRRRNEEDFEKRYN	extr(22),mito(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKA8	KLTH0F03102p	Low	7	1	28-47	KGVRVPKRTKFELYRNKKSA	cyto(12),cyto_nucl(10.5),nucl(7),mito(4),plas(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLF1	KLTH0F12562p	Low	9.7	1	2-22	VELRRSTRKKSSDAPKRAPEE	nucl(22),cyto_nucl(13.333),mito_nucl(11.833)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E214	KLTH0H01364p	Low	9.1	1	63-97	ADSVMRKRRLKMKKHKLRKRRKRQKAEKRKQSQGK	mito(21),mito_nucl(13.833),cyto_mito(11.333),nucl(5.5)	RKRRLKMKKHKLRKRRKRQKAEKRKQSQGK (68-97, prob:1)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E317	tRNA ligase	Low	8.4	1	19-44	ATLLPKRGRSYKHKCQIKNTNKEVFS	cyto_nucl(13.5),nucl(13),cyto(12)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3T1	KLTH0H16082p	Low	8.9	1	1-20	MKIVKQSRVTRKFKGPRGLD	nucl(14),cyto_nucl(10),mito(8),cyto(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBW7	KLTH0A05918p	Low	9.7	1	143-162	DLNRKQQLLKRKPAQNGEKE	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBX3	Biotin carboxylase	Low	8.8	2	437-456, 2112-2132	FSSKDSKQIQRKPTPKGHCT, WPEARRFFFWRLRRRLNEEYL	cyto(15),cyto_nucl(12),nucl(7),pero(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDQ7	KLTH0C02970p	Low	5	1	444-463	RDEPDPAQRRQRPPPPAPGK	plas(23),mito(1),cyto(1),E.R.(1),vacu(1),cyto_mito(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDR9	KLTH0C03278p	Low	5.4	1	10-37	DSVGSTPHRKQNHPNKRKPFSKMQLLGS	extr(16),golg(3),vacu(3),plas(2),nucl(1),cyto(1),cyto_nucl(1),E.R.(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEV8	KLTH0D10164p	Low	8.4	1	441-469	GDLERDEKSKQRFKNKTKKQAPTKTIGNV	nucl(14),cyto_nucl(13.333),cyto(8.5),cyto_mito(5.832)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFK6	KLTH0D15884p	Low	7.8	1	374-393	GPLSTRQSPRRPYKERGGTL	nucl(10.5),cyto_nucl(10),cyto(6.5),mito(4),pero(2),plas(1),extr(1),E.R.(1),cysk(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHQ5	KLTH0E06226p	Low	8.8	1	643-662	GINYKKKLDEYKKRGNYPTF	nucl(12),cyto(8.5),cyto_mito(6),extr(3),mito(2.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJV7	KLTH0F19470p	Low	9.1	1	36-62	EDDEEKPAPKPKSRRPKETPFTQQRIA	plas(12),nucl(3),cyto(3),cyto_nucl(3),golg(3),mito(2),vacu(2)	APKPKSRRPK (43-52, prob:0.754)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJV9	tRNA wybutosine-synthesizing protein 4	Low	9	1	15-34	LTPRQARQAEKLERRKKYAD	nucl(13.5),cyto_nucl(10),cyto(5.5),pero(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKM6	KLTH0F05940p	Low	9.6	1	37-61	QGLARKNKGGSRPWKHRRNIAVIVC	plas(18),nucl(4),vacu(3)	RKNKGGSRPWKHR (41-53, prob:0.739)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNB8	KLTH0G15708p	Low	8.7	1	1-20	MMRGWRRAPRRISRGKAFGE	mito(22),nucl(2),cyto(2),cyto_nucl(2)	RAPRRI (7-12, prob:0.644)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNR9	KLTH0G19316p	Low	9.5	1	426-453	YVNTGLQKARRTRKTRWTKYWQYKAGVP	nucl(17.5),cyto_nucl(12.5),cyto(4.5),mito(2),pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2B2	KLTH0H03542p	Low	6.4	1	63-88	LSKGKELLRGPKKNKQTSKSEVRSSF	cyto(12.5),cyto_nucl(9),mito(5),nucl(4.5),extr(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2D1	KLTH0H03960p	Low	7.8	2	43-63, 534-555	LVSTIKKSPANRNKKDEPSSQ, IDKKTKSWAKAVPKIVRNNKTL	mito(22.5),cyto_mito(12),nucl(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DB90	DNA-directed RNA polymerase III subunit RPC3	Low	9.9	1	211-231	LSDLKKRTEAKQKAKKQFYQL	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBS1	KLTH0A04906p	Low	7.7	1	39-62	HEVLRKSRSQLKRIEERRRLDLKN	mito(14.5),cyto_mito(9.5),nucl(9)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD57	KLTH0B08470p	Low	6.6	1	397-419	SGSALPQQHKKEQQKPKPLGASA	cysk(15),cyto(6.5),cyto_nucl(6.5),nucl(5.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDY0	Altered inheritance of mitochondria protein 39, mitochondrial	Low	7.7	1	69-88	EASIKNQRRRRGKQVSSALA	mito(19),nucl(7)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE39	Serine/threonine-protein kinase Tel1	Low	9.9	2	17-37, 404-424	FSFPSRQYPSLKQNRRHVTLF, QMVRTYFTKRGKQKPEESLLF	nucl(10),cyto_nucl(10),cyto(8),mito(3),E.R.(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGD2	KLTH0D04356p	Low	9.9	1	439-469	FDGWHEFEAKRHRRKEREEQKRREKSESQGS	mito(15),mito_nucl(12.333),cyto_mito(9.333),nucl(8.5)	KRHRRKEREEQKRREK (448-463, prob:0.934)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGG6	ATPase synthesis protein 25, mitochondrial	Low	6.2	1	11-30	QSDKNTKHTRVRNMLLRRAA	mito(15.5),cyto_mito(11.333),cyto_nucl(6.333),cyto(6),nucl(5.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DID5	KLTH0E11660p	Low	8.6	1	201-220	AEWILVRLRRNKANKPPQYK	nucl(12.5),cyto_nucl(9.5),mito(7),cyto(5.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIR3	KLTH0E14542p	Low	7.5	1	47-70	EDIRSRSLFKRRKNETQQERMVRG	nucl(8),cyto(8),cyto_nucl(8),cysk(8)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIS1	KLTH0E14718p	Low	5	1	25-46	EYAPRFKHVSKKQKGRVPVRVG	mito(22),cyto(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJR8	KLTH0F18590p	Low	8	1	186-208	GKATLKQSKAGAKQKKKKKCVLL	cyto(20.5),cyto_nucl(12),mito(4)	KQSKAGAKQKKKKK (191-204, prob:0.907)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL13	KLTH0F09130p	Low	9	1	20-42	QQDRSNARRRPHHSNYVRPRTRG	nucl(20.5),cyto_nucl(14.833),mito_nucl(11.332),cyto(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3G3	KLTH0H13310p	Low	5	1	560-584	SVSSTHYRPAYKKRLPRQNMPPASM	extr(11),plas(8),E.R.