ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUF1	pH signal transduction protein PalA, putative	Low	8.9	1	570-589	RLENRRKRRIQVLKEKARAD	nucl(13.5),mito(9),cyto_nucl(9),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZM3	Bicyclomycin resistance protein, putative	Low	5	1	514-534	ITMWRGLKWRQERAQRRAINQ	plas(25)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3Q5	Dihydroorotase	Low	7.9	1	639-658	SPNGCRRRSRAIIRNLSQDF	cyto_nucl(12),nucl(11),cyto(11),cysk(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAF7	Ankyrin repeat-containing protein, putative	Low	8.2	1	1176-1200	SSESGLYNSRRRPRRREEDSEEDSD	nucl(11.5),cyto_nucl(11.5),cyto(10.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH52	Fungal_trans domain-containing protein	Low	7.9	1	283-304	DGIREWLRRRARQCRDPSRSSH	nucl(10),cyto_nucl(10),cyto(8),pero(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNU4	Uncharacterized protein	Low	9.2	1	445-469	ATSPKCPRAREARQRAIRRMREQSL	nucl(15),cyto_nucl(11),mito(5),cyto(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRI0	Kinesin family protein	Low	9.6	1	1691-1710	LEERMNAINRKKKKSTLNCF	nucl(16),cyto_nucl(10.5),mito(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUP4	Aureobasidin resistance protein Aur1	Low	8	1	26-57	TMPWRSFKLLMPHRMRRKLRSKLRSRVSPATS	plas(24),mito(2)	RMRRKLRSKLR (39-49, prob:0.762)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXZ4	MFS multidrug transporter, putative	Low	5	1	48-67	EKHVRRPSPSRSRRSSDTRT	plas(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAW4	Mst3-like protein kinase, putative	Low	9.8	1	528-548	AQNNPHLKSHRRRQSEQILGE	nucl(12),cyto(9),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB41	F-box domain protein	Low	9.7	1	802-825	SPLPIKASRKRKHLSQPAAFDRKL	nucl(16.5),cyto_nucl(11),cyto(4.5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGS0	EF hand domain protein	Low	8	1	1473-1504	SPVHQSPKLPPHKRTAPRRPPSKPSPRQLTYW	plas(25)	LPPHKRTAPRRPPSKP (1481-1496, prob:0.845)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ74	Ubiquitin-activating enzyme E1-like	Low	8.3	1	547-567	AREIDIPKRPKQKPPHDESTV	cyto_nucl(13.5),nucl(12.5),cyto(11.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRA5	MFS transporter, putative	Low	5	1	469-488	NSLKEKSLTTHTRRNKRISI	plas(25)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0Z1	5-oxo-L-prolinase, putative	Low	6	1	1264-1284	GHNLWIRKIPRKDKDGNEFIE	cyto(15.5),cyto_nucl(11),mito(5),nucl(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M175	Nucleotide binding protein, putative	Low	7	1	25-46	GTPPTFKSRRGLPQKRRIPDVA	mito(20),nucl(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M666	CDF zinc transporter (Msc2), putative	Low	5	1	14-34	FGHSRRPPRGHMRSGNWPQLP	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M893	Glutaminyl-tRNA synthetase, putative	Low	8.6	1	326-345	AECAKFKKPKAPVKACVRIH	cyto(12),nucl(9),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M956	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	2	3-32, 50-70	GVPSGKACDCCRKSKKKCDEKTPTCSRCIR, QQPFGTSKTKKKTNSSNTDSG	plas(14),nucl(6),mito(3),cyto(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCR5	Monoxygenase, putative	Low	5.8	1	434-455	DIMKDPKKVRLRFPKWVFRHDP	plas(11),cyto(7.5),cyto_nucl(5.5),E.R.(3),nucl(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCU3	Reverse transcriptase, putative	Low	9.8	1	43-67	LLQPTPKEEYKKRPRVCFYVNRGLD	nucl(12),pero(8),cyto(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEG6	Tryptophanyl-tRNA synthetase	Low	9.5	1	410-442	KQYMTPRKLEWKGNPNPKPKPKETAKKEKEEKK	cyto(19),nucl(4),pero(3)	EWKGNPNPKPKPKETAKKEKEEKK (419-442, prob:0.979)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU63	NACHT domain-containing protein	Low	9.7	1	205-228	TCEKCDKEQLVKRKPRETRTPYIH	nucl(18),cyto_nucl(13.5),cyto(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTY0	Uncharacterized protein	Low	8.3	1	458-480	AIHSAIRCKSPKRRNVFRFLHGL	nucl(11.5),mito(9),cyto_nucl(9),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZP9	Uncharacterized protein	Low	5	1	7-30	YQSIWSLRRPSRTRPRDKPMTVLC	mito(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6E2	Uncharacterized protein	Low	8	1	30-51	SLLLLRQRRRKLEKQSHLPLYK	nucl(8),cyto(7),mito(4),extr(3),pero(2),plas(1),E.R.(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7G0	Uncharacterized protein	Low	6.4	1	231-258	DASPRKPASERRKQQIRPAQRGHRQFDP	mito(9),plas(8),nucl(4),cyto(4),cyto_nucl(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAZ9	Uncharacterized protein	Low	8.9	1	8-28	NTSFLPRRPDQPKKKMSITQT	nucl(15.5),mito_nucl(13.5),mito(10.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME64	Molybdenum cofactor sulfurase	Low	9.1	1	627-656	ARFPPRSHARHSKNPYRHHHPNLSKRRNEM	nucl(15.5),cyto_nucl(13),cyto(9.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFK0	Integral membrane protein	Low	8	1	58-83	QPAISEKEPKKRERVSRRQPRIEYLW	plas(25)	KEPKKRERVSRRQPRI (64-79, prob:0.859)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH78	60S ribosomal protein L12	Low	9.9	1	82-105	IKALKEPPRDRKKEKNIKHSKSIP	cyto(17.5),cyto_nucl(14.833),nucl(9),mito_nucl(5.499)	KEPPRDRKKEKNIKH (86-100, prob:0.844)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJD8	MFS transporter, putative	Low	5	1	462-482	FLNKLQEKKRFRNGKPAKLVD	plas(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLR7	Kinesin light chain, putative	Low	8.8	1	358-379	MERSRRVIYGRRGRRRWKEAEE	mito(18),cyto(5.5),cyto_nucl(4.5),nucl(2.5)	GRRGRRR (367-373, prob:0.727)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNM2	Integrase_H2C2 domain-containing protein	Low	7.8	1	108-129	ASTVRKLRLKHGHRRPPNEDAS	cysk(11),nucl(9.5),cyto_nucl(8),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR97	DNA-directed RNA polymerase III subunit	Low	9.5	1	98-119	MPSYSARYQKRKRTVPKIAGRE	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUL6	Reverse transcriptase [C. elegans], putative	Low	7.8	1	43-67	LLQPTPKEEYKKRPRVCFYVNRGLD	nucl(9.5),pero(9),cyto_nucl(8.5),cyto(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY44	Uncharacterized protein	Low	6.9	1	60-81	TIADALSKRKRRQEWEDKIAAV	mito(18),nucl(5),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2U0	AMP binding domain protein, putative	Low	5.7	1	1752-1776	SQDSRVSHTSPPRRLRNDRGNLPSQ	plas(16),mito(6),nucl(2),cyto(2),cyto_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4G5	54S ribosomal protein L31, mitochondrial	Low	7	2	12-39, 77-100	LLWKIPWRLSSRQKFRQRKRLRAVDQVV, SIYDRKEKNYRKGIHKLPKWTRVS	mito(24.5),cyto_mito(13)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8U2	Triosephosphate isomerase	Low	8	1	53-82	EDRTYTNQAENPRRKKKRKKERMATTVSYP	mito(14),cyto(9),extr(2)	PRRKKKRKKER (64-74, prob:0.982)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG40	Aspergillopepsin-2, putative	Low	5	1	29-52	RESNRVARRARSHKQTHTNQRIDT	extr(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHN8	Pentatricopeptide repeat protein	Low	9.1	1	751-778	DKNHPPGTSRRSRVRARRRLSTTPQSKE	mito(19),cyto(5),nucl(3)	RSRVRARR (761-768, prob:0.642)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP41	Ankyrin repeat and socs box protein, putative	Low	5	1	410-430	IRDRLRTDRNLKRWRNHPKVQ	cyto(8),extr(8),E.R.(4),mito(3),pero(2),mito_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRU4	Uncharacterized protein	Low	9	1	5-28	KTAQGNAKENRPRKRNPMNLTVDT	nucl(13.5),cyto_nucl(9),plas(5),cyto(3.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MST8	Dimer_Tnp_hAT domain-containing protein	Low	9.5	1	604-628	ESALWWWSQEKQRKRWPRLSLMAID	nucl(17.5),cyto_nucl(12),cyto(5.5),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT93	Zinc knuckle domain protein	Low	8.3	1	616-644	DSPYFRQPVNPQRHQARQRRIRPSDYREL	nucl(14),cyto_nucl(13.333),cyto(8.5),cyto_mito(6.832)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYT0	Mitochondrial intermediate peptidase	Low	6.5	1	6-31	RSRPWTCKDCLQRLHRLQRSRPERTF	mito(20),nucl(4),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1T8	Tyrosine--tRNA ligase	Low	8	1	339-369	TLKAYPPPTVQKKVKKVKDKGSRYPGAKKET	cyto(23.5),cyto_nucl(12.5)	KKVKKVKDKGSRYPGA (350-365, prob:0.778)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBE9	CHY-type domain-containing protein	Low	8.2	1	41-61	MTFACKKCKKCFRKDTSEFEE	mito(14),nucl(8),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF57	Valyl-tRNA synthetase	Low	8.7	1	55-82	KVKTEKELERERRKAEKAKKFAEKQAKA	cyto(14.5),cyto_nucl(9),pero(8),nucl(2.5)	KVKTEKELERERRKAEKAKKFAEKQAKAAAAKPAQPKAEKKEK (55-97, prob:0.993)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLJ1	Histone acetyltransferase type B catalytic subunit	Low	9.8	1	314-334	NPNPYPKETGKRRPRNVPTSS	nucl(13),cyto(9),pero(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUU2	DEAD/DEAH box helicase, putative	Low	9.8	1	1183-1203	SPEWHKKLTKFEKWQKAREKQ	plas(13),nucl(5),E.R.(3),mito_nucl(3),cyto(2),vacu(2)	KFEKWQKAREKQVLLVKEPKSKYRRRA (1192-1218, prob:0.765)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYR3	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase	Low	9.9	1	72-96	ESFGRRAWLEKRRRDKKALEKVGKE	mito(10),nucl(6.5),cyto_nucl(6.5),cyto(5.5),pero(5)	RRAWLEKRRRDKKAL (76-90, prob:0.865)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M086	S-methyl-5'-thioadenosine phosphorylase	Low	8	1	635-659	HDKTGQAPIRKKKRRYPASPPMTAK	plas(22),E.R.(2),vacu(2)	IRKKKRRY (643-650, prob:0.851)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7C6	RNase H domain-containing protein	Low	7.9	1	280-299	KQKAGKPTKKLVTQPSKRTL	mito(10),nucl(9.5),cyto_nucl(8),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M970	Solute carrier family 40 protein	Low	8	1	415-444	QYIHIQRKGIDRKDRKSKIRIAENSPPPKP	plas(24),E.R.(3)	RKDRKSKI (426-433, prob:0.704)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCM7	Ferric reductase transmembrane component 5, putative	Low	5	1	577-604	VYSFIKRLPNDYKKQKQKTVDPNRHIAE	plas(18),E.R.(4),mito(2),extr(1),golg(1),vacu(1),cyto_mito(1),mito_nucl(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG07	DDE-1 domain-containing protein	Low	7.9	1	376-403	HDLRAAHEKEKQKRQRSKQQISHEQGIT	nucl(10.5),cyto_nucl(10.5),cyto(9.5),mito(3),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHR4	Na/K ATPase alpha 1 subunit, putative	Low	8	1	41-73	RDPVTRRPQTRGRSSRSRRRSQSRNSISRTRSH	plas(24),golg(2)	RGRSSRSRRR (51-60, prob:0.724)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLN6	Ubiquinone biosynthesis protein coq4, mitochondrial	Low	5.7	1	263-285	LREIRRMMRQQEKRAKEQQMKAS	mito(23),nucl(2),cyto(2),cyto_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLQ2	Zn(2)-C6 fungal-type domain-containing protein	Low	5	1	1-27	MTSTCWTCRLRRKKCDRVRPVCTTCSR	plas(18),mito(5),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNV9	3-oxoacyl-[acyl-carrier-protein] reductase	Low	5	1	1646-1665	QSYRNKVEARQKKAYRYFHN	cyto(13.5),cyto_nucl(7.5),cysk(6),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNW7	rRNA processing protein Bystin, putative	Low	9.5	1	24-50	SNGHLRTTSKSGKKRSRKNDDDDDAEN	mito(12),cyto(7.5),cyto_nucl(6.5),nucl(4.5)	KKR (36-38, prob:0.613)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTQ8	Cyclin dependent kinase inhibitor Pho81, putative	Low	8.2	1	19-38	FPRVTFKMKFGKQIQRRQLD	nucl(12.5),cyto_nucl(11.5),cyto(9.5),mito(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUU7	Uncharacterized protein	Low	5.7	1	77-106	RDNCITRRGWFKRRLEKKQYKKTQSSQNLS	extr(6),mito(5),plas(5),E.R.(5),nucl(2),vacu(1),golg(1),pero(1),cyto(1),cyto_pero(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYB1	Pyoverdine/dityrosine biosynthesis protein, putative	Low	9.1	1	293-312	VTKNCPGPKQYKKKVKLIAK	nucl(15),cyto_nucl(12),cyto(7),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBX6	Cation-transporting ATPase	Low	5.3	1	1288-1313	GRTISLIRPKQEKNRRQYKVLLERMR	plas(23),nucl(1),mito(1),cyto(1),cyto_nucl(1),vacu(1),cyto_mito(1),mito_nucl(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCA3	Uncharacterized protein	Low	5	1	289-310	AGLAWFWYRRKNPNKRNTASYQ	extr(23),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCD7	Cell wall glucanase, putative	Low	5	1	316-338	FLFCCIRQRRIGKREWNAQNNQW	extr(25)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGB9	Uncharacterized protein	Low	7.1	1	9-29	MAKGKKSTTSARRQQRPGPGA	mito(13),cyto_nucl(7.5),nucl(7),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGU0	Uncharacterized protein	Low	9.4	1	252-274	KYIDARKHKLRYTLKNRKLDKTL	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHU0	Uncharacterized protein	Low	7	2	89-108, 252-274	VFFFRRKKKLDEKIKRYEAI, SSSNNQTLKGPKKPKPALTRLIT	extr(20),mito(3),plas(2),mito_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLL5	Beta-1,6 glucan synthetase Kre6, putative	Low	6.9	1	93-113	LFPLPRKVRRSRGSPDRSKSP	plas(9),nucl(5),golg(4),cyto(3),mito(2),E.R.(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNK2	Uncharacterized protein	Low	7.3	1	491-510	CLVLCRKKGFPRFKERTEIF	cyto(11),cyto_nucl(10.833),nucl(9.5),cyto_pero(7.333),pero(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQC8	Ab-hydrolase associated lipase, putative	Low	5.7	1	13-36	TTTESKHSKVHKFAKQAQKLSRGG	mito(15),plas(3),nucl(2),cyto(2),cyto_nucl(2),pero(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV46	RNase H domain-containing protein	Low	5.8	1	401-426	EASQRFCSRGPKDPQQQNPRQRPTTG	mito(9),cyto(7.5),extr(6),cyto_nucl(5.5),nucl(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LSV3	Sensitive to high expression protein 9, mitochondrial	Low	5.7	1	54-74	RTQSRRFSSKQENEKPRPELQ	mito(17),plas(4),nucl(2),cyto(2),cyto_nucl(2),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT86	Uncharacterized protein	Low	9.8	1	77-102	ASVYERLCGRRWRQRPNEKYHPLWKL	nucl(19.5),cyto_nucl(14),cyto(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTU9	Uncharacterized protein	Low	6.7	1	15-38	TDSRDTSYSHKQHQQQRPDSPSFQ	cyto(8.5),cyto_nucl(7.5),plas(6),nucl(5.5),mito(3),golg(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV75	RNase H domain-containing protein	Low	5	1	165-190	VQGAHRRGRAYKCRKLRSNYRRVYLG	mito(10.5),cyto_mito(10.333),cyto(9),cyto_nucl(6.833),extr(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW81	C6 finger domain protein, putative	Low	9.2	1	1-29	MSRSFTGCKRCKARRQKCDEQHPECGRCK	mito(13),nucl(11),cyto(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX76	Uncharacterized protein	Low	8.2	1	407-429	YAIRHFLRPDHRKHRKIRFFIDE	nucl(14),cyto_nucl(11.833),mito_nucl(8.833),cyto(8.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M463	HTH CENPB-type domain-containing protein	Low	7.8	1	168-188	TSQKRVFSRRLYEKKFKQFLQ	nucl(10),mito(7),cyto_nucl(7),cyto(4),pero(4),cyto_pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5H8	C6 finger domain protein Acr-2, putative	Low	7.7	1	1-21	MTKGCYTCRRRRIVCDNGFPT	plas(16),nucl(7),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8P2	NACHT domain-containing protein	Low	8.7	1	756-780	RTLIQERQRRARKLKVAQSHNHFIE	nucl(13.5),cyto_nucl(11.5),cyto(8.5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD95	LCCL domain protein	Low	5	1	86-109	FSSFLRGPNPPRRHRIRPFFESFQ	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF68	Dipeptidyl-peptidase V	Low	8.1	1	80-104	GADVLEREQRKRKRGDQDQLRGAGI	nucl(12),cyto_nucl(11.5),cyto(9),plas(2),mito(1),pero(1),golg(1),cysk(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVR1	ArAE_2_N domain-containing protein	Low	5	1	978-1001	LRLGEPKDKAEKKRQEKEWFTQLG	plas(23),E.R.