(6)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBG1	KLTH0A02332p	Low	5	1	243-266	CTDCDKSCPKLKPLRRNHCKVAGL	plas(14),E.R.(8),mito(2),extr(1),golg(1),vacu(1),cyto_mito(1),mito_nucl(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCR9	KLTH0B05302p	Low	7.5	1	81-101	LDNKSIKRSNRGNRTIKNSLP	mito(13.5),mito_nucl(12),nucl(9.5),cyto(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGG3	KLTH0D05104p	Low	9.9	1	364-393	RNEQLAKFDKKKTKATKVSKKRANNGTDIS	mito(10),cyto_nucl(9),cyto(8.5),nucl(6.5)	DKKKTKATKVSKKR (372-385, prob:0.847)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGY0	Phosphoinositide 5-phosphatase	Low	7.1	1	1084-1107	APINKPSRIPPPRPAKKPTLDNLN	extr(7),nucl(6.5),cyto_nucl(6),cyto(4.5),mito(4),E.R.(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHJ9	Tethering factor for nuclear proteasome STS1	Low	9.7	1	23-42	ISTCKVTKPRVKRRFAGEEA	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(1),plas(1),pero(1),cysk(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHS6	KLTH0E06776p	Low	8.1	1	1094-1122	YEGKRETKYDSKTRPGRKPTQNRGLEGRY	nucl(10.5),cyto_nucl(10),cyto(8.5),mito(3),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMF7	KLTH0G08514p	Low	5	1	778-803	INNAEVKTPERKRSLKRLVSLPNKSG	extr(26)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2B3	KLTH0H03564p	Low	8	1	678-700	LAEKLKRKLSFKRTKSTKSTSSR	plas(19),E.R.(4),mito(3)	KRKLSFKRTKST (683-694, prob:0.697)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC07	KLTH0A06864p	Low	8	1	89-110	LRGPSSSKLKKIKEKRFKIALS	cyto(14),cyto_mito(10.833),cyto_nucl(8.333),mito(6.5),extr(4)	SKLKKIKEKRF (95-105, prob:0.791)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCH1	KLTH0B03014p	Low	5	1	224-243	SNPHLLKTYKNRKKDQNFLF	E.R.(8),extr(6),cyto(3),plas(3),mito(2),cyto_nucl(2),pero(2),golg(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDI9	KLTH0C01342p	Low	8.8	1	214-240	QYVAPKKESKKETKKETKKPAAEKPKA	cyto(11.5),cyto_mito(9.833),cyto_nucl(8.166),mito(6),E.R.(5),nucl(3.5)	PKKESKKETKKETKKPAAEKPKAAAEAEKPAEQPKKPKH (218-256, prob:0.991)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG22	KLTH0D01804p	Low	8.8	1	25-54	PLLSQKRLACSNCRRRRKKCDMGYPCASCV	nucl(12.5),cyto_nucl(9),cyto(4.5),plas(3),pero(2),golg(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIT4	KLTH0E15026p	Low	5.8	1	1053-1072	LECSKSKPLLKKKPASCQSE	plas(12),E.R.(7),pero(3),nucl(2),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKD4	Elongation of fatty acids protein	Low	8	1	295-318	YIEVYKRRGTKKSRIVKRVRGGVA	plas(22),E.R.(3)	KRRGTKKSRIVKRVR (300-314, prob:0.82)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKG7	Protein LST4	Low	7.7	1	97-117	FGSPVRAKTRHKCDKFRVVAG	nucl(8.5),mito(8),cyto_nucl(7.5),cyto(5.5),pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNP2	KLTH0G18722p	Low	6.6	1	4-27	FNSFKGFTRSSKKTKNQNVGTTAN	mito(15.5),mito_nucl(11.833),nucl(7),cyto_nucl(5.833),cyto(3.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGV4	KLTH0D08580p	Low	9.9	1	399-418	AKSWNSQNRRKSKTRSQLLE	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH91	KLTH0E02354p	Low	5.3	1	246-267	ASSLDKKFQKVKRVERAQNGLI	E.R.(10),golg(5),plas(4),mito(2),extr(2),vacu(1),pero(1),cyto_nucl(1),cyto(1),nucl(1),cyto_pero(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ66	KLTH0F13904p	Low	5	1	45-74	GSDGNNKRNSDKRDNDKRDKKDPKDEDFKS	mito(12),cyto(6),extr(5),E.R.(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ77	KLTH0F14146p	Low	9.4	1	174-196	RDGGRSIRKDGRKHRCFPHEVRF	nucl(12),cyto(7),cysk(4),cyto_mito(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK20	KLTH0F01122p	Low	5	1	304-329	TSQFIVPNPTHKRKQKHHKVAAATSI	cyto_mito(8.832),mito(8.5),cyto(8.5),cyto_nucl(8.333),mito_nucl(7.499)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E273	KLTH0H02662p	Low	6	1	2-26	SANSWRQWLKLTKRQLKQIRQTLDD	mito(20),nucl(3),cyto(2),pero(2),cyto_pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2A9	KLTH0H03476p	Low	9.2	1	344-363	DSYGSKKDKKDKKSSSYGNS	nucl(17),cyto_nucl(12.833),cyto(6.5),cyto_pero(4.166)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBT4	Threonyl-tRNA synthetase	Low	7.4	1	22-44	KDNKSSEKGNGKSKNKQDSKQSS	cyto(9.5),cyto_nucl(9.5),nucl(8.5),mito(4),pero(2),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDW5	KLTH0C04334p	Low	5	1	268-289	ISDYVPQKKRPQHRLKFLIGKK	plas(17),E.R.(6),mito(1),extr(1),golg(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF53	KLTH0D12298p	Low	6.2	1	376-402	QLNDKELTKLRKERKWKDLYHKCDPKD	mito(5),extr(5),E.R.(5),nucl(3.5),cyto_nucl(3.5),pero(3),golg(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ36	KLTH0F13178p	Low	7.7	1	62-87	KTSPGLSSFKKKPNKAFKDHIKPLLQ	nucl(8.5),plas(6),cyto_nucl(6),E.R.(3),golg(3),cyto(2.5),mito(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJM9	KLTH0F17732p	Low	8.4	1	87-107	GSANKDKSHHHVQKKDRYFTD	nucl(16),mito_nucl(12.833),cyto_nucl(9.333),mito(8.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL61	KLTH0F10274p	Low	5	1	604-625	LIFVRYMKKRFKGERMHHAAEF	plas(22),extr(2),E.R.