(2),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWW5	Zn(2)-C6 fungal-type domain-containing protein	Low	7	2	10-41, 61-82	ALVGRPCLTCQRRKIKCDRAKPDCHRCQKAGL, GEGANKVRLRRTKGKENVKSTI	mito(22),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYP7	VHS domain protein	Low	9.6	1	48-67	ASRALRKKLKYGNLHRQLRA	nucl(22.5),cyto_nucl(14.333),mito_nucl(12.166)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8J5	Serine/threonine-protein kinase TOR	Low	8.1	1	1990-2011	VLHVLQTKKRPRRMTLKGSDGN	nucl(11.5),cyto_nucl(10),cyto(7.5),pero(4),mito(1),plas(1),E.R.(1),cysk(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8V0	Asparagine-linked glycosylation protein 10	Low	8	1	462-491	ETQQKSSKREEKEAKKQQKKQASKSKSAST	plas(22),E.R.(4)	SKREEKEAKKQQKKQASKSKS (468-488, prob:0.873)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFM9	DNA-binding protein smubp-2, putative	Low	6.5	1	37-61	ITPEAPASKRQERRDAKRTYKESDY	cyto_nucl(5),golg(5),nucl(4.5),cyto(4.5),mito(4),plas(3),extr(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGR9	Uncharacterized protein	Low	9.5	1	937-956	LEPVKLKQKKSRSAAGKACN	nucl(13),mito(8),cyto_nucl(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN65	Uncharacterized protein	Low	5	1	1-22	MPPIRTRNKKSRGKSALPGFGF	mito(23.5),cyto_mito(14)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M171	Siderochrome-iron transporter, putative	Low	5	1	590-609	AVGMWKNYRVDKKQNKGTLF	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M308	Uncharacterized protein	Low	7.1	1	135-155	EGYSRRGRPYRSHSNCCGKCR	plas(8),nucl(6),mito(5),cyto(3),E.R.(2),vacu(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBR3	MBOAT_2 domain-containing protein	Low	5	1	140-161	NDTSKLRRRKTQQSPDVSRQPQ	plas(22),E.R.(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF55	Uncharacterized protein	Low	7	2	168-187, 538-557	TPSPKEQTPHPNPKKKPGLP, RLCCQFWRERSQSRRWWQRW	extr(7),mito(5),cyto(5),cyto_mito(5),plas(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHV3	F-box domain protein	Low	7.8	1	459-478	SSYRQQHHYPYYRHNHHQRD	cyto(8),nucl(7),E.R.(3),golg(3),extr(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNS9	C-4 methyl sterol oxidase Erg25, putative	Low	8	1	276-299	TEYTPESVKRWREKKAEKAAKKAN	plas(16),mito(4),pero(3),E.R.(3)	KRWREKKAEKAAKKAN (284-299, prob:0.903)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQL3	C6 transcription factor, putative	Low	8.2	1	48-75	GDSSRFRAPKDHHQHHHHHHQHHHPSLT	nucl(13),cyto_nucl(11.833),cyto(8.5),cyto_mito(5.666),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVA1	Mating type protein MAT1-2-1	Low	9.4	1	195-220	NYQYAPRKHCEKKRRNSRRTAENFVD	nucl(16.5),cyto_nucl(13.5),cyto(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU05	Uncharacterized protein	Low	9.2	1	464-488	GYIYWSRKRWSHRRRRDQELRKLAL	extr(11),cyto(4),nucl(3),golg(3),plas(2),mito_nucl(2)	KRWSHRRRR (471-479, prob:0.674)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV23	Reverse transcriptase, putative	Low	6.8	1	25-46	DGFWRIARWVRNRGKPRATFTP	mito(12),nucl(6),cyto_nucl(6),pero(5),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYV8	DSBA domain-containing protein	Low	6.8	1	416-435	QEIERETRRRQRRNSRGSVG	mito(9.5),cyto_mito(7.833),nucl(7.5),cyto_nucl(6.833),cyto(5),extr(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7E8	Mitochondrial zinc maintenance protein 1, mitochondrial	Low	8.8	1	11-37	VLSLYRKCLREVRKKPQNTRDNFRAFA	mito(14),nucl(10),cyto(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCR1	Uncharacterized protein (Fragment)	Low	8.5	1	93-113	TETIYRRKSRQERRQEAREAS	cyto_nucl(16.5),nucl(14),cyto(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIM9	Arginine transporter, putative	Low	5	1	54-73	SLPVPDLKRKLKSRHLQMIA	plas(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT57	Uncharacterized protein	Low	9.7	1	313-336	ELFFKPCALRNKKRALYNTRARLR	nucl(19.5),cyto_nucl(12.833),cyto(5),cyto_mito(4.333)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU93	Integrase catalytic domain-containing protein	Low	8.4	1	203-252	ALVTRGRRPNRRTSSRNLRNGGNNSNSNRRERSNRNSRNKRLICNWCKRE	nucl(13),cyto_nucl(12.5),cyto(10),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVL2	Uncharacterized protein	Low	9.2	1	1-21	MPKRKKKSSRSIIQARAKKEI	mito(15.5),mito_nucl(10.833),cyto_nucl(5.333),nucl(5),cyto(4.5)	KRKKKSSRSIIQARAK (3-18, prob:0.841)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY67	C6 finger domain protein, putative	Low	8.8	1	87-115	DQSARRKRSKVSRACDECRRKKVRCDATS	nucl(13),cyto_nucl(9.5),plas(8),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYE2	UV radiation resistance protein (UVRAG), putative	Low	9.8	1	95-116	QDDKRVKESRRMRRRSTLPWSG	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYT3	Uncharacterized protein	Low	7.5	1	362-386	GQGTLMSKQREKKKPLPSENRTAHA	nucl(8.5),cyto_nucl(8),mito(7),cyto(6.5),plas(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0L7	Zinc finger protein, putative	Low	8.7	1	60-79	ENYCKDCKRKFINENNLRMH	nucl(14),cyto_nucl(12),cyto(6),mito(3),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M467	Uncharacterized protein	Low	5	1	257-276	CLAVLREKRRREFERERLVN	plas(19),E.R.(3),vacu(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGE9	Zn(2)-C6 fungal-type domain-containing protein	Low	9	1	20-41	ACDACRTRKSRCDGRRPECGMC	nucl(12),mito(6),cyto(4),pero(4),cyto_pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHM5	116 kDa U5 small nuclear ribonucleoprotein component	Low	9.5	1	161-180	INERLEKRTGRKRDEQLRYT	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK45	Uncharacterized protein	Low	5	1	16-39	ASLLPRRPLPPQRHRLRQANQTVL	mito(23.5),cyto_mito(13)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPL3	NACHT and WD40 domain protein	Low	6.1	1	1-24	MKQSFDKLRRKLFHKDEPLPNARV	plas(20),nucl(3),mito(2),cyto_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUD9	Uncharacterized protein	Low	9.4	1	139-165	ALKREGWSKKTSKRKARQRNPELRDGY	mito(12.5),cyto_mito(8.5),nucl(5),cyto(3.5),plas(2),pero(1),E.R.(1),golg(1),vacu(1)	LKREGWSKKTSKRKARQR (140-157, prob:0.913)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUJ7	Endo/exonuclease/phosphatase domain-containing protein	Low	9	1	948-971	QDMGLLNKTRKKQRDPDLTTNHAY	nucl(14.5),cyto_nucl(11),cyto(6.5),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT63	Small nucleolar ribonucleoprotein complex subunit, putative	Low	7.3	1	208-228	NTELRNKRKSRRNSHGTNGSE	mito(17),nucl(6),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXZ1	Fatty acid hydroxylase domain-containing protein	Low	8.6	2	6-27, 266-288	SPSKDSMKSTWRRANRDQWTIT, DHDLHHRKGWRKSHNYGKQTRLW	cyto(9),cyto_nucl(8.333),cyto_pero(7.833),nucl(6.5),pero(5.5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYN0	Uncharacterized protein	Low	7.1	1	128-152	YIFVIRLRSRNKRHLERDSERHQKS	mito(12.5),cyto_mito(9.166),nucl(9),cyto_nucl(7.833),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M254	Serine/threonine-protein phosphatase 2A activator	Low	8.1	1	14-33	AELRASKTRRSPPTNQQDPT	cyto(10),nucl(8),mito(5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7R1	Uncharacterized protein	Low	7.3	1	46-67	NILSHVQQRRRQRAEKVIKSTL	nucl(7.5),cyto_nucl(7.5),cysk(7),cyto(6.5),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M827	MFS multidrug transporter, putative	Low	5	1	31-51	SKANNPSHPHNWPRHKRWAHV	plas(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME45	Ankyrin, putative	Low	8.2	1	1210-1232	AEEETQRKRHPNLFKENRWNESL	nucl(11.5),cyto_nucl(10),cyto(7.5),pero(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPB9	Zn(2)-C6 fungal-type domain-containing protein	Low	9.5	1	12-31	CDRCHAKKVRCVLNRHQSKC	nucl(15),mito(9),cyto_nucl(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQG8	Alcohol dehydrogenase, putative	Low	5	1	331-355	AEAKDAYRRLKEKKHFAKVLIRIDH	plas(18),cyto(4),E.R.(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSS0	Uncharacterized protein	Low	5	1	390-414	LLEAIDKRRDKKYRRPVPGQSLDVS	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTD1	Uncharacterized protein	Low	8.6	1	16-35	KTKPTLKATKTKKADTYKKT	nucl(18),cyto_nucl(11.833),mito_nucl(11.833),mito(4.5),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWF6	Histone deacetylase SIR2, putative	Low	7.7	1	331-350	QALKRKRSSNGLQNNRKKGS	cyto_nucl(15.5),cyto(14),nucl(11)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYW4	Uncharacterized protein	Low	6.4	1	45-65	PKKMEKQWKLSLKSRKWNTRI	cyto(12),cyto_nucl(9.5),nucl(5),mito(4),extr(2),pero(2),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZM5	Zn(2)-C6 fungal-type domain-containing protein	Low	6.6	1	3-31	GIPLSRGCQPCRRRKVKCDEKRPACLRCT	plas(13),mito(6),nucl(4),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1R0	Uncharacterized protein	Low	8.5	1	11-31	LPGKRFFRSVKVPNLRRPPRS	mito(10),nucl(9),cyto(5),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4F7	Annexin ANXC3.2	Low	5	1	670-692	LDQVKKAYYHHYRRDLRDRVKGE	plas(15),E.R.(7),extr(2),mito(1),pero(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7H9	Uncharacterized protein	Low	7.1	1	931-957	ETSGHLKRIRMWQSRKRKNIVRWVYAD	cyto(9.5),cyto_nucl(9),nucl(7.5),golg(2),pero(2),plas(2),mito(1),extr(1),E.R.(1),cysk(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG04	Uncharacterized protein	Low	6.9	1	110-134	LRAAHEREKQKRQRSKQQISHEQGI	mito(19),nucl(5),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPC8	Alcohol dehydrogenase, putative	Low	8	1	281-306	TLLGKPVHWKKPYRRDARPKDKAFGD	cyto(18.5),cyto_pero(10),mito(7)	KPYRRDAR (291-298, prob:0.621)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRA0	Alpha-1,3-glucan synthase	Low	5	1	1647-1669	HVTSIAKHRKHSRQENPSRPNSI	plas(22),E.R.(2),extr(1),golg(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRQ0	DUF300 domain protein	Low	5	1	459-504	SDHGHVVRKARKHRNSHVCESSRENKATSSRTRRPQRPSEVPRHSS	plas(21),mito(2),extr(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY46	tRNA wybutosine-synthesizing protein 2	Low	7.5	1	1-24	MNEKDKYKKEKKPSTMCSNPLQRG	cyto_nucl(9),nucl(8.5),cyto(8.5),mito(4),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0M4	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	11-35	ACAECTRRKIKCDKVLPCRNCTRRG	nucl(13),mito(3),plas(3),golg(3),cyto(2),pero(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9F0	RNA methyltransferase, putative	Low	9.1	1	101-123	RPSYDRDTPAKRRSNKDEKRDYT	mito(15),cyto(7.5),cyto_nucl(6),nucl(3.5)	KKLGKGSGNIKRRRGK (145-160, prob:0.869)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFI9	Signal recognition particle subunit SRP68	Low	9.2	1	22-50	TYRAQTSRRLHTVRKRLGRTTPKGRKYSA	nucl(16),cyto_nucl(12.5),cyto(7),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIY1	Uncharacterized protein	Low	9.9	1	85-111	YCEGRNEKDKRRNWKGYQLKGKLSRRQ	nucl(19),cyto_nucl(12.5),cyto(4),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMX7	Uncharacterized protein	Low	6.5	1	379-405	AALLRVEYREKKEKKKTSTTTHDSREL	mito(15.5),cyto_mito(10),nucl(5),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUA8	Serine-threonine protein kinase, putative	Low	9.7	1	54-80	SARNTKEPPVSTKRKRRQEFQDFVRLI	nucl(17),cyto_nucl(12),cyto(5),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUB3	Uncharacterized protein (Fragment)	Low	6.1	1	102-123	GGAIQRKSPQYKKLKLKTFFFT	mito(16.5),cyto_mito(11),cyto(4.5),nucl(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTS1	RSC complex subunit Sfh1, putative	Low	9.2	1	453-480	SEAPLGRGERSKRKRRFRSLSPAGRSGT	mito(19),cyto(4),nucl(3)	RGERSKRKRRFRSLSPAG (459-476, prob:0.942)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUN7	MFS multidrug transporter, putative	Low	5	1	568-587	QEDQRRLKGKRENRNATSAI	plas(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZS8	Uncharacterized protein	Low	9	1	44-68	LRAAYEKEKQKRQKSKKQISHDQGI	mito(15),nucl(10)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M455	Uncharacterized protein	Low	8.8	1	31-52	QKSYQVKRRTGWRKVGHQAQTF	nucl(11),cyto(8),cysk(5),cyto_pero(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M674	Acetamidase, putative	Low	5	1	5-29	FDYFQYIKIRNAKRRERDARFSSLS	mito(18),cyto(6.5),cyto_pero(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMS5	Oxidoreductase, FAD-binding	Low	8	1	17-36	QVRPTPTKSLRAKNTQTTQS	mito(22.5),cyto_mito(13.5),cyto(3.5)	RRRP (287-290, prob:0.627)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0T2	General transcription and DNA repair factor IIH helicase subunit XPD	Low	9	1	677-698	VLADKRFARKRNQLPKWINQTI	nucl(14.5),cyto_nucl(12.5),cyto(9.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1M2	WD repeat protein	Low	9	1	47-68	AIRTYRPTKRFKLSKHENSHIT	nucl(15),cyto_nucl(12.5),cyto(8),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2X7	Transcription factor TFIIA complex subunit Toa1, putative	Low	8.4	1	334-354	LCTYDKVQRVKNKWKCTLKDG	nucl(12),cyto_nucl(10.5),cyto(7),mito(3),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7U4	Uncharacterized protein	Low	5.9	1	39-58	LQAFKEKQKKKLKSLFWIMI	cyto(13.5),cysk(8),cyto_mito(7.5),nucl(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ26	Uncharacterized protein	Low	7.8	1	8-44	LKSRHGCLTCKSRKVKRPVCSHCSRRKERCRYTEDAP	nucl(8),mito(8),mito_nucl(8),plas(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJR4	Pogo transposable element, putative	Low	5	1	426-446	SSNSRDINKKHSKKADQKPLL	plas(19),E.R.(5),mito(1),extr(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKI8	C6 finger domain protein, putative	Low	9.3	1	42-61	RTSVACVHCRRRKIRCLVAA	nucl(15),cyto_nucl(10),extr(4),mito(3),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKK1	Serine/threonine protein kinase, putative	Low	9.5	1	517-536	QNLKRWQKVLRKPQYEDPNY	nucl(13),mito(8),cyto_nucl(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMR6	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	1	15-35	MSSQRVIKPGIKRRRPPLACI	nucl(9),mito(9),mito_nucl(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNC0	HTH CENPB-type domain-containing protein	Low	7	1	407-428	EANDILQKRRTRRTKALQADGI	cyto(11.5),cyto_nucl(10),mito(8),nucl(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT16	Uncharacterized protein	Low	9.2	1	13-32	SRMHNESRAKRRYNVKTKEY	nucl(11),cyto(7),mito(6),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUY5	Endo/exonuclease/phosphatase domain-containing protein	Low	9.6	1	689-708	KTDFRRITRRSQRQFWQDKL	nucl(18.5),cyto_nucl(11.333),cyto_mito(3.833),mito(3.5),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT61	TLP1_add_C domain-containing protein	Low	5	1	497-518	ENNGNEKGRKRNLFTFRPKTRL	mito(11),cyto(10),pero(3),extr(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXA0	RelA_SpoT domain-containing protein	Low	9.9	1	57-80	QSAKGSVSRRNRERVIRRHIRDLV	nucl(18.5),cyto_nucl(12),cyto(4.5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M157	5'-nucleotidase, putative	Low	6.8	1	567-593	EYRIQHTHLKHKPRPHLRRYGRYYEPH	cysk(14),cyto_nucl(6),nucl(5.5),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1V1	C6 transcription factor, putative	Low	9.6	2	22-42, 65-84	QRVSRACLFCRQRKSRCDLDS, TSNRGGRRIRKSKSVTASKE	mito(17),nucl(7),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2L3	Nickel transport protein, putative	Low	5	1	190-212	QQMRKVLRFYRRRRQLRENMDDS	plas(25)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4P3	Oxidoreductase, 2OG-Fe(II) oxygenase family, putative	Low	7.6	1	328-348	TEQWVKVRQSQQQRRNRDVKI	cyto_nucl(13.333),nucl(11.5),cyto(10),cyto_mito(6.665),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME11	Uncharacterized protein	Low	9.3	1	474-497	VTVAYWWWKSRRQRLERGKHETSL	nucl(16.5),cyto_nucl(10.833),cyto(4),cyto_mito(3.333),golg(2),mito(1.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML55	Lipase, putative	Low	6.4	1	666-693	SDSSNLKDIKQRRPRRPSLSTPNKPLSF	extr(6),cyto(5),nucl(4),mito(4),mito_nucl(4),plas(3),golg(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPD0	S5A_REDUCTASE domain-containing protein	Low	5	1	196-219	REEAHRRVTKDKKKHAQQENIYSK	plas(19),E.R.