(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMG6	KLTH0G08756p	Low	9.8	1	421-442	RDSYRKRQARGQSASSKRRKYA	nucl(19.5),cyto_nucl(14),cyto(7.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMX1	Anaphase-promoting complex subunit 2	Low	9.7	1	570-589	INNYKKAYTNVKKGRKLRLH	nucl(17.5),cyto_nucl(12.5),cyto(4.5),cysk(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E246	KLTH0H02068p	Low	6	1	347-367	ISDAKKLKKEQVAKQKKSLSK	cyto(15.5),cyto_nucl(10),nucl(3.5),mito(2),E.R.(2),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E351	KLTH0H10428p	Low	8.9	1	228-251	ADPSRKISKKPKVRSFLRMRPKNK	plas(7),E.R.(7),pero(3),golg(3),nucl(2.5),mito_nucl(2.5),cyto_pero(2.5)	RKISKKPKVRSFLRMRPKNKV (232-252, prob:0.901)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDG8	KLTH0C00880p	Low	9.7	1	131-150	AEKPCDHCRRRQIKCVIAPD	nucl(18.5),cyto_nucl(14),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGH5	KLTH0D05368p	Low	6.5	1	563-582	VYSLKRPMKSIKHLNAHKDG	cyto(10),cyto_nucl(9.666),cyto_mito(7.499),nucl(7),cyto_pero(6.499),extr(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIY9	KLTH0E16258p	Low	8	1	683-708	GMKQDPMYKKVPKKVKQAMSNVVFRN	extr(15),E.R.(3),cyto(2.5),cyto_nucl(2),golg(2),vacu(2)	AKKKGAEASKLAKEKGK (499-515, prob:0.816)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ25	KLTH0F12914p	Low	5	1	69-88	RNPPTFLKRRKIPFKIHLLS	plas(17),E.R.(6),mito(2),golg(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL02	KLTH0F08888p	Low	6.9	1	10-30	SSLVSRFHRKVKSRGDQSLNE	mito(18),nucl(5),cyto(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNP0	KLTH0G18678p	Low	8	1	74-95	KYLKYLTKKYLKKNQLRDWIRF	nucl(11),cyto_nucl(10.5),cyto(8),mito(7)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E1X1	Autophagy-related protein 2	Low	7.9	1	1096-1116	FVKGSSKKTRLRPSRDFKVRI	nucl(13),mito_nucl(10.499),cyto_nucl(10.333),mito(6.5),cyto(4.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBL1	KLTH0A03498p	Low	9.9	1	10-56	IIDNDAAVRRRRRKIIKSCTFCRQRKLKCDHKRPKCGSCLARKLPEC	plas(19),nucl(5),mito(2)	RRRRK (19-23, prob:0.654)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCB1	KLTH0B01606p	Low	5	1	11-31	ETRRCFSNTRNVYKKLNKYSY	mito(20.5),cyto_mito(13),cyto(4.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGB4	KLTH0D03938p	Low	8.1	1	27-47	VSDAKTRYNYAKRSRFRHACA	nucl(14),cyto_nucl(10.833),mito(7.5),cyto_mito(7.166),cyto(5.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGD4	54S ribosomal protein L31, mitochondrial	Low	8.2	2	15-41, 109-131	LLWKIPWRMSRPQKQRQRHRLQDVDSV, YRKGIHKLPKWTKITQRRNPAFF	mito(20.5),mito_nucl(13.333),nucl(5),cyto_nucl(3.333)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIJ7	Elongator complex protein 3	Low	8	2	1-24, 46-69	MARRGPKTNKQKLAPEKERFIQCC, NGLITKFSKKYKLKQQPRLTDIIN	mito(21),nucl(3),cyto(3),cyto_nucl(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKW3	KLTH0F08030p	Low	5	1	1038-1063	EVYKYFKRCYFKNKGKARNPENDLES	plas(19),E.R.(4),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLA9	Autophagy-related protein 14	Low	6.1	1	71-95	LAMLRKTHLKRRTNKIRSKLQQLQE	mito(20),cyto_nucl(4),nucl(3.5),cyto(3.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN23	KLTH0G13552p	Low	8	1	35-60	NATSKLSKDQLKKREVRRFAQKKAAA	mito(27)	KKREVRRFAQKKAAARRP (46-63, prob:0.845)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2J0	KLTH0H05390p	Low	7.8	1	63-83	GPSAKNKEVKRPRLNPYLPRD	mito(15),nucl(8),cyto(2),pero(2),cyto_pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBG3	ATP-dependent DNA helicase CHL1	Low	9.6	1	129-148	YLSEDSPKVKRKRNLPHTTV	nucl(17.5),cyto_nucl(13),cyto(5.5),mito(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEC7	KLTH0C08118p	Low	5	1	615-638	IEHTDNHKIKKKCYKDQVLPHGAG	plas(18),E.R.(5),mito(1),extr(1),pero(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DES8	KLTH0C11858p	Low	7	2	3-22, 32-55	ITKLARCKSLKQLRLCSFKD, SNLNPPIKATHPRRKEFRKASVLT	mito(18),cyto_mito(12.833),mito_nucl(11.499),cyto(4.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFE0	KLTH0D14344p	Low	8.4	1	4-26	LCLQRLQEERKKWRKDHPFGFFA	nucl(12.5),cyto_nucl(11.5),cyto(9.5),mito(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK25	KLTH0F01232p	Low	9.1	1	1-24	MLRNCTRKPAKRLKVDTGRQKSVM	nucl(15.5),mito_nucl(13),mito(9.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL81	KLTH0F10758p	Low	9.8	2	19-40, 244-272	SSSTPPSEPKRRQASRARDDIL, IVMGRPGNRITRRKRCRATVGNNHKTSKE	mito(13),nucl(9.5),cyto_nucl(8),cyto(3.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3B2	KLTH0H11902p	Low	9.4	1	1005-1040	ISSGTKKKKLSSAELRKKKKERMKKKKEMGDAYVSS	cyto(20.5),cyto_nucl(13.5),nucl(5.5)	GTKKKKLSSAELRKKKKERMKKKK (1008-1031, prob:0.998)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3D7	KLTH0H12540p	Low	9.5	1	63-87	LLAVPKKKVSHQKKRQKLYGPGRKQ	mito(23),nucl(4)	KKKVSHQKKRQKL (68-80, prob:0.788)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBU7	KLTH0A05478p	Low	8.7	1	18-42	LEERRLHENKTRKKYWLKWGPYLSE	cyto(12),nucl(10),mito(2),pero(1),golg(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGJ9	KLTH0D05940p	Low	5	1	1-21	MAKKVVKRLRVADKKARSETF	mito(17),pero(5),cyto(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGN6	KLTH0D06776p	Low	8	1	35-58	RIDVAPKEAQKRKRARWTLLWSML	nucl(10.5),cyto_nucl(10),cyto(8.5),mito(3),plas(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKJ7	Oleate activated transcription factor 3	Low	7.8	1	3-45	QDRASDVPPAKKRRRPTVVCTNCKRRKSKCDRLKPVCGNCLRL	plas(18),nucl(7)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMT4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	Low	6.1	1	135-156	NAENCLKLRKRQPLPKRPNALT	cyto(14.5),cyto_nucl(10.833),cyto_mito(9.166),nucl(5),mito(2.5),extr(2),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN21	KLTH0G13508p	Low	5	1	2-21	FDKWQFKRLIKLPKHRGVVW	mito(11),cyto(7),extr(6),pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2W5	Apurinic-apyrimidinic endonuclease 2	Low	8.4	1	473-492	NAILRTSKTKNNPGKKFWAC	nucl(11),cyto(9.5),cyto_mito(7.5),mito(4.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3A5	KLTH0H11704p	Low	9.9	1	8-34	AGGSCLVCRRRKVKCDRTKPVCLACIK	nucl(17.5),cyto_nucl(12),mito(6)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBH3	KLTH0A02640p	Low	8.9	1	628-650	DEATEHHSRTRKRKQNPNFLNVL	nucl(15.5),cyto_nucl(11.333),cyto(6),cyto_mito(4.833),mito(2.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCE8	KLTH0B02464p	Low	7.5	1	91-115	VKWDSHFKLKNRKVVKKNKVLDIQA	nucl(11),cyto_nucl(9.833),mito(8.5),cyto_mito(8.166),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDZ6	KLTH0C05060p	Low	7	1	2-23	LSKSSSVRRIKTDKKRHSMVLT	mito(12.5),mito_nucl(11.666),nucl(9.5),cyto_nucl(8.333),cyto(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEH9	KLTH0C09372p	Low	5	1	564-589	GFNIKASKTLAKKRKQQLAAQKNSSG	plas(26)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH38	KLTH0E01100p	Low	9.4	1	958-991	DEFNPDSKKNRKVKFKVSKNNKRKKSHSSSSGQN	mito(7.5),plas(7),mito_nucl(6.833),nucl(5),cyto_nucl(3.833),E.R.(3),cyto(1.5)	KKNRKVKFKVSKNNKRKKS (965-983, prob:0.943)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHN7	KLTH0E05830p	Low	9.4	1	1683-1702	ESNYKKQRVSTDVNRKSRKD	nucl(16),cyto_nucl(11),cyto(4),pero(3),mito(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIN3	KLTH0E13860p	Low	5	1	527-546	CYEVIHRLKRKLKNKDESFL	plas(17),mito(4),vacu(3),E.R.(2),mito_nucl(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIZ8	KLTH0E16456p	Low	6.2	1	478-499	FQDLKLPTKKVTKKASKNTLGG	extr(12),cyto(5),vacu(4),nucl(3),mito(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ46	KLTH0F13420p	Low	7.2	1	211-233	DDVKNGKPLKPSQKERRAVLKNL	cyto_nucl(11),cyto(10),nucl(8),mito(7)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ75	KLTH0F14102p	Low	6.1	1	306-325	LTKLMRRLFRYIKANRRARL	mito(15),cyto_nucl(5.5),cyto(4.5),nucl(3.5),extr(2),pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLD1	KLTH0F11990p	Low	8.1	1	458-477	FVLRLPKRAKWDSKICHQTQ	nucl(10.5),mito_nucl(9.5),mito(7.5),cyto(6)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM12	KLTH0G05104p	Low	8.7	1	351-371	FQGASKTKKNNKVSPKKPEVA	nucl(14),cyto_nucl(11),cyto(6),mito(3),pero(1),E.R.(1),golg(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNR0	KLTH0G19118p	Low	7.6	1	1-30	MARRPARCYRYQKNKPYPKSRYNRAVPDSK	mito_nucl(10),nucl(9.5),mito(9.5),cyto(8)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNR5	KLTH0G19228p	Low	7.7	1	1-23	MAPATPPRSRNRRGKAVCPSSPR	mito(15),nucl(9),cyto_mito(9)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLA4	Signal recognition particle 54 kDa protein	Low	7.1	1	91-111	DGETEPFQPKKRKQNVIMFVG	cyto(12.5),cyto_nucl(10.5),nucl(7.5),mito(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMI2	MMS19 nucleotide excision repair protein	Low	8.9	1	989-1011	AVALDDKKRRVRKTCIDTRQAYF	nucl(15),cyto_nucl(12),cyto(7),mito(2),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMK6	Protein-tyrosine-phosphatase	Low	9.9	1	17-39	DGSTGPRSPRHVRNRNTKNLSLS	nucl(20.5),cyto_nucl(15),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E238	Coatomer subunit alpha	Low	5.8	1	280-299	WDLDKRTPVKQFKRENDRFW	mito(18),cyto_mito(12),cyto(4),nucl(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E396	KLTH0H11484p	Low	9.8	1	146-171	NPVGETPDRKPQRKQSLKREEHSKDE	nucl(19.5),cyto_nucl(14.5),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBD9	KLTH0A01804p	Low	6.1	1	308-331	HVKAYVPREQREKRKEKWYSFLFN	mito(18),mito_nucl(12.666),cyto_mito(11.166),nucl(6),cyto_nucl(5.166)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBI6	KLTH0A02926p	Low	7.6	1	6-30	YVAPSQRLYRARHKITRKDLWKSYT	mito(11),nucl(8.5),cyto_nucl(6.5),cyto(3.5),pero(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCJ2	KLTH0B03498p	Low	7	2	12-34, 486-508	GAYRPRLHKLRTRGKQIVRWSKS, RSQPASHHKCKNADHKRSFKSLW	plas(24),E.R.(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJN5	Thymidylate synthase	Low	8.3	1	20-39	TEQELKKQKLEKKNAEEQQY	nucl(12),cyto(12),cyto_nucl(12)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN95	KLTH0G15180p	Low	9	1	30-62	LLKDKKGRSRSCLLCQRRKRRCDHKMPSCTACL	nucl(14.5),cyto_nucl(11),cyto(6.5),mito(2),plas(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNH3	KLTH0G17028p	Low	6.5	1	937-959	THETYHCKRCKNGKQMVKSNAML	mito(18.5),mito_nucl(12.5),nucl(5.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2R8	KLTH0H07172p	Low	9.5	1	701-720	SYNNCLKKIRKAKQALSGAD	nucl(17),cyto_nucl(12),cyto(5),mito(2),cysk(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBL5	KLTH0A03586p	Low	9.3	1	329-354	ERNRIAASKCRQRKKIAQQQLQKDVS	nucl(14.5),cyto_nucl(9.5),mito(6),cyto(3.