(3),mito(2),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR07	tRNA nucleotidyltransferase	Low	9.4	1	64-91	SDGEFRIRKIKQSKRRNGKMDGTKMKRQ	mito(20.5),mito_nucl(13.5),nucl(5.5)	RIRKIKQSKRRNGKM (69-83, prob:0.857)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTH6	Probable dipeptidyl-aminopeptidase B	Low	6.5	1	75-96	ILSHPRDKSKRSRGSRWIWVIG	plas(16),nucl(4),mito(2),cyto(2),cyto_mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWP4	50S ribosomal protein L24	Low	9	1	77-106	SFGNKISKGRNKGKTRRSWKPNVRWKKLPS	mito(22.5),cyto_mito(12),nucl(4)	ISKGRNKGKTRRSWKPNVRWKK (82-103, prob:0.945)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1Y7	Protein phosphatase 2C, putative	Low	8.9	1	41-62	QIKSHNKQIKWRDDQIKSHKEQ	nucl(14),cyto_nucl(11.5),cyto(7),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3P5	Pro-apoptotic serine protease NMA111	Low	6.5	1	903-922	SSEFVKKNGKWKKIPLNLED	cyto_nucl(9.833),cyto_mito(9.165),mito(8.5),cyto(8),nucl(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M501	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial	Low	8	1	57-81	QLKEEAKRSKSQSRNGRGKKQVAAN	mito(25.5),cyto_mito(14)	KEEAKRSKSQSRNGRGKK (59-76, prob:0.761)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M668	Ubiquitin conjugating enzyme, putative	Low	5	1	503-529	AARLWRDDPKEFKKRVRKCVRDSLGED	plas(23),E.R.(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6X7	UDP-glucose:glycoprotein glucosyltransferase, putative	Low	5	1	1427-1446	CNNPLTKEPKLERARRQVPE	extr(13),plas(6),E.R.(3),cyto(2.5),cyto_nucl(2),golg(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCV1	Uncharacterized protein	Low	7.2	1	297-318	SDKDNDKKIRKTQEKLAKGKAD	extr(10),cyto_nucl(8),nucl(7),cyto(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK38	RING finger ubiquitin ligase (Tul1), putative	Low	8	1	725-753	AGSSRGQADKPPRPKDKKKKIFDCAICMQ	plas(25)	KPPRPKDKKKK (734-744, prob:0.877)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPB6	Sarcosine oxidase, putative	Low	5	1	68-94	VLGRLRCLRWRDRSIRRRAQLRQYRLV	mito(15.5),cyto_mito(12.333),cyto(8),cyto_nucl(4.833)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQJ2	Uncharacterized protein	Low	9.1	1	63-83	SPTTSRRKSFFRRRSHVSSSS	nucl(15.5),cyto_nucl(13.5),cyto(8.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LSU8	Nuclear pore complex subunit Nup192, putative	Low	7.8	1	2387-2409	SLACAKYRVLTKKPKGKDVNETD	nucl(7),plas(7),E.R.(4),mito_nucl(4),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYS8	Golgi reassembly stacking protein, putative	Low	8	1	272-292	LNSPAPPRSNKPGRRNRHAGI	cyto_nucl(13.833),nucl(13.5),cyto(11),cyto_mito(6.999)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1R1	Uncharacterized protein	Low	8	1	471-496	DLRAAHEKEKQKRQKSKKQISIEQGV	plas(23),E.R.(2)	EKQKRQKSK (479-487, prob:0.701)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8V8	54S ribosomal protein L4, mitochondrial	Low	9.1	1	218-243	AKAAKLEAKRQSRAEKKKKPETQPEA	mito(20.5),cyto_mito(12),nucl(4)	TAKAAKLEAKRQSRAEKKKKP (217-237, prob:0.947)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBL2	LCCL domain protein	Low	5	1	622-641	LDEDRKGKFTWRRQGHRGLE	plas(23),mito(1),cyto_nucl(1),E.R.(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIP3	Plasma membrane ATPase	Low	5	1	94-113	EVTTRRKKYGLNQMRKEEKQ	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML11	Uncharacterized protein	Low	9.7	1	154-173	SHQQRSHSTPKPKQNRQSTS	nucl(17),cyto_nucl(13.5),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLG0	WD repeat protein	Low	7.1	1	849-870	PTPTREQSPPRIRKKTSRYTLT	mito(14),nucl(6.5),cyto_nucl(6),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMP0	Reverse transcriptase, putative	Low	7.8	1	43-65	LLQPTPKEEYKKRPRVCFYVNRG	cyto_nucl(10),nucl(9.5),cyto(9.5),pero(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSI7	Uncharacterized protein (Fragment)	Low	8.3	1	228-255	EEKATQVRQSVRSRKRPRQEDNQYIYHE	mito_nucl(13),nucl(12.5),mito(12.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXM1	Methylthioribulose-1-phosphate dehydratase	Low	6.6	1	89-111	TPKYPPSERKYIRKPKNLKPSDC	cysk(14),cyto_nucl(5.5),nucl(5),cyto(4),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYC0	Sodium/hydrogen antiporter, putative	Low	8	1	512-538	EDEGRRPQSLRPKRRRKRMTNAGGPIS	plas(19),pero(3),cyto(2),E.R.(2)	GRRPQSLRPKRRRKR (515-529, prob:0.964)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB12	Presequence translocated-associated motor subunit PAM17, mitochondrial	Low	5	1	547-568	QGYRQWLKDQRAYNRKKSRHIL	plas(24),mito(1),E.R.(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLK5	Uncharacterized protein	Low	6.9	1	219-244	DEPYCSTYSPRREKRLRQQRQGISVV	mito(19),nucl(5),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MM82	Uncharacterized protein	Low	9.3	1	229-253	PVTPPPPRHRGRPRGSKNKQKADVN	cyto(18),cyto_nucl(12.5),nucl(5),mito(2),pero(2)	PPRHRGRPRGSKNKQK (234-249, prob:0.9)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNE4	Hexaprenyl pyrophosphate synthetase Coq1, putative	Low	5	1	44-63	IPSVHSRKYHPSRRRDVSPI	mito(22),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LSS4	Mitochondrial large ribosomal subunit YmL35, putative	Low	8.3	1	397-419	GIELRRKRVEPLPYKRRNPASFR	nucl(11.5),mito(10),cyto_nucl(8.5),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU28	Uncharacterized protein	Low	9.8	1	230-249	QQKCHHIKTKDTKKPPTVEV	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV30	Polyketide synthase, putative	Low	9.8	1	1627-1651	ISLPQKSPKKVKAPKKKTPSSQPDI	cyto(10.5),cyto_nucl(9.833),nucl(7),cyto_mito(6.666),extr(3),pero(3)	KSPKKVKAPKKK (1632-1643, prob:0.879)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVM3	MAP kinase kinase kinase	Low	9.1	1	132-156	QNDGRRSSSTKRNARRDPNAQYRAQ	nucl(14.5),cyto_nucl(11.5),cyto(5.5),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M881	Cytochrome P450, putative	Low	7	2	14-33, 428-447	AVILIQKRKKQDSQEPPFIS, FDESCKPTRKQHPSAFRTFG	plas(9),extr(6),mito(4),E.R.(4),golg(2),mito_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M934	Zn(2)-C6 fungal-type domain-containing protein	Low	7.4	1	23-52	FLCKICSKAFTKRTSRNRHVLYCRKKWVGS	nucl(6),mito(5),plas(5),cyto_nucl(5),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9N4	Uncharacterized protein	Low	6.9	1	18-39	SQSPGRWRHPRLREIVRRQNAT	mito(8),plas(6),nucl(5),cyto(3),golg(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME65	60S ribosomal protein L25, putative	Low	8	1	235-255	ELIRQWKQRGHGRGWKKWPRR	mito(23),mito_nucl(13.333),cyto_mito(12.833)	WKQRGHGRGWKKWPRR (240-255, prob:0.927)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGD3	Prenyltransferase, putative	Low	5	1	92-114	VDYEYDKHVRRRRSRPVARGALT	plas(21),E.R.(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1C0	Serine hydroxymethyltransferase	Low	5	1	72-91	IFAILQREKRRQKHFINLIP	mito(26.5),cyto_mito(14)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M560	MFS multidrug transporter, putative	Low	8	1	471-495	DLRAAHEKEKQKRQKSKKQISIEQG	plas(23),mito(1),pero(1),E.R.(1),vacu(1)	EKQKRQKSK (479-487, prob:0.701)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9L1	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	2	15-39, 592-614	SLSCSVCRSRKVRCGREQPACTNCI, GSLPAQKLWTRHKKGKTLFQIQG	plas(16),nucl(6),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF10	HTH CENPB-type domain-containing protein	Low	9.8	1	430-451	RDIATRKNQKTTKRQVKASGAL	nucl(13),cyto(7),mito_nucl(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGT1	C6 transcription factor, putative	Low	8.6	1	7-42	DGSSIKHKRNRTAQSCVQCRLRKVRCDRKLPCAPCL	plas(16),nucl(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML47	NACHT and TPR domain protein	Low	9.4	1	47-73	EESIKFGTFRNKKPKFTNVLKKAVKPF	cyto(8.5),cyto_nucl(7),mito(6),nucl(4.5),plas(4),pero(2)	RLRDKKAAA (501-509, prob:0.671)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRA8	Uncharacterized protein	Low	8.5	1	360-380	LGLRKEVTEKRKRLQDKDDSL	nucl(17),cyto_nucl(13.333),mito_nucl(9.833),cyto(8.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUI2	Endonuclease/reverse transcriptase, putative	Low	9.4	1	334-353	QCTRCWKWHNTRSCARPSRC	nucl(15.5),cyto_nucl(10),mito(4),cyto(3.5),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV60	Polyketide synthase, putative	Low	6.1	1	2091-2110	SLTRYFPKPMTPSQRPRNTY	cyto(10),cyto_nucl(8),mito(5),nucl(4),extr(3),golg(1),E.R.(1),pero(1),plas(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV39	FSH1 domain-containing protein	Low	6.4	1	116-137	GPFKRWLRSKKSHPKIHPDNAV	cyto(9.5),cyto_nucl(8.5),pero(8),nucl(4.5),cysk(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX63	Uncharacterized protein	Low	8	1	76-97	PEYLQLRKTSKHKKTNLAGCHG	mito(14),mito_nucl(14),nucl(12)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M325	Glycerol kinase	Low	5.5	1	556-576	LELRKIEIQQRLKRLRKESKS	cyto(17),cyto_nucl(10.5),cysk(6),nucl(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M398	ATP-binding cassette transporter, putative	Low	5	1	152-173	ESTPKTKILKPHYQKTPKEQTC	plas(17),E.R.(5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF96	Protein arginine methyltransferase NDUFAF7	Low	8.7	1	126-148	LVTAKDLRSRRERPRQVKMLTRE	nucl(12.5),cyto_nucl(10),cyto(6.5),mito(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH57	DNA-directed DNA polymerase theta, putative	Low	8.4	1	236-255	TPDSAKQKWKQPSKEIRVTG	nucl(11.5),cyto_nucl(10),cyto(7.5),mito(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQY9	Palmitoyltransferase	Low	8.1	2	5-25, 125-150	GSPTLSPKRRVRSLARTVERT, HGGARFCKKCQCPKPDRAHHCSSCKR	plas(13),mito(8),nucl(3),cyto(1),extr(1),E.R.(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRX2	ANK_REP_REGION domain-containing protein	Low	7.6	1	295-316	LLIQRIRKRSTSKTKMVQLPYS	cysk(10),nucl(7),cyto(6),mito(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ97	ATP-dependent Clp protease, putative	Low	5.8	1	579-604	ESDWENKMQRDKKRNSTNHGNGHKSG	mito(16),plas(3),nucl(2),cyto(2),cyto_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6R1	DUF1295 domain protein	Low	8	1	332-358	KFVPRWSVKARGQKGKAKAKIEQKKKE	plas(16),E.R.(7),vacu(2)	WSVKARGQKGKAKAKIEQKKKE (337-358, prob:0.975)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCT2	Uncharacterized protein	Low	9.9	1	18-42	AQKDAKQKRPEDSRQKRPEQRLTLD	nucl(17.5),cyto_nucl(11),mito(4),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLT4	Polyketide synthase, putative	Low	5.5	1	716-743	YAPLTRRRSKDQPLKYWRRKSKSLIKVL	plas(10),cyto(7.5),cyto_nucl(5),mito(2),extr(2),E.R.(2),nucl(1.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMJ2	UPF0016 domain protein, putative	Low	5	1	360-380	EEKEHEQRRMRNRRRSSVTPY	plas(10),extr(8),mito(4),cyto(2),E.R.(2),mito_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUJ4	Reverse transcriptase, putative	Low	8.7	1	43-67	LLQPTPKEEYKKRPRVCFYVNRGLD	nucl(10),cyto(8),pero(6),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUM5	Zn(2)-C6 fungal-type domain-containing protein	Low	8.4	1	211-230	REPFRPQPRKQRASMRQTSF	nucl(11.5),cyto_nucl(8),mito(4),extr(4),cyto(3.5),plas(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXI0	Sarcoplasmic/endoplasmic reticulum calcium ATPase, putative	Low	8	1	250-274	ASSMQGKKNRKVKKSRSMSVKKYGP	plas(17),E.R.(6),mito(4)	KKNRKVKKSRS (256-266, prob:0.843)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYA0	Uncharacterized protein	Low	5	1	769-792	FTLSRPPHTLRKTRWGKRVFRAMP	plas(22),E.R.(2),mito(1),cyto(1),vacu(1),cyto_mito(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0E1	Gram-negative bacteria binding protein, putative	Low	5	1	61-80	RPWVNDKRLKRIRVNNYIIW	extr(18),mito(2),cyto(2),pero(2),cyto_mito(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6C9	Uncharacterized protein	Low	8.5	1	50-74	SIESKLPPPTQPKKRSARQSSSSSL	nucl(11.5),cyto_nucl(9),mito(7),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M756	Peptidyl-tRNA hydrolase domain protein	Low	9.9	1	171-196	ETEARIKSKKMHSAKKSNRRNSKYDD	mito(20),nucl(5.5),cyto_nucl(4)	KNLRKAETEARIKSKKMHSAKKSNRRN (165-191, prob:0.922)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDA4	Mitochondrial GTPase (YlqF), putative	Low	7.7	1	321-347	QQLKAITRARINRKKEQRLQAPKSTAE	mito(12),nucl(9.5),cyto_nucl(8),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFW4	Integrase catalytic domain-containing protein	Low	9.5	1	203-252	ALVTRGRRPNRRTSSRNLRNGGNNSNSNRRERSNRNSRNKRLICNWCKRE	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKH1	Uncharacterized protein	Low	9.9	1	39-58	EQDKNEKDSKDKKKPSLFES	mito(19.5),cyto_mito(10.5),nucl(7)	KPEARKRWERKMIIREVRKRGR (133-154, prob:0.9)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMW9	Rho GTPase Rac, putative	Low	6	1	179-199	IRAVLNPRPQPKNKAKRCVIL	cyto(17.5),cyto_mito(12),mito(5.5),nucl(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPX9	DnaJ domain protein (Mas5), putative	Low	9.2	1	204-229	GSFFSPKDKCKKCKGKKVTEEKKMLE	nucl(16.5),cyto_nucl(13.5),cyto(9.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQH5	C6 transcription factor, putative	Low	8.1	1	7-26	STPRRRHRSAFACQLCRQRK	mito(9),nucl(8),plas(7),cyto(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWQ7	Cell cycle regulatory protein, putative	Low	9.6	1	89-111	QENNENPFCRRRRRMVIPIQFDI	nucl(12),cyto(6),mito(5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWT4	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	Low	8.9	2	155-176, 549-571	AFSLAKYKLRKEKKYLKRFTIV, HVQARGVNSRKKRKLDVGDNGTP	cyto_nucl(9.833),mito_nucl(9.166),cyto(9),nucl(8.5),mito(8.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX20	Short-chain dehydrogenase, putative	Low	7.2	1	290-310	QDKQECDGRSRPRNNFISKRS	mito(7.5),nucl(7),cyto_mito(7),cyto(5.5),extr(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXJ0	GATA transcription factor LreB	Low	9.9	1	416-440	LCNACGLRWAKKERKRQGSIQSSIQ	nucl(21),cyto_nucl(13.833),cyto(4.5),cyto_mito(3.666)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M379	Nucleotide-sugar transporter, putative	Low	8	1	87-119	EETGLTAKQRNERRRRRKRQRRRLDAKIAGVKG	plas(16),mito(5),E.R.(4)	QRNERRRRRKRQRRRLDAKIAG (95-116, prob:0.996)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5K9	Spindle pole body component	Low	7.1	1	945-970	AASTTRDRDKDRRGRRNVVQSNNNAA	mito(12),mito_nucl(11.333),nucl(9.5),cyto_mito(8.333),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7Q7	Zn(2)-C6 fungal-type domain-containing protein	Low	6.8	1	42-84	TRACDWCRVHRIKCDNNYPCQNCHSRQGHCSRRERSKTRTLPS	plas(12),mito(7),nucl(5),cyto(1),pero(1),vacu(1),cyto_pero(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBZ3	25S rRNA adenine-N(1) methyltransferase	Low	9.2	1	2-21	AVKKRNKRPGLLSHTRPRIA	nucl(14),mito(11),cyto_nucl(8.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME62	PAP2 domain protein	Low	5	1	3-22	QLPSKLPFSKKRLRARIIIS	plas(16),mito(4),extr(4),E.R.(2),cyto_mito(2),mito_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF36	Kinesin, putative	Low	7.5	1	205-227	DTCGKCDKDKLVKRQPRATRTPY	nucl(8),mito(7.5),cyto_mito(6),cyto(3.5),plas(3),extr(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFJ9	Amine oxidase	Low	5.9	1	80-100	IVNYDKTQRKHTRHIQKFLEG	mito(13.5),cyto_mito(10.833),cyto(7),cyto_nucl(5.833),nucl(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUC5	Non-specific serine/threonine protein kinase	Low	9.9	1	216-242	WQGLKATTKKQKYKKIMEKKKTTPIEV	mito(10),cyto(9),nucl(5),pero(3)	KK (229-230, prob:0.612)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV59	Uncharacterized protein	Low	5	1	264-285	GSLKRYCRRKINTRLERIVRKK	plas(19),cyto(2),E.R.