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCU3	KLTH0B05852p	Low	6.8	1	82-106	AFGWGNKTRKRVKRQEKILEERLQE	cyto(11),cyto_nucl(11),nucl(7),E.R.(3),pero(2),mito(1),extr(1),cysk(1),vacu(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD37	KLTH0B08008p	Low	7.2	1	166-187	HSKTSKFKFKHSRRWYKFWDGQ	cyto(9.5),nucl(7),cyto_pero(7),cysk(5),pero(3.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG56	Endonuclease III homolog	Low	9.9	1	327-348	ADQKLLQKVRNPKEERKSRGNV	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHC4	KLTH0E03146p	Low	5	1	464-485	MIFDNHRRNKRQGIKLTYKDVP	plas(25)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIX6	KLTH0E15950p	Low	5	1	282-301	MYLWAAKKNRRYGTKRAFLI	mito(7.5),cyto_mito(7.5),cyto(6.5),plas(6),E.R.(3),pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIY6	3-hydroxy-3-methylglutaryl coenzyme A synthase	Low	6.3	1	2-24	TEQNQLKKQKTVSQPPRPQNIGI	mito(10),cyto(8.5),cyto_nucl(8),nucl(4.5),pero(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJF2	KLTH0F15928p	Low	9.4	1	283-307	EKKQGQIIRERRKRQLREQQEREGM	nucl(19.5),cyto_nucl(14.333),cyto(6),cyto_pero(3.999)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL07	37S ribosomal protein S24, mitochondrial	Low	6.9	1	257-285	LDTRHTTARNLRRKTRGYKFPEEWKRPQD	mito(19),nucl(5.5),cyto_nucl(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLW1	KLTH0G03982p	Low	8	1	48-70	LFKEAKKRKVAERKPLDFRRTFK	mito(23),pero(2)	KEAKKRKVAERKPLDFRR (50-67, prob:0.905)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E255	KLTH0H02266p	Low	9.3	1	56-81	VYLKDCFQKVQQQKRLLKKSQQDIEA	nucl(16.5),cyto_nucl(13),cyto(8.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBS4	KLTH0A04972p	Low	9.4	1	580-604	LDMHSYKPQKIRKISASKKTLKSVW	nucl(15.5),cyto_nucl(10.5),mito(5),cyto(4.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBS9	KLTH0A05082p	Low	7.3	1	28-52	SKRTNGYKTKDKKLRAGLKRIDDQY	mito(8),cyto(8),cyto_mito(8),nucl(7)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGA2	KLTH0D03608p	Low	9.1	1	1540-1563	ISGKLRPYIKKTKAEKKIKIDEEM	nucl(11),mito(8),cyto_nucl(8)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHY3	Replication protein A subunit	Low	8.8	1	28-48	IYQCVRTRKNDPSNHANRKNL	nucl(14),cyto_nucl(13.5),cyto(9)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIF4	KLTH0E12100p	Low	5	1	369-392	PFLPLRLQKRRIQKRLNITKKALD	plas(23),E.R.(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJI6	Protein BIG1	Low	5.9	1	295-320	LQTIQLWRGKPKQPDKTKITTEKKLQ	E.R.(9),extr(5),cyto_nucl(3),pero(3),nucl(2.5),cyto(2.5),plas(2),golg(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK08	KLTH0F00858p	Low	7.9	1	32-63	PEKVSSWKVRLQQKNKQKRTSQTSKRERDTPA	cyto(12),nucl(8),cyto_pero(8)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLN1	KLTH0G02024p	Low	5	1	15-37	ETEGSKCCVERKPRAQHQVTWAE	plas(26)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN36	KLTH0G13838p	Low	7	2	1039-1058, 1134-1159	VFPLKDTTRKQKRDSSSKVL, PSPSGSSPSNLQRKKKKIDRGFIVLI	extr(19),E.R.(4),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNP3	DNA-directed RNA polymerase	Low	6.6	1	1187-1206	MKVTDLKKKLSQKLGRPFTL	mito(19),cyto_mito(11.5),nucl(6)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC87	KLTH0B01034p	Low	6.2	1	35-54	QRSANMPKSRRPTWKRYVVW	mito(8),plas(8),nucl(3),cyto(3),cyto_nucl(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHU5	Mitochondrial group I intron splicing factor CCM1	Low	9.6	1	21-45	VVIPASSKARRRRRDVGGIRKNVSV	mito(20.5),mito_nucl(14),nucl(6.5)	KARRRRRD (28-35, prob:0.802)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHZ2	KLTH0E08360p	Low	9.6	1	809-830	IEVRKFIPSLKKKRFHRPLFLI	nucl(16),cyto_nucl(10.5),cyto(3),plas(3),mito(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJG5	DNA-directed RNA polymerase subunit	Low	7.3	1	137-162	RMGILKKVVDQCKKQRRCLRCGSLNG	cyto_nucl(11.333),nucl(10.5),cyto(10),mito_nucl(8.666),mito(5.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJI3	KLTH0F16654p	Low	9.4	1	236-256	LTPSQRYRLRKEKNKTALQNS	nucl(16),cyto_nucl(12),cyto(6),mito(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKM7	KLTH0F05962p	Low	8.5	1	117-139	EVTRHTSQYIRRKERRNLNLNIQ	nucl(17),cyto_nucl(13.333),mito_nucl(9.833),cyto(8.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMP5	KLTH0G10582p	Low	5	1	95-120	GSQEPVEKQKHRRQKKVASRVDRYSC	plas(18),mito(4),E.R.(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNK2	1,3-beta-glucanosyltransferase	Low	9.1	1	356-384	REEHTRKQGSDPRRKKRRECPAISKTWKA	E.R.(10),golg(6),nucl(3),plas(3),extr(2),cyto_nucl(2),vacu(2)	AKPKGITREEHTRKQGSDPRRKKRR (349-373, prob:0.936)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNP6	KLTH0G18810p	Low	8	1	147-173	APASAPAKSKRQTKRDKNADKIRYKYK	mito(16),E.R.(4),extr(3),golg(2)	PAKSKRQTKRDKNADKIRYK (152-171, prob:0.816)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2K9	KLTH0H05808p	Low	8.6	1	98-122	AQTLYMSQTPRRRNNNNNNNGRRGQ	nucl(13.5),mito_nucl(13),mito(11.