(2),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX11	HTH CENPB-type domain-containing protein	Low	8.3	1	440-461	RDIATRKNQKTTKRQVKASGAL	nucl(11.5),cyto_nucl(10.5),cyto(8.5),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYX4	Uncharacterized protein	Low	9.1	1	49-70	EWSPPIKDKRVKHKSNREYFGG	nucl(15.5),cyto_nucl(13),cyto(9.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZG6	Sodium/calcium exchanger protein	Low	7	2	8-28, 267-289	FTLPQLRPRMHQRYHPRPFFL, VVSWHWYLTRKRRKYDREIAARA	plas(21),mito(2),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0L0	Catalase domain-containing protein	Low	9.6	1	96-116	ITPLHRRTRARNNSLRTKPPS	nucl(17.5),cyto_nucl(13),cyto(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2D3	Nitrite reductase NiiA	Low	6.7	1	1057-1078	PFEKVDKKYKGTRGKKIGDVHV	cyto(10),cyto_nucl(9),nucl(6),plas(6),mito(2),golg(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4F0	DDE-1 domain-containing protein	Low	8.3	1	290-309	EQARKDNKKLQQQLTKQAKE	nucl(11.5),cyto_nucl(10),cyto(7.5),pero(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4N7	Fructosyl amino acid oxidase, putative	Low	5	1	387-407	PTEIREKWKLRKDIKGSNAPL	extr(21),mito(2),cyto(1),pero(1),E.R.(1),golg(1),mito_nucl(1),cyto_pero(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4Z9	Uncharacterized protein	Low	5	1	1-21	MPTYRRTTARRRYQWPELQLN	plas(18),E.R.(4),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHH1	FAD binding oxidoreductase, putative	Low	6.3	1	437-458	DNLSRLKELKKQYDPRNVFRKW	cyto(15.5),cyto_nucl(12.833),cyto_mito(8.832),nucl(6),extr(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJD9	Uncharacterized protein	Low	8	1	257-286	EQGPILSRPWKNRDKRRRKHRQGVYSESAA	plas(21),E.R.(2),golg(2)	PWKNRDKRRRKHR (265-277, prob:0.922)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQP3	MARVEL domain-containing protein	Low	5	1	195-217	YTSGTTRRRGFWRRNKATNPDVP	plas(18),E.R.(4),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRG1	cAMP receptor (Car4), putative	Low	8	1	264-288	ISIGMKSWRRQTRLQKWKLSDKVKG	plas(17),E.R.(4),mito(3),golg(3)	KWKLSDKVKGMAPAKPRAPR (279-298, prob:0.812)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUA9	Uncharacterized protein	Low	8.7	1	1-21	MLQQRAQRRRKAIPNEWKAAL	nucl(13.5),mito_nucl(12.5),mito(10.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZB7	3-ketoacyl-CoA thiolase (POT1), putative	Low	5	1	410-432	FEQVIKMSKKKAKFRVNKEFLQT	mito(15),cyto(8.5),cyto_nucl(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4E8	Phenylalanine ammonia-lyase	Low	6.9	1	9-34	AKTHELWTRLKLRKRQGRYEINGNSL	mito(14),cyto_nucl(6.5),nucl(6),cyto(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M967	Uncharacterized protein	Low	9.4	1	34-56	MPPLPLDKSKKRRQHSTSNSSST	mito(14),nucl(11)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHN0	Ribosome recycling factor, putative	Low	5.9	1	63-85	FTNSASLSKKKDKNKRNDDVDSS	mito(23),nucl(2.5),cyto_nucl(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNE9	Uncharacterized protein	Low	9.1	1	56-81	KNTHDLKDDGKKERNRRNARLLQGPS	plas(16),nucl(3),mito(2),cyto(2),golg(2),cyto_mito(2)	RQHRLRSSSSPSPRGRGHRRGG (825-846, prob:0.816)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNL5	Major sperm protein, putative	Low	9	1	110-129	VPKPQYQHSFKKLRRRTSLL	nucl(13.5),cyto_nucl(10),cyto(5.5),cysk(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQX0	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	12-52	TSPRVSPHSLHGKRKRKTLSCYECRRRKLKCDREEPSCTRC	nucl(12),plas(7),mito(4),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU42	50S ribosomal protein L10e, putative	Low	6.1	1	1-28	MVRRPARCYHYCKNKPFPKSRFNRGVPD	mito(19),cyto(5),nucl(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6C7	Uncharacterized protein	Low	9	1	277-303	GIELSAKSKKSKRQSKKPPQKAADADE	plas(12),cyto_nucl(4),E.R.(4),nucl(3),cyto(3),mito(2),vacu(2)	KSKKSKRQSKKPPQ (283-296, prob:0.903)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M788	DUF2293 domain-containing protein	Low	9.5	1	14-33	QNSSTRTRFRKHKVILESVT	nucl(15.5),mito(10),cyto_nucl(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEQ1	Sarcosine oxidase, putative	Low	5	1	396-415	RGLKREWKYGGRKEIRNVTR	cyto(10.5),mito(9),cyto_nucl(6),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGI5	C2H2 transcription factor, putative	Low	6.1	1	3-34	LRKCNICDRKFKKTEHYKRHERSHTKERPYEC	plas(20),nucl(3),mito(2),cyto_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVG8	HTH CENPB-type domain-containing protein	Low	8.2	1	466-487	RDIATRKNQKTTKRQVKASGAL	cyto(12),nucl(8),pero(3),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LSU9	Serine/threonine-protein kinase Tel1	Low	8.8	2	2593-2613, 2839-2860	SNVLRDHRSTRQRNLHIRTYK, LTKGVERTKSKNKDPKEPSEAD	plas(12),cyto_nucl(6),nucl(5.5),cyto(5.5),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT41	Vacuolar transporter chaperone (Vtc4), putative	Low	5.6	1	742-768	VLYVWRVDKIRKRRDVKRIYYEKWGPT	plas(19),pero(3),cyto_nucl(2),nucl(1.5),cyto(1.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUM6	Uncharacterized protein	Low	9	1	20-50	VQKSQGGRKNSGKRRLKGKKRGDITKTSKDE	cyto(14),cyto_nucl(9.833),cyto_mito(7.833),cysk(7),nucl(4.5)	GGRKNSGKRRLKGKKRG (25-41, prob:0.98)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUS6	Uncharacterized protein	Low	9.9	1	115-140	AQSFCGAKKKKEVKKARKYPTTPRQD	mito(22),nucl(5)	KKKKEVKKARK (122-132, prob:0.901)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZW0	GNAT family acetyltransferase, putative	Low	5.6	1	158-177	GGNKKSPKFKARYRNKTFGT	cyto(13),cyto_nucl(8.5),pero(5),mito(3),nucl(2),plas(1),extr(1),cysk(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M700	Zn(2)-C6 fungal-type domain-containing protein	Low	9.8	1	5-36	EGRRRRPAVSCILCRRRKIRCNRETPCSNCVR	mito(13),nucl(12)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7C5	Uncharacterized protein	Low	8.8	1	307-332	EHLKQLMKQLRRKRAPWKQQMLHALE	nucl(17),cyto_nucl(11.833),mito_nucl(10.833),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBQ0	C6 finger domain protein, putative	Low	8.4	1	65-85	CENCRLKKTRCDESRPKCGLC	nucl(10),plas(10),cyto(2.5),cyto_mito(2.5),mito(1.5),pero(1),E.R.(1),golg(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC20	Uncharacterized protein	Low	5	1	610-629	SIEQKHKVRRWENLLPEQRQ	extr(8),cyto(5),plas(4),cyto_nucl(4),cyto_mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTU0	Uncharacterized protein	Low	5	1	22-41	VFPKMRSRFCRPKKLSNALL	mito(23),cyto(2),plas(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUW5	Uncharacterized protein	Low	7.9	1	271-292	GEPSRPPKKNIRSTFRSPKTSN	nucl(11),cyto_nucl(11),cyto(9),mito(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU23	Uncharacterized protein	Low	8.6	1	39-58	LLVAYKRLRRHRLWNKLTSS	nucl(10),mito(7),cyto_nucl(7),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX91	Uncharacterized protein	Low	6.4	1	92-115	LEANTRRPCRTSKRNDPTLVRQYR	plas(15),nucl(4),mito(2),cyto(2),pero(2),cyto_mito(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1S5	Phosphatidylserine decarboxylase family protein	Low	5.6	1	410-434	FSLPDDWKDRPKNMKQVKVRSKLAT	mito(9.5),cyto_mito(7.5),cyto(4.5),golg(4),nucl(2),plas(2),extr(2),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5E5	Polysaccharide export protein (CAP59), putative	Low	8.1	1	379-402	TMPVFERRVIRRRVKNWENEEGNR	mito(12),nucl(9.5),cyto_nucl(6.5),cyto(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8S6	Zn(2)-C6 fungal-type domain-containing protein	Low	9.1	1	16-37	CDRCHSFKLKCPRPSLRNDDTC	nucl(14),mito(11),cyto_nucl(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBN2	3' exoribonuclease family protein	Low	9.6	1	26-48	AAGEKAERPRRARKPTELRKIFL	mito(10),cyto_nucl(5),nucl(4.5),cyto(4.5),pero(3),extr(2)	EKAERPRRARKPT (29-41, prob:0.867)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDG4	Ubiquitinyl hydrolase 1	Low	8.4	1	56-81	EAYHTWHIKDWRKLKKKEHGPVFECG	nucl(12.5),cyto_nucl(12.5),cyto(11.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEQ2	Zn(2)-C6 fungal-type domain-containing protein	Low	7.7	1	9-53	QADNCRIKQRVRSGCKTCRVRRVKCDETKPRCRNCLRKGLACDNS	plas(17),nucl(7),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEQ9	Exocyst complex component EXO84	Low	8.4	1	9-33	MDVRGLTLRNKSRRRPQISAPQPIT	nucl(12.5),cyto_nucl(9.5),cyto(5.5),mito(5),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIV9	Kinesin light chain, putative	Low	8.9	1	202-227	GTCEKCDKNQLVKRKPRETRTPYVHY	nucl(14),cyto_nucl(11.5),cyto(7),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTD2	Uncharacterized protein	Low	8	1	397-422	AKRFKDVVKRNPKKHKSLNSARQYFR	mito(20.5),cyto_mito(12.666),cyto_nucl(4.333),cyto(3.5)	KRNPKKHK (405-412, prob:0.704)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTW0	Pentatricopeptide repeat protein	Low	7	2	205-226, 666-691	THHNGRVKPKWPKNHIGHRLKE, RQLHQHWIYDKKKRRRIYNAMFLSRE	mito(11),plas(8),golg(4),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M187	Patched sphingolipid transporter (Ncr1), putative	Low	5	1	286-309	SSYVAYRERRYRKPERVRLLQDPV	plas(20),E.R.(4),extr(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7B0	Uncharacterized protein	Low	9.4	1	204-224	ANDILQKRRTRRTKALQADGI	nucl(17),cyto_nucl(12),mito(5),cyto(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIB4	Uncharacterized protein	Low	8.4	1	50-69	SDQNHKKKPKYVRTARRYNH	mito(14),nucl(10.5),cyto_nucl(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTG8	Uncharacterized protein	Low	5	1	166-187	DVASLNKKQRKRYEKKMAALAA	mito(24),cyto(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUW8	Uncharacterized protein	Low	9.2	1	101-127	DFVRLHDTAKRKNNKKNKRQVKASGAL	mito(19),cyto_nucl(4),nucl(3.5),cyto(3.5)	KRKNNKKNKRQVK (110-122, prob:0.86)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUW7	RNase H domain-containing protein	Low	8.6	1	310-335	RSWDRQKAGKPIKKLINKPSKRTLQY	mito(14.5),cyto_mito(8.5),extr(7),nucl(2)	SWDRQKAGKPIKKLINKPSK (311-330, prob:0.84)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWP2	Steroid alpha reductase family protein	Low	8	1	274-304	TLQMWDWAKKKERRYRKEFGDKYKRKRFTLL	cyto_mito(8),mito(7.5),cyto(7.5),plas(7),pero(2)	KKKERRYRKEFGDKYKRKR (282-300, prob:0.903)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXE7	Uncharacterized protein	Low	8	1	67-93	QKQAFLAKNYHRKKKQASIQRLKSSNA	mito(10),nucl(9.5),cyto_nucl(6.5),plas(3),cyto(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXQ0	Histone deacetylase	Low	9.5	1	702-727	GVWHNENRRKPSKRYGRLLRSPKTGL	cyto(14),cyto_nucl(10.833),cyto_pero(9.333),nucl(6.5),pero(3.5)	RKPSKR (710-715, prob:0.622)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZB0	Uncharacterized protein	Low	9.6	1	63-82	LTTTASKPAKPKKANGKPEY	mito(16),cyto_nucl(6),nucl(5),cyto(5)	KPAKPKKANGKP (69-80, prob:0.797)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5F1	Actin polymerization protein Bzz1, putative	Low	9.6	1	51-73	SKLSALCKKYSDRKAKKISSLSV	nucl(15.5),cyto(9),mito_nucl(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8C6	Calcium/calmodulin-dependent protein kinase, putative	Low	6.7	1	550-570	RYNGATRQKQQQQQQQQQPGG	mito(16),cyto_nucl(6),nucl(5.5),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFA6	Oxidoreductin	Low	8.7	1	585-605	LPVPPRQWKIQIPRPPRHDEL	nucl(10),mito(6),cyto(5),extr(3),E.R.(1),golg(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU52	Uncharacterized protein	Low	8.3	1	456-478	NRSRFTRKPSRHFRGPRNDKKTC	nucl(10),cyto(10),cyto_nucl(10)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUE8	Mitochondrial carrier protein, putative	Low	5.7	1	28-52	TSNPWIFDTKKRNRMLKRYRTQVAS	mito(18),cyto(4),nucl(2),plas(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ80	Pantothenate transporter, putative	Low	5	1	13-35	FKRVNKMSFWARRTRRKPASEIA	plas(20),mito(4),E.R.(2),cyto_mito(2),mito_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0B0	Mitogen activated protein kinase kinase, putative	Low	7.8	1	27-55	QSSPPSTASRLQKRTKPPRLPVAVKRPAD	cyto_nucl(12),nucl(10.5),cyto(10.5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD72	Response regulator, putative	Low	9.9	1	171-190	PSPGSRPNRHSRRPPFARHT	mito(14),nucl(6),cyto(6),cyto_nucl(6)	R (249-249, prob:0.601)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME63	Uncharacterized protein	Low	8	1	167-193	VKETVVRRRSHSSRRGHRHSRSGSSSR	plas(18),mito(5),E.R.(2)	RRSHSSRRGHRHSR (174-187, prob:0.729)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGD8	Alpha/beta hydrolase, putative	Low	6.5	1	325-345	FSNPKNQKYRIVRYRPRGRSS	cyto(14.5),cyto_nucl(10.5),nucl(5.5),pero(3),mito(2),cysk(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIK5	SWIRM domain protein Fun19, putative	Low	9.5	1	219-243	NSQPRPTKVSRPRRTPKSTPQQRVL	nucl(17),cyto_nucl(12),cyto(5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLT5	Zn(2)-C6 fungal-type domain-containing protein	Low	8.1	1	14-33	LERPVSCRFCRSRKLLCSRE	nucl(8),plas(6),cyto_nucl(6),mito_nucl(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRF7	Xenobiotic compound monooxygenase, DszA family	Low	6.4	1	30-51	QAPGLWRHPRNKTDQYKKLCFW	cyto(13.5),cyto_mito(9),nucl(5),pero(4),mito(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV15	MYND-type zinc finger protein samB	Low	9.4	1	1157-1204	KCDNCGKHDVRPKKCLRCGIVSYCNRDCQKAAWKKHKKDCKKGRTGIL	cyto(9),mito(5),extr(5),cyto_pero(5),nucl(4)	K (1193-1193, prob:0.604)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVK1	Uncharacterized protein	Low	9.4	1	78-105	NDCRICKKIQTKIRRRQRELQRLQRWSR	nucl(17),cyto_nucl(11.5),mito(6),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTN3	Uncharacterized protein	Low	9.9	1	36-62	ASSVASTAKPQHKKRRSNNLLWEHTRP	nucl(18.5),cyto_nucl(12),cyto(4.5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWI4	Uncharacterized protein	Low	5.4	1	340-359	QSDDRQTRHTRDSRRSRSQR	extr(15),plas(7),vacu(2),nucl(1),mito(1),E.R.(1),mito_nucl(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX70	Uncharacterized protein	Low	8.5	1	107-129	KEGLAKQKWKQRWQLEPDRIKPW	nucl(13),cyto_nucl(12),cyto(9),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1S6	C6 transcription factor, putative	Low	9.9	2	90-119, 130-150	GAAGQPQQKRAYRQRRKDPSCDACRERKVK, ECSNRKVRCQFTKETNRRMSS	mito(9),nucl(8),plas(4),cyto(3),extr(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5U6	Uncharacterized protein	Low	5	1	31-54	LTLTLKRVNRVKRPLNNPTQHTRC	mito(11),extr(8),cyto(6.5),cyto_nucl(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIK9	Mitochondrial carrier protein, putative	Low	6.5	1	329-348	QETFKRCQKRASRSGGWMRW	mito(8),cyto(7.5),cyto_nucl(6.5),nucl(4.5),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIX6	Transcription factor Tos4, putative	Low	9.4	1	502-527	VVNDLRKPGLRNCRKQHKQYYWRKPK	nucl(14.5),cyto_nucl(9.5),mito(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT55	MYND-type zinc finger protein samB	Low	9.9	1	183-211	LVTYCSKDYQRKDWKNYKRECKGKSKAMD	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV51	Cytomegalovirus gH-receptor family protein, putative	Low	8.4	2	439-460, 964-984	QQSNTRRRKTSAQPNHRRQKSM, DDPNALRKIREKERAEKDKHS	plas(20),nucl(4),cyto(2),mito_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1X2	Uncharacterized protein	Low	9.4	1	69-98	SPSPNPRIQSKYQKRNWFKRRNGQGKQAQD	nucl(17),cyto_nucl(11.5),cyto(4),mito(3),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M635	MFS transporter, putative	Low	5	1	86-107	FAQEYLKRKRSTKKIVHQGSLN	plas(23),E.R.(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M800	Dynactin Arp1 p62 subunit RO2, putative	Low	7.8	2	13-50, 368-392	PCAQQTRSSKLSKRNSREFSPKKQSSPRKPAANTQQPE, RPLPVLLRTKRSKRCKSCKHILVKP	mito(22.5),cyto_mito(12.5),nucl(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME75	Diphthamide synthase	Low	5	1	1279-1298	ADSPSRPQARQRSLPRQNGF	plas(22),cyto(2),pero(1),E.R.(1),vacu(1),cyto_mito(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFC9	Protein-tyrosine-phosphatase	Low	5	1	16-37	ETAQLFVRERHHRKNTNVTVTS	cyto(10.5),mito(6),cyto_nucl(6),plas(4),extr(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGT7	Uncharacterized protein	Low	8.3	1	20-50	ICTGNYRKPYPSSRRRRLRYRGDDPRKLFTT	nucl(9),mito(9),mito_nucl(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKF7	Tyrosine/serine protein phosphatase, putative	Low	7.6	1	1-20	MGQKRSKRPTRLTPSPSPSA	mito(12),nucl(7),golg(3),pero(2),cyto(1),plas(1),E.R.(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML94	C-24(28) sterol reductase	Low	7	2	6-27, 50-72	QRVTRSQTGKTPKKVDRPDFVE, STSANPQSTKGRRRKTPLASVDE	plas(19),mito(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLW3	Uncharacterized protein	Low	9.5	1	263-290	ESPAKRKGPPPPKRKGRGLRGRGRKKVM	mito(18),cyto(5),nucl(4)	AKRKGPPPPKRKGRGLRGRGRKK (266-288, prob:0.999)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MM22	Kinesin, putative	Low	8.9	2	24-44, 184-205	VSSSWRSKSHAKMPPRSREEF, QSFLNRLRTRRMKDQVQRQTAQ	mito(15),nucl(6.5),cyto_nucl(6.5),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUU1	Zn(2)-C6 fungal-type domain-containing protein	Low	9	1	5-25	RPTPDSKQKTGESKRGRTSRA	nucl(14.5),cyto_nucl(11),cyto(6.5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU34	Uncharacterized protein	Low	8.7	1	38-59	PEPPQLPSKKNNAKTRAERISA	nucl(10),cyto(6),cysk(5),mito(3),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV01	MFS transporter, putative	Low	5	1	514-541	LAKIYYDARNRWKRTRWEKMSPNEKASY	plas(25)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX21	Reverse transcriptase	Low	9.1	1	383-403	GLCFNCKQPGHRRNSCPFKKG	nucl(15.5),cyto_nucl(12),cyto(7.5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZT8	Inositol-3-phosphate synthase	Low	5.8	1	45-64	TPYEKKYEFKINRKVPRVGV	cyto(11.5),cyto_nucl(7.5),plas(7),nucl(2.5),pero(2),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M386	Zn(2)-C6 fungal-type domain-containing protein	Low	7	1	5-54	ALASCFSCRRSKRRCDKSLPSCQLCIRKGLKCNYPHRRGQRSPSPPHSSR	mito(15),nucl(5),plas(3),cyto(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3L5	Cytochrome P450, putative	Low	8.2	2	13-39, 134-153	GFLIYRSIKARVRKRQIRQKEAQLGCL, TTRGWDWKHSRSRLRPQFAR	mito(9),E.R.(4),golg(4),nucl(3),plas(3),extr(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4G7	ATP dependent RNA helicase (Dbp9), putative	Low	9.6	1	579-604	IGKTSENRIRKARERNRGKGRRGAVG	cyto(12),cyto_nucl(11),nucl(6),pero(5),mito(4)	NRIRKARERNRGKGRRGAVGKKADPLKNFNAKGRKK (585-620, prob:0.997)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDQ4	Membrane-spanning ATPase, putative	Low	9.2	1	66-93	DSDSPNRGGSRRRRKQKREELVLNQYEQ	mito(15),cyto(8),nucl(3)	RGGSRRRRKQKR (72-83, prob:0.9)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEU3	Cell morphogenesis protein (PAG1), putative	Low	6.8	1	215-234	SSTVHKKMPSSTKLRREQSH	plas(15),nucl(5),cyto(4),mito(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNV5	Ariadne RING finger, putative	Low	9.9	1	235-258	AHVPNKFQKKWKSKYKEYTTKDRY	nucl(18.5),mito_nucl(13),mito(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSL7	Fungal_trans domain-containing protein	Low	7.4	1	63-86	SIQMQKCGYRHKNIQRRGDHKATS	cyto(7),nucl(6),mito(4),plas(4),cyto_pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXA8	Mitochondrial chaperone bcs1, putative	Low	5	1	472-495	AEWVVKARKERSKLQRENSWVQNI	cyto(7.5),E.R.(6),golg(6),cyto_nucl(4.5),plas(3),mito(1),extr(1),pero(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYV0	Uncharacterized protein	Low	7	2	41-66, 564-586	YILAWVRYHRVRRSRRGAQVPPKYPT, LGTARTKYPVPVRVRRRKYKENA	plas(10),mito(8),extr(6),cyto(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6S3	Mitochondrial inner membrane AAA protease Yta12, putative	Low	8	1	53-81	NPGGDPKRPDDDKNKKKKVEKSKDEELAE	mito(18.5),cyto_mito(13),cyto(6.5)	DKNKKKKVEK (64-73, prob:0.809)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8X2	Platelet-activating factor acetylhydrolase isoform 1B alpha subunit, putative	Low	6.6	1	95-117	TAYRFINRGRHPKKQLQKFLASQ	cyto(6.5),cyto_nucl(6.5),nucl(5.5),extr(5),E.R.(3),golg(3),mito(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAQ6	Proton-translocating NAD(P)(+) transhydrogenase	Low	5	1	32-55	WQRFHCLRTTSRPRSHRQDRFLVA	plas(13),E.R.(6),mito(4),extr(2),vacu(2),cyto_mito(2),mito_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDG2	Signal peptidase subunit 3	Low	5	1	136-163	TTKSVGKNSKKTNNKKTQPKKTEQQQSG	extr(25)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEE0	Uncharacterized protein	Low	8.5	1	146-171	AEKERTKKDSHAKIRAENKQKFRTTH	mito(15),nucl(11.5),cyto_nucl(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIF0	Nucleotid_trans domain-containing protein	Low	5	1	13-34	FMFPPSERRRRLPTNCRWPLSI	plas(14),mito(3),golg(3),pero(2),E.R.(2),cyto_mito(2),mito_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJA8	Polymerase, putative	Low	8.6	1	131-154	SGTAIKQTKPPTKKPTPDVKQSLP	nucl(12),cyto_nucl(9),mito(8),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKB1	Small nucleolar ribonucleoprotein complex subunit, putative	Low	8.1	1	169-189	VGERNGSKRTNKKQNDDDGEA	nucl(11),mito(10),cyto_nucl(9),cyto(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQV8	DDE_3 domain-containing protein	Low	9.9	1	331-357	AIDSVLKKRPKLRKKYKRPEPGTDRLY	cyto(10),mito(6),nucl(5),pero(3),cysk(3)	KKRPKLRKKYKRP (337-349, prob:0.962)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LSV8	DUF221 domain protein, putative	Low	5	1	296-316	SVAARWVKRKDRPTHRLKFLI	plas(23),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZT4	Beta-ketoacyl-[acyl-carrier-protein] synthase I	Low	6.9	1	163-183	LIAHKLKKSWRELDRKQTIKQ	cyto(12),mito(7),nucl(5),cysk(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0X4	Uncharacterized protein	Low	5	1	1-20	MKGLFKKSLKSLRKPGKGEA	mito(22),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4G4	Uncharacterized protein	Low	8	1	88-107	IPQDRYNARRRKWKNLYSIF	mito(9),extr(8),plas(6),golg(2)	SKRKIGSSRRRSIQASLRKRK (135-155, prob:0.848)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5I5	C6 transcription factor, putative	Low	8	1	32-58	VPKVSKARACAECKRHKIKCEVKPGET	nucl(9),cyto(7),plas(6),mito(4),cyto_pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6F3	MFS multidrug transporter, putative	Low	5	1	488-507	NFAARWRGKDREKSEQKDGE	plas(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6Y2	37S ribosomal protein Rsm22	Low	9.5	1	796-835	LENQARSLERRKKGHNIPSWKRHADKKRIRQAVRKVSSNT	mito(14.5),cyto_mito(10.333),nucl(6.5),cyto_nucl(6.333),cyto(5)	ERRKKGHNIPSWKRHADKKRIRQAV (804-828, prob:0.94)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MER5	Integral membrane channel protein, putative	Low	5.7	1	1-24	MLASLLRPRKPRQHVLRSASPHET	plas(22),nucl(2),mito(2),mito_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIV6	Uncharacterized protein	Low	9	1	86-112	DLRAAHEKEKQKRQRSKQQVSHKQGIT	mito(13),nucl(10),cyto(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIX5	Nonsense-mediated mRNA decay factor (Upf2), putative	Low	9	1	1112-1135	TEQPEEKRPSRDNRMDKSNRPGFR	nucl(14.5),cyto_nucl(12.5),cyto(9.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKP5	Uncharacterized protein	Low	5.4	1	276-299	QSSYDRKKAARNRHQQNNNNNGRS	plas(19),E.R.(3),vacu(2),nucl(1),mito(1),golg(1),mito_nucl(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPK9	Sodium P-type ATPase, putative	Low	8	1	226-251	ALRSSDSKRRPVKRGPTGKAKKRSYV	plas(24),E.R.(2)	SKRRPVKRGPTGKAKKR (232-248, prob:0.944)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSP7	Serine-rich protein, putative	Low	9.8	2	2-21, 708-733	SRPSSSVSPRRRPLHERTPS, QYRIAQYEKKRYQNARWWRNVNRVMI	plas(15),nucl(8),mito(2),cyto(2),cyto_mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW55	MFS multidrug transporter, putative	Low	5	1	418-437	LLNQRFYISRFKKNNNRPVP	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWF5	TPR domain protein	Low	6.8	1	1-22	MGKSRTKNKKSSTKSEKSVLHS	mito(14.5),cyto_mito(10.166),nucl(8),cyto_nucl(7.333),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0K5	Uncharacterized protein	Low	5.3	1	278-302	AGIASFVRRRRQQRKQQQQIPDIDD	extr(23),nucl(1),mito(1),cyto(1),plas(1),cyto_nucl(1),cyto_mito(1),mito_nucl(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M153	RTA1 domain protein	Low	8	1	370-397	CCGYCCCCCCRRGRKKKVAVSRGSERQE	plas(22),E.R.(4)	RKK (383-385, prob:0.634)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M319	Sister chromatid separation protein (Src1), putative	Low	9.8	1	222-244	QTPRTRTISRERKRKSTPRVSGD	cyto(6.5),cyto_nucl(6.5),nucl(5.5),mito(4),extr(4),plas(2),E.R.(2)	RKRK (233-236, prob:0.627)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4M5	Very-long-chain acyl-CoA synthetase family protein (CefD1), putative	Low	5	1	555-577	FLRVTRKGARHTHNNKQNKVPLR	extr(14),cyto(6),E.R.(4),cyto_mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9R5	20S-pre-rRNA D-site endonuclease NOB1	Low	7.3	1	390-410	EYVRAVTDEKRQQRRERDLMD	cyto(14.5),cyto_nucl(12.833),nucl(10),mito_nucl(6.333)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBQ2	Sad1/UNC domain protein	Low	6.2	1	723-749	QTPPTVNPSKKKAHRRQCSNALRHESI	plas(10),extr(4),nucl(3.5),cyto_nucl(3.5),E.R.(3),cyto(2.5),golg(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDV1	Pre-mRNA-splicing factor	Low	8.7	1	22-46	ALAQKHWLKQSKIRKVKQDVIKKEI	nucl(12.5),cyto_nucl(9.5),pero(6),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDZ5	Dynein intermediate chain, putative	Low	9.5	1	10-36	AKKAKLAELKRQRELRQKEFNQNRASI	nucl(15),mito(9),cyto_nucl(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGA9	Uncharacterized protein	Low	5	1	287-311	HMYGRKIQVKGQPKKYYRRRDMADE	plas(19),E.R.(4),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLJ2	Uncharacterized protein	Low	8	1	545-566	TSTSARRRTRSRSRSVPPPYER	extr(15),plas(6),E.R.(3),golg(2)	RRRRRDLASRREELRARRAYRNAARRLR (427-454, prob:0.899)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN95	Uncharacterized protein	Low	8.4	1	52-82	EDYTETPKPNPRGKKKKKKGHKNARADLERI	cyto(10.5),cyto_nucl(6.5),plas(4),E.R.(3),extr(2),mito(2),nucl(1.5),pero(1),golg(1),cysk(1),vacu(1)	KPNPRGKKKKKKGHKNAR (59-76, prob:0.997)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP14	Monooxygenase, putative	Low	9.1	1	493-512	KLQKIRARFAREKVERERKE	cyto(10),cysk(9),cyto_nucl(8),nucl(4),pero(4)	AGKLQKIRARFAREKVERERK (491-511, prob:0.778)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV34	Sulfatase domain-containing protein	Low	5	1	169-191	RSRQCLPLTNKPKEPRRRKYLAL	plas(18),E.R.(5),extr(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUG5	Uncharacterized protein	Low	7.9	1	267-286	QFARGTKKGRRSALRLKGLS	mito(11),nucl(10),cyto_nucl(8.5),cyto(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVB9	Uncharacterized protein	Low	7.8	1	354-376	SGDPTNRSSKKPRRAQWDKDLVI	nucl(10.5),cyto_nucl(10.5),cyto(7.5),mito(3),golg(2),plas(1),extr(1),pero(1),E.R.(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYS4	FK506-binding protein	Low	9.1	1	301-326	KESASKGDSKKQQKKLKKNNGDAVPV	cyto(19),cyto_nucl(12.5),nucl(4),mito(2)	SKKQQKKLKKNN (309-320, prob:0.802)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8M0	Fungal_trans domain-containing protein	Low	9.1	1	57-79	VDWMPNRKEKRLKQLERENRDLI	nucl(12),extr(8),mito(3),cyto(3),cyto_mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD70	Uncharacterized protein	Low	6.5	1	317-336	ELEKERKRIAKEKAEKQLTR	mito(19.5),mito_nucl(13.666),nucl(6.5),cyto_nucl(4.833)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJH6	DNA helicase	Low	9.7	1	889-908	NYRIQPQRYKPPRPVPLSAK	nucl(14),cyto(8),mito_nucl(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJI6	Serine/threonine-protein phosphatase	Low	9.4	1	483-507	DSSALKNHIKKGRNKRNSMLNSPPA	nucl(17),cyto_nucl(12),cyto(5),pero(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3T8	Amino-acid acetyltransferase, mitochondrial	Low	6.3	1	58-82	AYLSRFPSVKKPKPPIPRQNQGAVE	cyto(12),cyto_mito(9.833),cyto_nucl(9.333),mito(6.5),nucl(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6J8	Uncharacterized protein	Low	5	1	30-55	RDVRSHAGRWRWRQARKGQYDKSELN	plas(11),mito(9),extr(3),cyto(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8B5	F-box domain protein	Low	9.9	1	979-998	MNTINERRKSKGKNSRCIVM	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFH4	C6 transcription factor (AmdR), putative	Low	9.4	1	49-74	QSSGKLDCRIHEKKKRPITRSALNPV	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJN0	Zn(2)-C6 fungal-type domain-containing protein	Low	8.2	1	6-34	SAFFACEQCRERKRRCDKAKPKCSSCTYL	plas(15),nucl(8),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML25	Uncharacterized protein	Low	9.7	2	579-601, 662-681	NEPNQPAKLRTPKRRTTLTKLNT, KETPEIPKTPEKKQNTPRAA	plas(17),nucl(7),cyto(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPD9	Uncharacterized protein	Low	9.5	1	8-37	NVLSSSEKKRLRDRRAQQTLREKRQNRMLE	nucl(16.5),mito_nucl(12.5),mito(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS66	Polyketide synthase, putative	Low	5	1	2254-2273	SVVCVNRRSRQQPLERQHRS	plas(14),cyto(3),E.R.(3),mito(2),extr(2),cyto_nucl(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3N3	C6 transcription factor, putative	Low	8.1	2	2-32, 60-85	SRSLRSTKGCWTCRLRRKKCDERHPVCQLCH, SLKQTVRYTSRQRDRARPQPLRSQSQ	plas(16),mito(5),nucl(3),cyto_mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5P6	Endo/exonuclease/phosphatase domain-containing protein	Low	8.4	1	812-831	KTDFRRITRWSQRQFWREKL	nucl(14),cyto_nucl(11.333),cyto(6.5),cyto_mito(5.666),mito(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7W3	MFS transporter, putative	Low	8	1	20-48	FLDPSQPKNERPSRKEKNASREKLRIRLM	plas(27)	PSRKEKNAS (31-39, prob:0.665)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGF1	Aldehyde dehydrogenase, putative	Low	6.5	1	52-82	VESCSRAFQKWKKTSPERRRKLLQRLAQLIR	cyto(11),cysk(6),nucl(4),pero(3),mito_nucl(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPD2	Phosphatidylinositol transfer protein PDR17, putative	Low	7.2	1	341-362	LTEHRRKAYKERWVRSGRKIGE	cyto(10.5),cyto_nucl(10.5),nucl(7.5),mito(4),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVG7	Methyltransf_25 domain-containing protein	Low	6.1	1	284-303	ARLLSQKKRKQDYKGWTEDY	cyto(15.5),cyto_nucl(10.333),nucl(4),pero(4),mito_nucl(3.833)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTW8	SAP domain-containing protein	Low	9.6	1	65-88	NHSTSEHKSKTKERKKSGKELSIL	mito(20),nucl(4.5),cyto_nucl(4)	SKTKERKKS (73-81, prob:0.723)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXE6	Chitin synthase	Low	8	1	57-87	SEKRTLRRELWIKRKKSQKATLKIKTNQTDE	plas(25)	RRELWIKRKKSQKATLK (63-79, prob:0.833)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGG0	IZH family channel protein (Izh3), putative	Low	5	1	28-48	ETPLIRSRRRHSFQHARRSSC	plas(20),E.R.(4),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIB0	Non-specific serine/threonine protein kinase	Low	8	1	663-693	ELNLQEPTKKKKRQRGQRGGKSHKRKPKPGS	plas(9),extr(7),E.R.(5),golg(2),vacu(2)	KKKKRQRGQRGGKSHKRKPKP (671-691, prob:0.995)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MM44	Zn(2)-C6 fungal-type domain-containing protein	Low	9	2	4-23, 61-83	SVNRRNPKLRSACNRCYELK, KAVSRLSSGKCRRQQQHQPTIDS	mito(15),nucl(6.5),cyto_nucl(6),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU02	Uncharacterized protein	Low	9.5	1	29-57	ERPTWRKKAGRFVKVLKRTKNQARRTDAT	plas(20),nucl(4),cyto(2)	RKKAGRFVKVLKR (34-46, prob:0.677)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV34	Beta-ketoacyl-[acyl-carrier-protein] synthase I	Low	8.1	1	1575-1595	TYEEYRQKATRRQRAANSVFI	nucl(9),cyto(8),mito(6),cyto_pero(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1Y2	Uncharacterized protein	Low	5.7	1	36-64	VSASKQRNTRETSQTRRHRKTLKVQENAH	mito(14),cyto(9),nucl(2),plas(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4J5	L-ornithine N(5)-monooxygenase	Low	8.4	1	154-176	GQELSKHKRKKIRNISQFPREAE	plas(7),golg(6),cyto(4),E.R.