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E320	KLTH0H09614p	Low	9.7	1	3-30	EQITHKRPIRIKIDKDKRKQLQDFYKLR	nucl(18),cyto_nucl(12.5),cyto(5),mito(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD13	KLTH0B07480p	Low	5	1	278-300	ASSPTKFKYFKRIRRYQAPAAPP	plas(20),E.R.(3),mito(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHV7	Dolichyl-diphosphooligosaccharide--protein glycotransferase	Low	8	1	710-730	RGSSRGIKKRVAKKPLLDVRV	plas(19),E.R.(5),mito(2)	RGIKKRVAKK (714-723, prob:0.732)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIE1	KLTH0E11792p	Low	5	1	140-161	FVKAVRKIYRHRRRSTSHEHAS	plas(27)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK84	KLTH0F02552p	Low	5	1	3-23	NAKLRGKRVGRFLKRHFPCSR	plas(16),E.R.(6),mito(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN09	KLTH0G13244p	Low	8.8	1	308-329	FEEKLRIHKHAHKTHQRLKWVS	nucl(10),cyto(9),cysk(3),mito(2),pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E229	KLTH0H01694p	Low	9.2	1	412-435	QAIFEKYSERRHRRSSQVVARWIA	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E393	Glycogen [starch] synthase	Low	7.1	1	571-596	DYMESFVKKTRRQRINQRNRTERLCD	cyto(13.5),cyto_nucl(11),nucl(7.5),pero(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3T5	KLTH0H16170p	Low	9.6	1	1-39	MHNKQTKRNRRLHVCDACRIRKLKCDKAKPNCSRCAKHG	nucl(18),cyto_nucl(11.333),mito(5.5),cyto_mito(4.666)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDG5	KLTH0C00814p	Low	9.3	1	34-72	SDEMSSRTSKRRIKRSGLACVRCRRRHAKCSGEKPCSTC	nucl(14.5),cyto_nucl(10),plas(5),cyto(4.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEE7	KLTH0C08580p	Low	8.7	1	60-83	IFSQIMKKDEQKKKTKELLKPIIS	nucl(14.5),mito_nucl(13.5),mito(11.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEX8	KLTH0D10604p	Low	7.9	1	110-131	GSFSRWKTHRRRGKSIPQDQKE	nucl(8),plas(7),mito_nucl(7),mito(6)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG23	KLTH0D01826p	Low	6.5	1	1128-1151	YLTVDWPRWLRPQRFRPRQLAAAK	extr(6),nucl(5.5),mito(5.5),cyto_nucl(5.333),cyto_mito(5.333),cyto(4),E.R.(2),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGX9	KLTH0D09152p	Low	5	1	23-48	AYKYMLKDPSKKYKPFKAVTLPNRKW	mito(17.5),cyto_mito(12.333),cyto(6),cyto_nucl(4.833)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH83	KLTH0E02112p	Low	7.4	1	427-449	LDGSRGDYRRRRWIRQCTRIAEQ	cyto_nucl(9),nucl(8),cyto(8),mito(5),plas(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHX2	KLTH0E07832p	Low	5	1	434-455	LRDQAKCKKKYGEDWDKYCKEC	plas(18),E.R.(3),golg(3),mito(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIM6	KLTH0E13706p	Low	5	1	363-384	NDSLDCYTRRRMWKRRAFQCSH	plas(11),mito(9),E.R.(3),cyto(2),extr(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ69	SURF1-like protein	Low	5	1	36-58	VDWKPIKSSKTPNDEKHKKPFTR	mito(15.5),cyto_mito(8.5),plas(8)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJE0	NADPH:adrenodoxin oxidoreductase, mitochondrial	Low	6.6	1	281-306	MLPFDQRTKKNYKKHRPPEHGLNRQW	mito(16),nucl(5),cyto(5),cyto_nucl(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJL0	Fe-S cluster assembly protein DRE2	Low	9.6	1	243-268	ITVVTCGKTKTRRRKACKDCTCGLKE	cyto(18),cyto_nucl(13),nucl(6)	KP (166-167, prob:0.61)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMZ3	KLTH0G12870p	Low	7.7	1	159-180	NPTTCRFHVQRKKFNRETRQGE	mito(12.5),mito_nucl(12),nucl(10.5),cyto(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2Z4	KLTH0H09042p	Low	9.7	1	217-242	ATAKQAPGKPSTKRKTKKTKTSCVIL	cyto(12),cyto_nucl(10.833),mito_nucl(7.666),nucl(7.5),mito(6.5)	KQAPGKPSTKRKTKKT (220-235, prob:0.853)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF33	KLTH0D11858p	Low	7.7	1	65-84	STQSRVARLRQKFKNCVVTP	cyto_nucl(10),nucl(9.5),pero(8),cyto(7.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF95	KLTH0D13310p	Low	8	1	290-309	KAEREERMKRKAEQRAKKAN	mito(17.5),cyto_mito(10.5),plas(4),cyto(2.5)	EREERMKRKAEQRAKKAN (292-309, prob:0.895)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFR5	Mitochondrial genome maintenance protein MGM101	Low	8	1	235-261	EKFVEHVTTKKKRKIWLRKDREVEYPY	mito(23),cyto(2)	KKRKI (245-249, prob:0.696)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHD9	KLTH0E03586p	Low	8.9	1	606-630	PGMIHKPPSRSQNQRHRARKTAFSS	nucl(14.5),cyto_nucl(14),cyto(8.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMN9	Protein-lysine N-methyltransferase EFM6	Low	9.5	1	200-222	VLMSYRKRRKADRIFFKAIRKNF	cyto(16),cyto_nucl(12),nucl(6),pero(5)	RRK (207-209, prob:0.626)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNJ5	KLTH0G17556p	Low	5	1	20-39	LEPVKDRRRRRSSSLISHVE	plas(22),mito(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNL5	KLTH0G18106p	Low	9.2	1	1-24	MAVQKIIRKKPKAKVDPLAKQKII	mito(11.5),cyto_mito(7.833),plas(6),nucl(4.5),cyto_nucl(4.333),cyto(3)	RKKPKA (8-13, prob:0.684)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNT5	KLTH0G19690p	Low	5	1	486-506	YFDFGKQKSLRRKFKSPAELE	golg(10),mito(7),E.R.(3),vacu(3),cyto(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2C6	mRNA-capping enzyme subunit alpha	Low	9.9	1	400-419	MKSNWEKRQIEKKRGFQEVQ	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCH9	KLTH0B03212p	Low	5.7	1	764-787	LFYYRWCIRTPRKVRKRMEVVSEN	plas(17),E.R.(4),nucl(2),mito(2),mito_nucl(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDB0	KLTH0B09724p	Low	8	1	560-585	KAKQAEDDKKNRKDKKHNAHEVKTND	plas(18),E.R.(4),golg(3)	KNRKDK (569-574, prob:0.644)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFL7	ATP-dependent DNA helicase PIF1	Low	9.4	1	369-393	DSKILLKKVRRSKKHVKRWASIKAL	mito(17.5),mito_nucl(12.666),cyto_mito(11.333),nucl(6.5)	KKVRRSKKHVKR (375-386, prob:0.884)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGU6	KLTH0D08404p	Low	8.5	1	153-172	AKSQTQRQSQHQRQPPQQDY	nucl(13),cyto_nucl(11.5),cyto(8),mito(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHC3	KLTH0E03124p	Low	8.1	1	53-74	FSRLDVKKKHFARHLKNSNEGF	plas(11),nucl(9.5),cyto_nucl(6),mito(3),cyto(1.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHP9	GPI ethanolamine phosphate transferase 3	Low	5	1	22-41	EDKRLFKSRIQRFKTTHRLY	plas(24),pero(1),E.R.(1),golg(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIH2	KLTH0E12496p	Low	7.5	1	1432-1454	TTDGKNQRERWSKQKRPVVEQII	cyto(10.5),cyto_nucl(10.5),nucl(9.5),pero(3),mito(2),cysk(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLC2	KLTH0F11792p	Low	7.1	1	33-54	VHTSWKKGKCYQYKLQHNPTLD	cyto_nucl(9.333),nucl(9),cyto_mito(8.666),mito(8.5),cyto(7.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM17	Non-specific serine/threonine protein kinase	Low	9.4	2	36-57, 593-618	NYAIKVCSKKHIIRERKVKYVT, SSASRPTSATKSRPKQKINSSPRMVV	mito(9),cyto(7),nucl(6),plas(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM49	KLTH0G05984p	Low	9.1	1	157-176	EPTHQAKKRKVENGDARRLA	nucl(18),cyto_nucl(16.5),cyto(9)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDF7	KLTH0C00638p	Low	8.7	1	248-275	GKPTYVCSRCVKREQRRASRRKSGLCDN	nucl(14),cyto_nucl(12.5),cyto(9),E.R.(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEG5	KLTH0C08976p	Low	7	2	598-618, 665-685	DMMFDGKKAKKNHKNDPDYVP, SNKIDSTKSPKQSNKDMCKYI	golg(10),E.R.(6),extr(5),vacu(3),plas(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEM9	KLTH0C10560p	Low	5	1	496-515	MYEYHTFKKSKKMPSEKPFA	plas(26)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF04	KLTH0D11220p	Low	5	1	1-21	MKLTRRPQRPIKALKRAPYYL	golg(10),mito(7),E.R.(5),pero(2),plas(1),extr(1),vacu(1),cyto_pero(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHB4	KLTH0E02926p	Low	5	1	31-63	SLGFLKPSKRNPLVRKYTRTRRRYGPDQQSFRS	plas(20),E.R.(5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHY0	Calcium-transporting ATPase	Low	8	1	507-526	NPFHKPRKTLFPWSRNNRKE	plas(23),golg(2)	RKLATKERRRIVPK (781-794, prob:0.758)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHY4	KLTH0E08140p	Low	7.8	1	1-35	MKVIKRRRSIKSCKYCYEHKLKCNKQSPCNNCARL	nucl(10.5),cyto_nucl(9.333),plas(8),cyto(5),cyto_mito(4.999)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMJ4	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	Low	6.4	1	179-202	KTVYSQEKYLKRKKQKFAKFFTVE	cyto(12),cyto_nucl(10.666),cyto_mito(10.166),mito_nucl(8.166),nucl(8),mito(7)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMY5	KLTH0G12650p	Low	9.7	1	531-551	RGASWKDYFNRKKKARDLAGD	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(1),extr(1),E.R.(1),golg(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3H0	KLTH0H13508p	Low	8.3	1	117-136	ICTKCSRKPHSVRCIRGVRK	cyto_nucl(15),nucl(13),cyto(11)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DB87	KLTH0A00550p	Low	7	2	18-40, 365-385	VGSPLQKRCSNPRQNTGPKESQA, TKPSCTKSKFSKTSCTKKSKS	extr(19),mito(6)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBR7	40S ribosomal protein S24	Low	8	1	96-125	LAEKVEKASRQQRKQKKNRDKKVFGTGKRL	mito(19),cyto(7)	KASRQQRKQKKNRDKKVFGTGKRLAKKVARRN (102-133, prob:0.982)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBW8	Uridine kinase	Low	7.8	1	469-489	ALGTHHCKWARKRFVDSQYFG	cyto(10.5),cyto_nucl(10.5),nucl(9.5),mito(2),pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCE5	KLTH0B02398p	Low	5.8	1	49-70	ATNNFCKPNKRLEKPPRGERAL	mito(19),cyto(3),nucl(2),pero(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCI9	KLTH0B03432p	Low	5.7	1	34-53	VEAHFKKKDPRDTRSSNVRN	extr(11),E.R.(8),golg(3),nucl(2),cyto(2),cyto_nucl(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIU9	Pheromone-regulated membrane protein 10	Low	8.7	1	231-259	EDKVDHFKRFFRRRSSTRRRSSHDSRPSG	plas(22),nucl(2),cyto(1),golg(1),vacu(1),mito_nucl(1)	KATRPKMKNVKSVAKHANKLRRKQ (510-533, prob:0.849)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLH1	Glutamyl-tRNA synthetase	Low	5.8	1	169-188	QELKKASTSNKKKETHKANF	cyto(15),mito(3),pero(3),nucl(2),E.R.(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNA1	KLTH0G15312p	Low	8.6	1	542-563	TTTMSHKKPKPSKTTSGRQFSD	nucl(13.5),cyto_nucl(13),cyto(11.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3R4	KLTH0H15708p	Low	5	1	64-83	VSYKLYKEKNPSPQKPQSAT	mito(23.5),mito_nucl(13.333),cyto_nucl(2.333)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBV9	KLTH0A05742p	Low	8.7	1	27-60	GAAASHRHVHKKSKKSSQESKKTWRESRRIVFSL	plas(19),nucl(2),E.R.(2),mito(1),cyto_nucl(1),pero(1),golg(1),vacu(1)	EKRHGAAASHRHVHKKSKKSSQESKKTWR (23-51, prob:0.928)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBW5	ATP-dependent 6-phosphofructokinase	Low	5	1	16-39	KDKLREVRPKRANLAQRRSKSNFS	mito(11),cyto(8),E.R.