(4),mito(2),nucl(1),extr(1),pero(1),vacu(1)	KRKK (161-164, prob:0.66)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M745	Patatin-like serine hydrolase, putative	Low	5	1	526-551	IELDRCYQMVRRRRRRSDVSQQPAVV	plas(9),cyto(7.5),extr(5),cyto_nucl(4.5),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFE5	Uncharacterized protein	Low	9.5	1	774-794	LKRSSRPSSVHQRPARNRSIE	nucl(17),cyto_nucl(11.5),mito(5),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKJ6	Glutamate decarboxylase	Low	6.9	1	508-530	RLQTHPDRTRLERKRHHFKELGQ	cyto(14.5),cyto_nucl(11.5),nucl(7.5),pero(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML29	Translocation protein SEC62	Low	8	1	326-354	SFKPLWGWQEKKKKKVKLSKKAKSAPSAD	plas(24),E.R.(2)	KKKKKVKLSKKAKS (336-349, prob:0.972)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWX6	Biphenyl-2,3-diol 1,2-dioxygenase, putative	Low	7.9	1	1-21	MSSHPKSQKRSHPSPDKLAHV	mito(12),nucl(8),cyto_mito(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0V6	Uncharacterized protein	Low	7.1	1	100-129	WAYGRFSKYFRPPPKPTCRQPPPKLRLPCP	mito(11),nucl(6.5),cyto_nucl(6),cyto(4.5),extr(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9B2	C6 finger domain protein, putative	Low	9.5	2	11-52, 63-89	GSRNAAKSHFRPKQRISHTKSRNGCYTCKLRRVKCDEVRPVC, VYPSPGDTRGQRRRQRPGSRERPSSES	plas(16),nucl(7),cyto(1),pero(1),E.R.(1),golg(1),cyto_pero(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHD5	Mitotic check point protein (Bub2), putative	Low	7.2	1	19-41	APPASPQSPRRLRKYQSHQSLTS	mito(14),nucl(7),cyto_nucl(6.5),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHG3	Endo/exonuclease/phosphatase domain-containing protein	Low	9.1	1	519-538	LTYVRKKKGIRTSQLRPFTT	nucl(15.5),cyto_nucl(12.5),cyto(6.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK52	Alternative NADH-dehydrogenase	Low	7	2	51-76, 481-503	ASEAAAQPPKKKRFRVLRWTWRLTWL, FDEIKERQRQLRRTKQIGPFQYS	mito(22.5),cyto_mito(13.5),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLW8	Uncharacterized protein	Low	8.8	1	174-195	QGHSPRQHSNQRGRKKCFRINQ	nucl(15),cyto_nucl(12.5),cyto(8),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPV6	Uncharacterized protein	Low	8.2	1	126-149	DTSTPQPRPAQRPQRNRQLPARYR	nucl(12),cyto_nucl(12),cyto(8),mito(3),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV35	C2H2-type domain-containing protein	Low	9.5	2	23-47, 129-150	VCEQTFPRRNDWKRHVKPHYVEKIW, NPLQRIQPRRTVKQRNPKTLGG	mito(18),nucl(9),cyto_mito(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUC7	DDENN domain protein	Low	9.5	1	159-182	AITPNVKPPKPRPKVQKIVSEDRP	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUF3	L-ornithine N(5)-monooxygenase	Low	9.1	1	556-580	ESKLTTEGLKQRRRKALRRSIALVL	cyto(11),mito(5),nucl(3),plas(3),pero(2),extr(1),E.R.(1),golg(1)	RRRK (567-570, prob:0.644)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2B7	Uncharacterized protein	Low	9.8	1	32-53	ALWIHRSPQQRQKWNKVCKIIN	nucl(19),cyto_nucl(14.5),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4W0	Apple domain-containing protein	Low	8	1	440-460	SFSYRFGEKRPPKSDGKRYKS	golg(10),extr(9),E.R.(5),mito(2)	PPKSDGKR (450-457, prob:0.622)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5I3	Uncharacterized protein	Low	8	1	492-513	PDATNEKAKRSKKKGFLPAMVR	plas(23),E.R.(2)	AKRSKKK (499-505, prob:0.718)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9L0	Uncharacterized protein	Low	9.2	1	124-148	KYICANWKTKWQKPMLKKVRDLWIS	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA56	Non-specific serine/threonine protein kinase	Low	8.3	1	2368-2391	DPTTDFIGKKRRTHKDVPDTPEGV	nucl(12.5),cyto_nucl(10.5),cyto(7.5),plas(3),mito(1),pero(1),golg(1),cysk(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB71	Zn(2)-C6 fungal-type domain-containing protein	Low	7.6	1	4-37	RRFHTKSRYGCLQCKHSRKKCDENRPQCGRCEKA	nucl(8),mito(8),mito_nucl(8),plas(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEU5	DNA damage-binding protein 1	Low	6.5	1	140-160	VIPIIQPHKKRGKPPVLKTSH	cyto(13),cyto_nucl(10),mito(6),nucl(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWB3	Florfenicol exporter, putative	Low	5	1	516-541	IWIEWKYGEKWRREREKRFAAREGDN	plas(23),E.R.(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0A9	Uncharacterized protein	Low	8.5	1	108-130	ACLQKTIQRHTRRQEKYKRVLAT	nucl(17),mito_nucl(13.333),cyto_nucl(9.833),mito(8.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M142	Short-chain dehydrogenase, putative	Low	5	1	1-31	MAPGKKSHPYQKHTSKKRLPPETKTNTHQRF	mito(15),cyto(9.5),cyto_nucl(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8D1	Histidine kinase	Low	9.8	1	70-98	DLETELQYKRPRRSRRLKRKYDDDDDDDD	cyto(15.5),cyto_nucl(11.5),nucl(6.5),mito(2)	KRPRRSRRLKRK (78-89, prob:0.88)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD18	BTB domain-containing protein	Low	8.9	1	363-388	KYVVRCKECLNTKHPRRNRGWNTASG	nucl(14.5),cyto_nucl(12),cyto(8.5),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDA3	Anion exchange protein, putative	Low	5	1	14-39	TSSSLRHRSERAHRRHQGRSSNDQNG	plas(20),E.R.(3),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDE2	Zn(2)-C6 fungal-type domain-containing protein	Low	9.9	1	11-67	AGYEYPVKQRKVRKGTRSCWECKRRKVRCSFSAINDNSTVCVACRKRRTPCVSQEFL	nucl(18.5),cyto_nucl(11.5),cyto(3.5),mito(2),plas(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME41	Uncharacterized protein	Low	9.1	1	313-332	AILTKLPLRRSKRLRLSVAA	nucl(14),cyto_nucl(10.5),cyto(5),mito(3),plas(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEJ7	Zn(2)-C6 fungal-type domain-containing protein	Low	7.8	1	9-48	KSRHGCLTCKSRKVKCDFQRPVCSHCSRRKERCRYTEDAP	mito(11),nucl(7),plas(5),cyto(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIQ0	Protein-serine/threonine kinase	Low	9.2	1	101-121	VKAHLIRPMRNHKKDSKPLSE	nucl(11),mito(9),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNX1	Fasciclin domain family protein	Low	5	1	115-134	FEEKHFKGKHHKAKHGDDEV	extr(17),E.R.(4),cyto(2),golg(2),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU82	Uncharacterized protein	Low	9.6	1	104-126	YFDGKFPDKKRRRILQKMAPSVF	nucl(17.5),cyto_nucl(13),cyto(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV51	Kinesin, putative	Low	9.7	1	332-351	QCTRCWKWHNARSCARPSRC	nucl(16.5),cyto_nucl(11),cyto(4.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUI4	Uncharacterized protein	Low	9.9	1	124-143	LSPQILPKRLPRRAKQCVAE	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVV5	C6 transcription factor, putative	Low	9.5	1	36-62	AHTLTACTRCRQRKSRCDPGIPRCEPC	nucl(13),mito(10),cyto(2),pero(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGI4	FAD dependent oxidoreductase, putative	Low	5	1	3-23	LTSPRRQLCRHLQLLQCRRQQ	mito(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGJ5	Fungal specific transcription factor, putative	Low	9.4	1	560-590	RLHQPNSQSTQPKRRSKRRKKTSADHEDDHT	plas(13),nucl(4),E.R.(4),vacu(3),cyto(2),mito_nucl(2)	PKRRSKRRKK (571-580, prob:0.944)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIZ2	Uncharacterized protein	Low	8.6	1	12-31	SDLKAQKKPQYAKIARKYNV	nucl(12),cyto_nucl(9.5),mito(7),cyto(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN62	CCHC-type domain-containing protein	Low	7.9	1	359-381	CQKMGHKAFSCKKKQTCAKCAAE	cyto(11.5),cyto_nucl(11.5),nucl(10.5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPN2	Kinesin light chain, putative	Low	9.1	1	207-234	TCEHCDKEKLYKRQPRKTRTPQIHYGLI	nucl(13.5),cyto_nucl(9),cysk(4),cyto(3.5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSY4	CobW domain protein	Low	7.6	1	533-552	DSIARQKRKASHHLGHEHKH	nucl(9),cysk(9),cyto_nucl(8),cyto(5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU71	NACHT domain-containing protein	Low	9.7	1	379-401	LPSHRHILRIRKNQKYEPKLKMF	nucl(15.5),cyto_nucl(9.5),mito(5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUJ9	Reverse transcriptase, putative	Low	7	1	62-82	LNRHCKQIKLCARSKRWWNSE	cyto(10.5),cyto_nucl(9),pero(7),nucl(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTM0	Ubiquitin carboxyl-terminal hydrolase	Low	8.3	1	67-91	VLALNVRRTRKKVQRDEPPQKISKL	nucl(12.5),cyto_nucl(12),cyto(8.5),pero(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUH1	DnaJ domain protein	Low	5	1	233-254	TAEDARRKQRRSQQMQREREIL	extr(20),mito(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVE1	Pentatricopeptide repeat protein	Low	8.4	1	24-44	TKYPSRSTEKVNPKRQNAALR	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(3),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVP1	Calcium channel subunit Cch1	Low	8	1	1923-1943	EEFLRRRTRLRRVEEAVRRNT	plas(25)	RRGRRRSSGARSGHGPR (40-56, prob:0.795)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXE8	Small oligopeptide transporter, OPT family	Low	5	1	643-665	ITWALWKYTKKNYWKKVNWPLFW	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0A5	Uncharacterized protein	Low	9.7	1	746-767	QHLWDRHYFRRLRGRKRKVEEL	mito(13.5),cyto_mito(10),nucl(6),cyto(5.5)	RLRGRKRK (756-763, prob:0.733)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M106	Palmitoyltransferase	Low	5	1	459-488	IHCMVRKPLRSKHCRRCSRCVAKHDHHCPW	plas(24),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M430	Mannosyl phosphorylinositol ceramide synthase CSH1, putative	Low	5	1	325-347	LVIWRCCCRSRKAKHNTTGGLKT	plas(18),E.R.(4),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M973	Uncharacterized protein	Low	8	1	227-252	ALISVYIHHRRRRKRPVEHPGMPPTE	extr(17),cyto(6),mito(3),cyto_pero(3)	RRRRKRP (236-242, prob:0.797)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9X8	Monooxygenase, putative	Low	5	1	409-429	PDTTRRTTERRPWRLYRRLIS	cyto(11.5),cyto_nucl(7),extr(4),pero(4),mito(3),cysk(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAE9	Uncharacterized protein	Low	8.3	1	9-31	VVEYQYPKPKKPSKLPLIPCGAS	nucl(15.5),cyto_nucl(13.333),mito_nucl(10.832),cyto(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCX0	RAS small monomeric GTPase (Rsr1), putative	Low	8.9	1	191-212	AASGNAKEARRRSRRRGQCVII	cysk(22),nucl(2.5),cyto_nucl(2.5)	ASGNAKEARRRSRRR (192-206, prob:0.867)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEA0	ABC multidrug transporter, putative	Low	7	2	56-85, 1278-1300	QDEGQKPGVQKRKWYRKLNPLRLRKVPSVP, TDEEKKQTVKSQQQQQQQQQTQN	plas(21),E.R.(3),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEZ1	DNA helicase recq1, putative	Low	6.9	1	207-229	ADDNHKDNKRQHRPPQGHKRWAG	nucl(6),cyto(6),cyto_nucl(6),cysk(6),mito(4),cyto_pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKH5	Uncharacterized protein	Low	7.9	1	197-248	LNTATNLPKKQKKRTKAQIEDYINARRNGACLKHKKQHKKCNCHEKQSAKSH	nucl(10),cyto_nucl(10),cyto(8),plas(4),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLX7	Sulfatase domain-containing protein	Low	5	1	184-205	ITRGRFCRTKRHSPNDQYYQIT	plas(11),extr(5),E.R.(5),mito(3),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNZ4	MFS transporter, putative	Low	8	1	297-319	VASLRAARRKKRQAKLRNIDNVL	plas(24),E.R.(2)	AARRKKRQAK (302-311, prob:0.829)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR01	C6 transcription factor, putative	Low	7.5	1	5-37	RTHTKSRLGCVQCKQRRIKCDEQRPVCKNCFRH	plas(12),nucl(7),mito(5),cyto(1),pero(1),E.R.(1),cyto_pero(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUQ9	Pro-apoptotic serine protease NMA111	Low	5	1	3-24	RDRLPHWLRKWQINKQKTIKSV	mito(21),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT64	Uncharacterized protein	Low	5	1	67-88	LLSLVYKRYRERPQRPLKIWAF	plas(16),E.R.(5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVJ4	Aquaglyceroporin, putative	Low	8	1	594-627	VNYPLDRTKRSLKKSRAKWSRRLHLTPKEAKKGA	plas(20),E.R.(3),mito(2)	TKRSLKKSRAKWSRRLHLTPKEAKKG (601-626, prob:0.946)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYX1	Succinate dehydrogenase assembly factor 3, mitochondrial	Low	6.4	1	31-51	IPLYRRLLRVHRKKLPPQMRL	mito(20.5),cyto_mito(11),nucl(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M154	Longevity assurance factor, putative	Low	8	1	11-63	GSDHGGTRQRRQVDKKKPSTEIAKPPNEKSNIEKIRRRKYRPVWKRLANFGLK	plas(24),mito(3)	RQVDKKKPSTEIAKPPNEKSNIEKIRRRKYRPVWKR (21-56, prob:0.949)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5F6	MFS transporter, putative	Low	5	1	472-491	FDNVRRNRRAGRKIDARDVP	plas(24),E.R.(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA88	Alpha-1,3-glucosyltransferase	Low	5	1	1-24	MASSPVSYRPRQKKKLPTTFSGSS	plas(20),E.R.(3),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBP5	HET-C domain protein HetC	Low	5	1	797-816	QGYREHREHREHEHRRDQDN	extr(20),golg(3),mito(1),cyto(1),pero(1),E.R.(1),cyto_mito(1),cyto_pero(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBR4	SNF2 family helicase, putative	Low	7.1	1	20-41	QENAHRPTKINRKDRVNNSTPL	cyto(12),cyto_nucl(11.333),nucl(9.5),cyto_mito(8.333),mito(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGR1	Peroxisomal ABC transporter (PXA1), putative	Low	9.5	1	57-78	SLLLKRSKERAQGRRMLRRNSG	mito(8),cyto(6),mito_nucl(6),nucl(4),extr(3)	RSKERAQGRRMLRRNS (62-77, prob:0.725)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIL0	MFS monosaccharide transporter, putative	Low	5	1	825-847	NMLSRSKEPAKRSQYRRVDQDEE	plas(24),mito(1),E.R.(1),golg(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIM8	AMP-binding enzyme, putative	Low	5	1	669-688	LTPTLKMKRPPIVKKFRALL	cyto(12),mito(6),pero(5),mito_nucl(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIV4	Translation elongation factor eEF-3, putative	Low	8.9	1	1030-1065	ETKKKAKLSAGELRKKRKERMARRKRGEERWLNIGK	cyto(21.5),cyto_nucl(13),nucl(3.5)	KKKAKLSAGELRKKRKERMARRKRGE (1032-1057, prob:0.998)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJX9	ABC bile acid transporter, putative	Low	5	1	45-65	LLSSKYLYRWRPKWTHPFVYE	plas(16),mito(4),E.R.(4),vacu(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK79	Amino acid transporter, putative	Low	8	1	333-354	RPDTPGMKRRKHKERAPKGTNT	plas(23),mito(2),E.R.(2)	MKRRKHKERAPK (339-350, prob:0.883)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNB5	Zn(2)-C6 fungal-type domain-containing protein	Low	6.2	1	10-39	RATIVCLQCKMRKRKCDKRLPCCSNCDRVQ	plas(17),mito(4),nucl(3),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSQ2	Homoaconitase, mitochondrial	Low	5	1	2-23	LASTRCPQWRATRQYIHRPSSS	mito(24),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWL1	Uncharacterized protein	Low	8.8	1	126-153	EPKPSASSNKRQRGYKRRLSKNACIWCY	plas(11),nucl(10),cyto(3),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ44	Uncharacterized protein	Low	5	1	22-42	GKFQYRRCSRHPQPIRSNMMN	mito(25.5),cyto_mito(14)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZI3	Uncharacterized protein	Low	8.3	1	126-147	LDALRKYTRKRGRAFPREEAKE	nucl(13),cyto_nucl(12),mito(7),cyto(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M110	Protein kinase, putative	Low	9.5	1	137-159	SLPNTRPRTSPKSPSKRVLNISS	nucl(18.5),cyto_nucl(14),cyto(8.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M874	Zn(2)-C6 fungal-type domain-containing protein	Low	8.2	1	43-72	GIQRRNRKPVSCTPCRQRKLRCDQALPVCD	nucl(11),cyto_nucl(10),cyto(7),plas(4),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9Q1	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	Low	9.6	1	74-93	VNTGRRSNKRGGKRKAAALN	cyto_mito(10.333),cyto(10),mito(9.5),cyto_nucl(9.333),nucl(7.5)	RRSNKRGGKRK (78-88, prob:0.82)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCV9	Uncharacterized protein	Low	9.7	1	399-421	TSFAYKRKEFRAKWGKRFRMINL	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG12	Thij/pfpi, putative	Low	5	1	191-212	ELNWIKKKYPNVKWTNEKKWIV	cyto(24.5),cyto_pero(13)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG82	Zn(2)-C6 fungal-type domain-containing protein	Low	9.5	1	11-37	LHPIACEPCRQKKCKCDREIPVCSQCL	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJS5	Aspartic-type endopeptidase, putative	Low	5	1	533-554	VLYTIGKKRREENKTNNGNNAS	extr(17),plas(6),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRF9	Leucoanthocyanidin dioxygenase, putative	Low	9	1	17-41	EKARDPSKFKARTRYSGRINKQNTM	nucl(10),mito(8),plas(4),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUN3	Uncharacterized protein	Low	9.2	1	114-137	TEPQEADKRLRQTKRQRKIGTPDQ	nucl(15.5),cyto_nucl(12),cyto(7.5),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUR1	Cytochrome P450, putative	Low	6.5	1	479-498	TAVPYNWPCRLRRRPKQQHA	cyto(7),mito(6),nucl(4),pero(4),plas(3),extr(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTF4	Uncharacterized protein	Low	9.6	1	1-20	MPVIWRPQPRRLPRPFVEDE	nucl(17.5),cyto_nucl(12),mito(5),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6Q8	Ubiquinone/menaquinone biosynthesis-related protein	Low	7	1	34-54	AVSSKKPSQLKRPTRTDAFRD	mito(13),cyto(7),nucl(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU05	40S ribosomal protein S24	Low	9.5	1	97-133	AAAKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKSKD	mito(18),cyto(5),nucl(4)	AAKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKSKD (98-133, prob:0.997)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUN1	Pro-apoptotic serine protease NMA111	Low	5.5	1	31-50	DPNAIKYKRITKLKLNPDGA	cyto(22),cyto_nucl(13),nucl(2),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYZ6	FAD binding domain protein	Low	5.4	1	20-40	LLILRRKKAVREQQPPAPPKP	extr(9),cyto(7),mito(6),nucl(1),plas(1),pero(1),E.R.(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M173	Lipase/esterase family protein	Low	9.7	1	674-716	VAQKTRTSRKRSISKPDRGKLAPPPADERSRSRPRNRSRIVSD	cyto(11),cyto_nucl(9.833),cyto_mito(7.833),nucl(7.5),extr(4),mito(3.5)	RTSRKRSISKPDRGKLAPPPADERSRSRPRNRS (679-711, prob:0.915)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5J1	Zn(2)-C6 fungal-type domain-containing protein	Low	9.8	1	12-57	CSLCGKPFTQERQHRRHQAYCRRNQSRLRTRPRSCRACNQAKIKCN	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6C6	DUF28 domain protein	Low	6.8	1	36-59	GHSRWSTIKHDKAKNDKAKSKERG	mito(13),cyto_nucl(6),nucl(5.5),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCQ0	Uncharacterized protein	Low	7.3	1	342-364	CRKLYCWSTKHSKEERQRAYNEF	mito(11.5),cyto_mito(9.5),nucl(8),cyto(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJN4	Uncharacterized protein	Low	9.9	1	85-105	RDTAKRKAAKRTKRQVKAVGA	mito(8),extr(7),nucl(5.5),cyto_nucl(5),cyto(3.5)	KRKAAKRTKRQ (89-99, prob:0.854)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPH6	Maltose permease, putative	Low	5	1	471-490	DLRFEKKISARKFRKTAINH	plas(19),E.R.(4),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV54	Telomere-associated RecQ helicase, putative	Low	8.8	1	357-379	EDNERQHRPPRGHKRVRSHPVTE	mito(15.5),cyto_mito(11.5),cyto(6.5),nucl(3)	PRGHKR (366-371, prob:0.636)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTU3	Calcium binding protein Caleosin, putative	Low	6.7	1	224-246	DGSLFWRIREQRKQPKGWQQGYG	cyto_nucl(6),nucl(5.5),cyto(5.5),extr(5),E.R.(3),mito(2),plas(2),pero(2),golg(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M353	MYND domain protein (SamB), putative	Low	8.4	1	192-217	QDNTHPPHHHHHHRHHHHHNNSNNNE	nucl(14),cyto_nucl(12.333),cyto(8.5),cyto_mito(6.666)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBQ9	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	Low	5	1	8-29	HAVHRSCRRTLVRRQVATRKFS	mito(22),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIL6	ER to Golgi transport protein (Sly41), putative	Low	5	1	76-95	SWDHHRPASKHRPRKSISET	plas(24),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ60	C6 transcription factor, putative	Low	7.7	1	11-33	ACDTCRSKRTKCDGLRPSCNPCQ	plas(10),nucl(7),mito(5),cyto(2),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLB0	Uncharacterized protein	Low	8	1	28-54	RLEGIRPKTRRSRRHYGFKQWIPFRKG	cyto(20.5),cyto_nucl(12),pero(3)	R (38-38, prob:0.602)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP92	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	1	316-336	TYLRQRQKSGPRRLRQSSKKI	nucl(10),mito(10),mito_nucl(10)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ50	Mitochondrial thiamine pyrophosphate carrier 1	Low	6.2	1	475-496	FEYLKRRLVARKARQEKCHEDD	plas(15),cyto_nucl(4),nucl(3.5),cyto(3.5),mito(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTY3	alpha-1,2-Mannosidase	Low	5	1	826-849	QSKNKNDTKSSRHQKSKQEQTIIR	extr(19),mito(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUT1	Uncharacterized protein	Low	5	1	3-24	LPPNANRPPKRLKRSTTEPLAG	mito(15.5),cyto_mito(10.833),cyto(5),cyto_nucl(4.333),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTI6	37S ribosomal protein S5	Low	9.1	1	36-63	LYARKPPGPRPTAKKPGQKKTWDDIEKK	mito(19),cyto_mito(12),nucl(4),cyto(3)	RKPPGPRPTAKKPGQKK (39-55, prob:0.865)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX36	Bicyclomycin resistance protein, putative	Low	5	1	55-74	ANKHDKLRPVPVPRLKRRGL	plas(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYB2	Uncharacterized protein	Low	7.6	1	211-230	ANHPHSRKVKWQANRRWVRT	mito(11),nucl(8.5),cyto_nucl(6.5),cyto(3.5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRN9	DNA mismatch repair protein (Pms1), putative	Low	9.7	1	547-568	NTERTRKSKRRVHTPSRPNIFS	nucl(23.5),cyto_nucl(14.333),mito_nucl(12.666)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV92	Uncharacterized protein	Low	9.9	1	225-246	ALVTRGRRPNRRTSSRNLRNGG	nucl(18),cyto_nucl(13),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV46	WD repeat protein	Low	9	1	825-848	ISSSTISSKKRSQRKQSASNATAV	nucl(14.5),cyto_nucl(11),cyto(6.5),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3J8	Long chain fatty alcohol oxidase, putative	Low	7.8	1	779-805	HSKNRHGCIPCKRRRVKCNLARPICRN	nucl(9.5),cyto_nucl(8.5),cyto(6.5),plas(5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6R9	Uncharacterized protein	Low	9.5	1	603-637	APEETTPSQTRRRRNRMGQRQRRRLHELNENQTQR	extr(13),nucl(4),cyto(2),plas(2),pero(2),E.R.(2),cyto_pero(2)	RRRNRMGQRQRR (614-625, prob:0.678)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7M2	Protein serine/threonine kinase (Ran1), putative	Low	7.5	1	68-87	GLDPRQRKFQQREIKLHHLA	cyto(10.5),cyto_nucl(10),nucl(8.5),mito(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7N7	Mitochondria protein Fmp29, putative	Low	6.5	1	54-73	DDLFRYQRHRWLRNDAKEQD	mito(22),nucl(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDQ1	ABC multidrug transporter Mdr1	Low	5	1	42-63	SSSNTSSDKKSPKEKTEKLTAT	plas(23),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFW0	Uncharacterized protein	Low	5	1	75-98	VTPPPPRCRERPRGSKNKQKVDVN	mito(18),cyto(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFY4	Uncharacterized protein	Low	6.9	1	732-752	QWHSLPPDQPRAKKRLRTSDD	extr(9),plas(7),nucl(5),cyto(3),mito_nucl(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIY3	Cytochrome P450, putative	Low	7.1	1	168-191	SVHSTRDKRDHARRRKMWDRAFSS	nucl(6),cyto(6),cyto_nucl(6),mito(5),plas(3),extr(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJI8	Uncharacterized protein	Low	9.5	1	21-46	TDVPHHLNSRTRKRVRDNRPDQQTVY	nucl(15.5),cyto_nucl(10.5),cyto(4.5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ38	Nonribosomal peptide synthase GliP-like, putative	Low	7.5	1	143-165	EELTARRKADQKFHRPWERIQPD	nucl(9),cyto_nucl(8.5),mito(8),cyto(6),plas(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV56	Uncharacterized protein	Low	7.7	1	313-339	ESQERQSQYRFTRRQKEAWKRLVQIAQ	nucl(9),cyto_nucl(7.5),cysk(6),cyto(4),pero(4),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU49	Uncharacterized protein	Low	9.3	1	168-195	KEQNRIRECGNRRYRRRAKTRNGDEVFL	nucl(18),cyto_nucl(12.833),cyto(5.5),cyto_mito(5.166)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0K4	Uncharacterized protein	Low	9.7	1	606-631	QAIRRKPVDPKNTKERQKKLHDSEIN	plas(18),nucl(5),mito(3),cyto_nucl(3)	GKKK (875-878, prob:0.661)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD48	ABC bile acid transporter, putative	Low	8	1	367-388	ETDKEKDDSKHKKKSDDKKEDG	plas(18),mito(4),E.R.(2),vacu(2),cyto_mito(2)	HKK (377-379, prob:0.624)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD69	RNA binding protein	Low	9.7	1	359-380	LFSKQRGYKRLCFRNKQNGPMC	nucl(18),cyto_nucl(12),mito(4),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEM9	RNase H domain-containing protein	Low	8.3	1	537-562	AKVRDTATRKNQKTTKRQVKVSGALY	nucl(11),mito(11),mito_nucl(11)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIU2	Choline monooxygenase, chloroplastic	Low	5	1	2-22	MAPRIHIKQKQSRCPACQLHI	plas(5),mito(4.5),cyto_mito(4.5),extr(4),E.R.(4),golg(4),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ48	Pogo transposable element, putative	Low	9.3	1	438-464	HDLRAAHEKEKQKHQKSKKQISIEHGI	nucl(15),cyto_nucl(10.5),mito(5),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJB4	Steroid dehydrogenase, putative	Low	8	1	293-312	FRIMHDRKTSQYRREQRKNE	cyto(9.5),nucl(9),cyto_mito(6.5),pero(3),mito(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJG5	Integral peroxisomal membrane protein	Low	6.1	1	400-421	RGDSWGRYTRRRKWHRDAELVE	plas(20),nucl(3),cyto(2),mito_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLJ6	Lysophospholipase	Low	9.8	1	797-826	QVKRVVRGVYERRKRDRLQREKLAKEKAAD	mito(11),cyto_nucl(6),nucl(5.5),cyto(5.5),extr(2)	RRKRDRLQREKLAKEK (808-823, prob:0.793)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMN8	Oxidoreductase, putative	Low	5	1	29-48	GPMLQPRRLSRRKRSIFTEI	mito(17.5),cyto_mito(12.333),cyto(6),cyto_nucl(5.333)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPH5	Uncharacterized protein	Low	8	1	25-45	HQYNKVKKAAQKQKELDKLSQ	nucl(9),mito(7),cyto(7),cyto_mito(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTL9	HAD_SAK_1 domain-containing protein	Low	9.7	1	436-461	GDWSTYHGNKKNKRRHPVGHRDEDMP	cyto(9),cyto_nucl(8.333),mito(8),nucl(6.5),cyto_pero(5.333)	SHRGRGRGGRGSGFGRGRGSSRGGGRGRGR (496-525, prob:0.97)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYZ9	Hsp70 family protein	Low	7.5	1	441-464	LEGIRPKTRRSRRHYGFQRWIPFR	cyto(9.5),cyto_nucl(9.5),nucl(8.5),cysk(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7B5	Uncharacterized protein	Low	5.5	1	192-214	TSAKCPRAREARQRAVRRMRERS	mito(16.5),cyto_mito(12),cyto(6.5),nucl(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA73	Uncharacterized protein	Low	9.2	1	605-627	QKPAINKVKKLWRTYRERAPPLA	nucl(15.5),cyto_nucl(11.5),cyto(6.5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQQ9	Uncharacterized protein	Low	6.8	1	74-93	LTYVRKKKGIRTFQLRPFTT	cyto(12.5),cyto_nucl(10),nucl(6.5),extr(3),mito(2),cysk(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT59	tRNA wybutosine-synthesizing protein 4	Low	7.2	1	449-471	LEELAKQKEGRKRKWDEIIHANS	cyto(8.5),cyto_nucl(8.5),nucl(7.5),pero(7),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTD4	Serine/threonine protein kinase, putative	Low	8.5	1	63-83	LREASKLARKKRPNDDTDTKN	nucl(11.5),cyto_nucl(9),mito(7),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU29	RNase H domain-containing protein	Low	8.1	1	17-37	VLPGRLIRRLRNPRNRFGYAD	nucl(10.5),cyto_nucl(7.5),mito(5),pero(4),cyto(3.5),extr(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUZ1	Cortactin-binding protein, putative	Low	9.4	1	606-636	EEPRRYHFPSPSPRNRVMREYRRRGLRRGGI	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVR6	14_3_3 domain-containing protein	Low	9.5	1	37-60	VILSKKLVRARKLRRLDPTRETKS	nucl(18.5),cyto_nucl(14),cyto(8.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW39	Uncharacterized protein	Low	7.8	1	253-274	NFTTSSSTKKRKRDWGNVPSYN	nucl(9.5),cyto_nucl(8.5),cyto(6.5),mito(4),extr(3),golg(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWL4	ADAM family of metalloprotease ADM-B	Low	5	1	714-741	ILSCIVSACRRRRWRKAAPTQPQYQGYR	extr(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M146	Benzoate 4-monooxygenase cytochrome P450, putative	Low	5.4	1	170-191	GLNTHRSKYVHKHRRRIWDHAF	mito(10),plas(8),extr(3),cyto(2),nucl(1),pero(1),E.R.(1),golg(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1T5	D-lactate dehydrogenase, putative	Low	9.9	2	1-21, 578-597	MSPPPLKPVNRNPNKGKDEPF, DKTQHTLSKKRSGWRTPEKL	cyto(9.5),nucl(9),cyto_pero(6.5),mito(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7R7	Catalase, putative	Low	6.1	1	139-165	IKFPSLNRSHKRHPRTHRPDANMVRQR	cyto_pero(10.333),cyto(10),pero(9.5),cyto_nucl(7.833),nucl(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEP8	FAD-binding PCMH-type domain-containing protein	Low	5	1	120-139	DNRRPWTRLRYLKSPPDIRR	mito(12),cyto(8),plas(2),E.R.(2),extr(1),pero(1),golg(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ11	Uncharacterized protein	Low	6.2	1	436-459	LGGGKRRLTKINKGKQMQKPSTMT	plas(14),mito(7),nucl(3),cyto(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ78	OPT peptide transporter Mtd1, putative	Low	5	1	130-150	TPSPEKFKSKWIRNTLRFLNF	plas(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT28	Adenine deaminase	Low	8.2	1	1-23	MSRRINPPRRVRRKLHHDYYSGA	nucl(10.5),cyto_nucl(8.5),mito(8),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUG4	SUMO conjugating enzyme (UbcI), putative	Low	7.6	1	4-23	CLNRLTEERKQWRKDHPFGF	cyto(11.5),cyto_nucl(11),nucl(9.5),mito(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2X6	C6 transcription factor, putative	Low	9.2	1	492-515	QRSRYACGPCRHRKRKCDGKFPCS	nucl(15.5),cyto_nucl(12.5),cyto(8.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBN7	Mannan polymerase II complex ANP1 subunit Anp1, putative	Low	6.6	1	485-507	AAPPQKETKPASQKEKTRQNSSS	mito(14),nucl(4.5),cyto_nucl(4.5),cyto(3.5),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT77	Uncharacterized protein	Low	8.2	2	136-156, 170-201	FDRVHFRARFRRKNYKAYSDE, VETKKTCKDVKGRRYHNARKCRDGRLDSKQFR	cyto(13),cyto_nucl(10.5),mito(5),nucl(4),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXS1	Uncharacterized protein	Low	5	1	235-256	LETIHRDRKETKRKMRVWYAVF	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYM9	Uncharacterized protein	Low	7.4	1	521-546	AKVRDTATRKNQKTTKRQVKASGVPY	cyto_nucl(9),nucl(8.5),cyto(8.5),mito(6),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M381	DNA replication initiation factor Cdc45	Low	8	1	738-768	KKNEARRVKKEAADKKKKDREERREKRAAEH	extr(6),mito(5),cyto(5),cyto_mito(5),mito_nucl(3),golg(3),E.R.(3),cyto_nucl(3),plas(3),cyto_pero(3)	KKNEARRVKKEAADKKKKDREERREKRAAEHARR (738-771, prob:0.997)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3L9	Tryptophan synthase	Low	5	1	3-22	AIKATFAKCKREKRSALVTY	mito(15),cyto(11)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4T0	Ribosomal RNA-processing protein 43	Low	7.6	1	98-122	EVSTSSGSRKRRKINSDPNDSKQPT	mito(8),nucl(7),extr(5),cyto(4),plas(1),pero(1),E.R.