(3),plas(2),extr(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC37	KLTH0A07524p	Low	6.8	1	15-38	SESLTTKSRKPPNTAFRQQRLKAW	plas(17),nucl(5),mito(3),cyto_nucl(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCX9	KLTH0B06688p	Low	8	1	89-111	IQRFKKRYSASLLKKKRRGGGKF	plas(10),extr(7),golg(3),mito(2),E.R.(2),vacu(2)	SASLLKKKRRGGGK (97-110, prob:0.899)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF17	KLTH0D11506p	Low	5	1	31-50	GLLLKRRYEVPKRRWRVWFF	plas(16),mito(5),E.R.(2),golg(2),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHF0	Non-specific serine/threonine protein kinase	Low	9.1	1	635-664	EEGSSERRKRKRGSRGKKKNKKVHEFSQTD	plas(10),E.R.(9),nucl(3),golg(2),extr(1),pero(1),vacu(1)	ERRKRKRGSRGKKKNKK (640-656, prob:0.997)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNF1	Trehalase	Low	5	1	37-56	EGESRGTNRHHKRTNSLDQF	extr(7),golg(7),E.R.(5),plas(4),vacu(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBV1	KLTH0A05566p	Low	9	1	152-171	NGTTHSSKKRSNKHNSQIDT	nucl(14.5),cyto_nucl(12.5),cyto(9.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCG0	KLTH0B02750p	Low	5	1	478-502	QLYIGYLCKKENKKRDREQEGQVTS	plas(22),E.R.(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDT8	ATPase expression protein 2, mitochondrial	Low	6.5	1	512-539	FEKHRNAYSARKQRRTEAAQKAQKRFDD	mito(19),nucl(4),cyto(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHZ9	SWR1-complex protein 4	Low	9.4	1	329-353	NSHIQNQVKKTKKQKQEMQIAVKRK	nucl(17),cyto_nucl(11.5),mito(6),cyto(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI24	KLTH0E09130p	Low	9.9	1	13-38	DDGYRDFRPRMPKRQRVPPVVQLCKE	nucl(17.5),cyto_nucl(12),cyto(3.5),pero(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIC6	Probable vacuolar protein sorting-associated protein 16 homolog	Low	9.9	1	715-740	IGYHPFFKYCLKQKRKKEAAVYVRMI	nucl(18.5),cyto_nucl(11),cyto(2.5),mito(1),plas(1),pero(1),E.R.(1),golg(1),cysk(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJB0	Actin-related protein 8	Low	9.6	1	46-69	SNPNASKVKKPDPHAKQQTKVPGH	nucl(19),cyto_nucl(14.5),cyto(8)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJG4	KLTH0F16214p	Low	8.3	1	59-78	LEKIKDNKEKIKNNRQLPYL	cyto_nucl(13),nucl(12.5),cyto(12.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL22	KLTH0F09350p	Low	8.8	1	1191-1214	GQDQKHLWLKKRTRPKQEAEVSLQ	nucl(13.5),cyto_nucl(10.5),cyto(6.5),pero(3),vacu(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLD5	KLTH0F12078p	Low	6.6	1	2-26	PHQLIPEVYKRRRKQLQDDLVNQVS	plas(15),nucl(4),mito(3),E.R.(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMA2	KLTH0G07172p	Low	8.4	1	347-370	ALSTKCSTRSSRPRNTTRAPPIRG	nucl(14.5),cyto_nucl(12.333),cyto(9),cyto_mito(6.333)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNA5	KLTH0G15422p	Low	8	1	206-231	LPDARKPRRRWTTRDRNLRRQIPKCG	cyto(7.5),plas(5),cyto_nucl(5),mito(4),pero(3),E.R.(3),golg(3)	KPRRR (211-215, prob:0.644)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC26	KLTH0A07282p	Low	8	1	702-725	SGDCKARIWKYTKKSEPKLREVKE	cyto_nucl(14.5),cyto(12.5),nucl(11.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC64	KLTH0B00352p	Low	9.2	1	1-46	MEHQHPIKIQKRNRPSFVCQECRRRKIKCDKKRPRCSRCVDTGLPC	plas(12),nucl(11),cyto(3)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCR2	KLTH0B05148p	Low	9.1	1	90-111	DAYRECKKQWLQARRRNRSQWE	nucl(16),cyto_nucl(14.5),cyto(9)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDI7	KLTH0C01298p	Low	9.1	1	11-37	ARIGSQLRFYRKRLKPRYNHVPQVSSL	nucl(14),mito(11),cyto_nucl(9)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDK8	Maintenance of telomere capping protein 6	Low	5	1	471-496	MLSWRRVPIQDNRKRWKRVINSHLGS	extr(21),E.R.(2),mito(1),plas(1),pero(1),golg(1)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE83	Aminoacyl-tRNA hydrolase	Low	5	1	40-59	KDILKRCKAKAKKEQEMQGS	cyto(17.5),cyto_mito(10.666),cyto_nucl(10.333),extr(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGC3	KLTH0D04136p	Low	9.7	1	250-271	TDRFTCGKCKEKKVSYYQLQTR	nucl(23.5),cyto_nucl(14.333),mito_nucl(12.666)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHN5	KLTH0E05786p	Low	9.4	1	44-72	IRKTPQACISCRRRKVKCNGCRPCSSCKT	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(4)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIK6	Translocation protein SEC62	Low	8.7	1	221-243	GESECYSYIKKMKRRKRKMNKKD	mito(11),plas(11),nucl(2),cyto(1),E.R.(1),vacu(1)	KKMKRRKRKMNKKD (230-243, prob:0.984)
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKC1	KLTH0F03388p	Low	7.5	1	111-131	TAETGKKSKKKTYTYSAVKLA	plas(13),nucl(7.5),cyto_nucl(5),mito(2),E.R.(2)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E277	Glycine cleavage system P protein	Low	5	1	204-227	LSFNTAKRKKSKFIVDKRLHPQTK	mito(23.5),cyto_mito(13.5)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E281	KLTH0H02838p	Low	8.3	1	16-37	LANMTRTYKKPKVNDNRTQLEH	nucl(12),mito(12),mito_nucl(12)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2U8	Required for respiratory growth protein 1, mitochondrial	Low	9	2	205-225, 313-335	GQIIRREKRKNQKNIDYWEKC, QQFFARKSDKMYQNRKKRFESLL	mito(17),mito_nucl(14.333),nucl(9.5),cyto_nucl(5.666)	
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2W7	KLTH0H08294p	Low	5	1	587-608	CVSGSKHKFRRRKEDAKCLVKE	extr(9),E.R.(7),plas(4),golg(4),vacu(3)