(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6I9	BTB domain-containing protein	Low	9.8	1	7-33	TKYRVDKAVKPTKKTYRDKAKEKMEES	nucl(13),mito(8),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7F7	SNF2 family helicase/ATPase, putative	Low	9.2	1	1161-1184	WWHQHRTCPTCKRKLKANDFHQIT	nucl(21),cyto_nucl(12.833),mito_nucl(12.333),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9D9	Trehalase	Low	5.8	1	514-535	ETSSVWDRRARKRKITMDKLMW	cyto(14),pero(6),mito(4),nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC90	C6 transcription factor, putative	Low	7.3	1	21-44	CLPCRSRHLKCDGKKPYCSRCVET	mito(8),nucl(6),plas(6),cyto_mito(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG92	Uncharacterized protein	Low	5	1	535-555	IFWYRGKSFRKWTRDSKVHTM	plas(25)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGQ8	Lysine--tRNA ligase	Low	9.3	1	437-458	ENSPWEQRRKFEQQKIFNQHTN	nucl(17),cyto_nucl(12.5),cyto(6),mito(1),extr(1),golg(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH01	Cell wall integrity signaling protein Lsp1/Pil1, putative	Low	9.7	1	271-296	SNLSTRSRTLSQRRRNNIKRHTEDAE	nucl(17),cyto_nucl(11),mito(5),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKT5	Uncharacterized protein	Low	9.9	1	57-78	TNENQIRRSKRRGHGQPAPWLG	nucl(16.5),cyto_nucl(10),mito(5),cyto(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT09	Alternative oxidase	Low	6.1	1	334-353	AVFRDSKKPRPSKGGDLMKP	mito(19.5),cyto_mito(12),nucl(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXI4	YagE family protein	Low	6.9	1	49-74	DIPSMQQRRPMQQRPQMRPRSRLSAS	plas(17),nucl(5.5),cyto_nucl(4),golg(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5B0	Kinesin, putative	Low	7.6	1	98-123	YRPGHRRQSSCARQSKRQRAEFSEEP	mito(15),nucl(8),cyto_mito(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Z4	Zn(2)-C6 fungal-type domain-containing protein	Low	6.9	1	11-37	RVRAAQACENCKKRKQKCNGTFPCANC	plas(16),nucl(5),mito(3),cyto_nucl(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6G3	Thioesterase family protein	Low	5	1	44-63	NNTENTKRSRWRRRIILGLL	mito(24),cyto(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCI0	Uncharacterized protein	Low	8	1	547-569	IPTGYVDKKLKNRHWYNFKPAYL	nucl(12),cyto_nucl(10.833),cyto(7.5),cyto_pero(6.166),pero(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGL1	F-box domain protein	Low	8	1	572-593	RESGWDRRWRRLDENQSWRSRG	nucl(10.5),cyto_nucl(9.5),cyto(7.5),extr(5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKZ4	Prpd, putative	Low	6.3	1	416-437	HLKNPRTKELHQRKFEKNMRLA	cyto(13.5),cyto_nucl(9.5),mito(5),nucl(4.5),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQP5	Hexose transporter, putative	Low	5	1	17-41	YLAGRLFPRKKWWRDKNMRTLYFFI	plas(23),mito(1),pero(1),E.R.(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRH9	Cytochrome P450 alkane hydroxylase, putative	Low	6.1	1	16-41	FLAYRFLKNQYKSRAHRKLEIAKGCQ	mito(9),extr(5),plas(4),nucl(3),cyto(3),cyto_nucl(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV40	Uncharacterized protein	Low	7.7	1	135-154	ERTPHQSKKSRNQSRSRDTD	mito(17),nucl(7),cyto(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M479	Uncharacterized protein	Low	9.5	1	334-353	WVERSLMKRNSKLKNVRFAT	nucl(17),cyto_nucl(12),cyto(5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFX2	RNase H domain-containing protein	Low	7.9	1	516-541	FKEQLKKSEKEQKRQQRNIEEQRERI	nucl(10.5),cyto_nucl(9.5),cyto(7.5),mito(5),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGE3	Protoheme IX farnesyltransferase, mitochondrial	Low	8	1	103-129	APEQTQELPHRRRKRLKEEAKSRDDGP	mito(10),plas(9),E.R.(4),extr(2)	RRRKRLKE (113-120, prob:0.798)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGN1	Mucin-desulfating sulfatase, putative	Low	7.8	1	344-363	TRYMRDRWYKYHRNVCKPSM	nucl(10),cyto_pero(5.833),pero(5.5),cyto_mito(5.333),cyto(5),mito(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK61	Uncharacterized protein	Low	9.5	1	101-125	MGTAIQHQRKMRRRRGSLRKTALLE	plas(20),nucl(4),cyto(3)	RKMRRRRGSLRK (109-120, prob:0.844)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLF8	Uncharacterized protein	Low	8	1	116-139	PIELKRVKFRRRMKHDLNRPFRFL	plas(18),E.R.(4),mito(3)	TRQLKFKAPIELKRVKFRRRMK (108-129, prob:0.855)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLN2	Dolichyl-phosphate-mannose--protein mannosyltransferase	Low	8	1	9-51	LNVRPVSRGNRSRSRSRSRSRSPNPKSKKSAPKNKKDYSSEGV	plas(25)	SRGNRSRSRSRSRSRSPNPKSKKSAPKNKK (15-44, prob:0.986)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNV2	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase	Low	9.9	1	1136-1156	HGNPNSKRKKSDERLAKLREL	nucl(20.5),cyto_nucl(15),cyto(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNW6	Protein SSH4	Low	9.1	1	39-70	PSVPTTTGEQRSKRNKRDSRKKREAKGLDTDV	cyto(16.5),cyto_nucl(11.833),cyto_mito(10.666),nucl(5),mito(3.5)	RSKRNKRDSRKKREAK (49-64, prob:0.951)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUS3	Uncharacterized protein	Low	8.7	1	571-596	AIYITRRYKAKHKRLQKLDKAGNETI	nucl(13.5),cyto_nucl(10.5),cyto(6.5),plas(2),pero(2),golg(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVC8	Aldehyde reductase II	Low	5	1	314-335	ADTKSSGKRKALRRFWRVCEGH	extr(16),plas(4),cyto(3),E.R.(2),cyto_mito(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVK5	5-aminolevulinate synthase	Low	5	1	64-84	LDAKKKDKTYRHFNNINRLAD	mito(19),cyto(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU76	Zinc finger protein, putative	Low	9.3	1	50-71	ADPRQHGRAKHHYKCQHCNRSF	nucl(16.5),cyto_nucl(12),mito(5),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVF7	Uncharacterized protein	Low	8.5	1	699-718	LFKLQPKKPNWDLKRHLDEK	mito(12),nucl(9),cyto(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVL4	Nuclear pore complex protein	Low	9.1	1	834-859	LRSPTKSPSKSSRFRRPQTEDERHER	nucl(11),mito(6),cyto(4),pero(2),plas(1),E.R.(1),golg(1),cysk(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5M9	DNA ligase	Low	9.8	1	641-661	LSLAATKKKERNTRRKVLLST	nucl(15),mito(9.5),cyto_mito(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFE8	Acid phosphatase, putative	Low	6.6	1	266-287	GDKDTLQRKGKPNRVRQFQWST	cyto(14),cyto_nucl(12.333),cyto_mito(9.999),nucl(7.5),mito(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHR5	Myosin light chain kinase, putative	Low	9.2	1	10-33	SASSSFLKKFRTRNQHDQRLLSRQ	nucl(11),mito(5),cyto(5),cyto_mito(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPQ1	Atypical serine/threonine protein kinase BUD32	Low	8.6	1	237-263	DEKYENTGQKERRRRNHPSMQMTKSRE	mito(10),nucl(9),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT06	Uncharacterized protein	Low	9.9	1	1-23	MDPHSYSPHQRRWERRLSRDVNE	nucl(15),pero(5.5),cyto_pero(4.5),mito(3),cyto(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUT0	Uncharacterized protein	Low	8.4	1	11-36	VVITGPPQKDKHKRISQVRSVIRKSQ	nucl(12),cyto_nucl(9.5),mito(5),cyto(5),plas(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVT4	Cnn_1N domain-containing protein	Low	9.8	1	50-72	TAPPLRHSSSRKISRNNPPHVNN	nucl(16.5),cyto_nucl(10),mito(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ00	Protein kinase domain-containing protein	Low	8.9	1	7-30	DIIGLKKPEKKKTTESSNRQQDSS	nucl(18),cyto_nucl(12.333),mito_nucl(9.833),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3C2	Uncharacterized protein	Low	5	1	16-42	AVKAVTKSHHEKKKEKQKNQNNIQDMY	mito(13),extr(6),cyto(3.5),cyto_nucl(3),plas(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M574	F-box domain protein	Low	9.9	1	628-649	GPEDTKKSSRRQRCSILSPCSS	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8U1	Dihydroorotate dehydrogenase (quinone), mitochondrial	Low	5	1	42-68	EPEPIATITKKNKKSPLRKFIFRSSIA	mito(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB26	Ribosome biogenesis protein Rsa4, putative	Low	6.7	1	2-25	ATLLPPPSKKQKREIAERAREQQE	cyto(8.5),cyto_mito(8.5),mito(7.5),nucl(6),pero(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIP4	Uncharacterized protein	Low	8.7	1	31-72	SQYSREAVKKRKLDNQQRHRQDAIDRRVRRERVKTSRCRDYA	nucl(12.5),cyto_nucl(10),cyto(6.5),mito(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKN2	2-dehydropantoate 2-reductase, putative	Low	5	1	49-69	GVSFRSKKFGNERFKPRHVVR	mito(16.5),cyto_mito(10.833),extr(5),cyto(4),cyto_nucl(3.333)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMS2	40S ribosomal protein S4	Low	5	1	1-20	MPRGPKKHQKRLSAPAHWLL	mito(21),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMT6	C6 transcription factor (Gal4), putative	Low	8.6	1	10-38	FACDECRARKSRCSKGKPKCLQCLKLGKE	nucl(10),mito(4),cyto(4),cyto_mito(4),plas(3),cyto_pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQF4	Palmitoyltransferase PFA4	Low	5	1	351-373	NDGIVRRRRKFHERYNKTNKSAQ	plas(12),vacu(4),golg(3),mito(2),extr(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS35	FHA domain protein	Low	7.2	1	580-606	QEVAQTSPKKNPRKRVKTHQAYTFMKY	cyto(9.5),cyto_nucl(9),nucl(7.5),mito(3),extr(3),golg(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXC8	Uncharacterized protein	Low	9.5	1	232-251	ETYKRVWIWKHEQQRLPQEF	nucl(17.5),cyto_nucl(11.5),mito(5),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXU2	TPR domain protein	Low	7.8	1	1141-1164	LKREGWSKKTSKQKASQRNADLRD	mito(11),nucl(9.5),cyto_nucl(8),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1Q0	Ribosome biogenesis protein Urb1, putative	Low	9.3	1	1-26	MAPGFSPEHRNKRRKISTDGNQPPTN	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3D7	Uncharacterized protein	Low	6.7	1	342-363	IARSSKFKSKYIKPARRAKFMA	mito(11.5),cyto_mito(10),cyto(7.5),nucl(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3T5	Uncharacterized protein	Low	9	1	206-228	ETGVRIPRIRPNQRPNQPNQQAQ	nucl(16.5),cyto_nucl(11.833),extr(5),cyto(4),cyto_mito(3.499)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M844	AP-1 complex subunit gamma	Low	5	1	607-630	EPTNKRQSRMLKDKSKKPVKQSED	mito(21),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8I8	Uncharacterized protein	Low	9.6	1	233-263	SSSSNNKDSKGKRKKRRSIRGKRAHKKTVVI	cyto(12),cysk(9),nucl(4)	SKGKRKKRRSIRGKRAHKK (241-259, prob:0.998)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD87	Septin AspA, putative	Low	6.2	1	1-25	MMSSPLNAIRRKKNVKKGIQFCLMV	mito(20),nucl(3.5),cyto_nucl(3.5),cyto(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDL5	Mitochondrial export translocase Oxa1, putative	Low	9.1	1	507-527	RQKGKEVATSKKPVKKSKARK	mito(18.5),cyto_mito(11.5),nucl(4),cyto(3.5)	KGKEVATSKKPVKKSKARK (509-527, prob:0.971)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDR2	Mucin family signaling protein Msb2, putative	Low	5	1	647-671	GVMFYVARRYRKRKQLHARSPSVTT	extr(25)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MM53	Glycosyl transferase, putative	Low	5	1	315-335	YVTRLCLRRRRCSAARDKAMG	plas(20),E.R.(3),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MME5	Oligo-1,6-glucosidase	Low	9.3	2	111-150, 403-426	DQHEWFQKSKRSKENNEFRDWYIWKPPRFDEQKNRHPPNN, QALNSYRKQYQKKSRDNARTPVQW	nucl(7.5),mito(7),cyto_nucl(7),cyto(5.5),pero(3),golg(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPG8	Protein-tyrosine-phosphatase	Low	8.3	1	450-476	PAPTPGQPRKSHRKDSRHHPYARNVSG	nucl(12.5),cyto_nucl(12),cyto(10.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRN3	SNF2 family helicase/ATPase, putative	Low	8	1	102-121	DEGTNKKRNRESKDLTGERK	mito(19),nucl(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWH3	Toxin biosynthesis protein, putative	Low	7.5	1	400-423	AFQNTWNKKTQRKKSTVDERWLKE	mito(12),nucl(8.5),cyto_nucl(7.5),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3Z1	Lon protease homolog, mitochondrial	Low	5	1	1096-1121	NHVWKKQLTKPADAKKRRDKHDEDDD	mito(21),cyto_mito(12.833),mito_nucl(11.833),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF31	Uncharacterized protein	Low	5	1	442-463	GLFGRKEKTRFFRREHQIPNSL	plas(24),E.R.(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH49	Uncharacterized protein	Low	9.6	1	132-154	NSLQPPRNREKQIQNRHHRRTES	nucl(18),cyto_nucl(12.5),cyto(5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPN8	Uncharacterized protein	Low	6.7	1	731-752	RSQIDRRPTRQRVGSLKRPPNL	cyto_nucl(8),cyto(7.5),nucl(5.5),pero(4),mito(3),E.R.(3),extr(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSC8	Protein transport membrane glycoprotein Sec20, putative	Low	9.2	1	358-377	DGPRNTKKRMWEEPVERRDE	nucl(11),mito(8),cyto(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUZ6	Uncharacterized protein	Low	9.8	1	9-29	FVGPSTKKTLRPRYQDREGSM	nucl(13),mito(8),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVF5	R3H domain protein, putative	Low	9.4	1	443-462	SSTSGRKKNFRQKTPHDDSF	nucl(15.5),cyto_nucl(11),extr(5),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4M2	Beta-glucosidase, putative	Low	8	1	61-99	GAVVAPLNRKNRDKKKQQLSKRRKYRRRLITLKNFIVRY	plas(25),cyto(1.5),cyto_nucl(1.5)	RKNRDKKKQQLSKRRKYRRR (69-88, prob:0.969)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA55	Cytosine deaminase, putative	Low	9.7	1	164-183	NENAPNPRSKRNRELNTEFA	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBT8	Poly [ADP-ribose] polymerase	Low	7	1	133-152	DEPPSKKKRDDETKEEKKIH	mito(10.5),mito_nucl(10.166),nucl(8.5),cyto_mito(8.333),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDA2	Phosphatidylinositol 3-kinase VPS34	Low	7.5	1	136-157	DGKLRMGRQKCKIYRHKAADGF	cyto(14),nucl(7),cyto_mito(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFS3	Zn(2)-C6 fungal-type domain-containing protein	Low	9.3	1	25-44	HKTRCLPSARSDQCRRCEKI	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGD9	Patatin-like phospholipase domain-containing protein	Low	5	1	70-91	RLSKEGREEKLRRDNRRQLLYL	plas(24),cyto(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHC7	Methylisocitrate lyase	Low	5	1	14-36	VVNKIFRSQKWQGQRQRQYCFLY	mito(9),cyto(9),cyto_mito(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKT2	C6 transcription factor, putative	Low	9.3	1	8-27	QGTHRQEYPHTPRRKRVGLA	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLA4	Uncharacterized protein	Low	7.6	1	9-32	SHLALKRQPCYRRRHSNSAHGDSS	mito(16),nucl(9),cyto_mito(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPH4	Chitinase	Low	5	1	606-633	ESFIKVRDTEKRKQQKTTKRQVKAMGAL	extr(21),golg(3),mito(1),cyto(1),vacu(1),cyto_mito(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT92	Glycerophosphocholine acyltransferase 1	Low	5	1	75-98	LRLLIFKWLRPQKRRIRSHLTLLA	plas(23),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVZ1	Taf5, putative	Low	7.8	1	167-190	INTVLEKRPRLQRKYKQPDFSSDR	nucl(9.5),cyto_nucl(9.5),cyto(8.5),mito(3),plas(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW33	Uncharacterized protein	Low	8.2	1	111-137	QEQRKEHKRFEQQCKERHERRLQRRAH	nucl(12.5),mito_nucl(9),cyto(8),mito(4.5),cyto_pero(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW48	RNase L inhibitor of the ABC superfamily, putative	Low	7	1	5-29	AIVNSDKKCRQECKKSCPVVRTGKL	mito(8.5),cyto_nucl(8.333),cyto_mito(8.166),nucl(8),cyto(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX64	Uncharacterized protein	Low	5.4	1	132-157	RMIKDVTNPSRKRRRQDKDNIIPVDS	plas(19),E.R.(3),cyto(2),nucl(1),pero(1),golg(1),cyto_mito(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXY9	C6 and C2H2 transcription factor, putative	Low	9.6	1	11-37	HFPGCGLRYRRKEHLTRHARRHFQPES	nucl(12),mito(10),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0I6	DDE-1 domain-containing protein	Low	9	1	360-387	HDLRAAHEKEKQKHRRSKQQISHEQGIT	nucl(14.5),cyto_nucl(10.5),cyto(5.5),mito(3),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0S5	Zn(2)-C6 fungal-type domain-containing protein	Low	9.2	1	24-48	GSEQRARKACINCRRQKMKCIAEDN	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(1),plas(1),pero(1),golg(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7Y1	Sensor histidine kinase/response regulator, putative	Low	8.5	2	1028-1049, 2283-2306	QSTDLIRKRVRNRHRYRKVLLN, QYLAPARPTKLRRRPVTRQSGEDS	plas(10),cysk(7),nucl(4.5),cyto_nucl(3),E.R.(2),pero(1),golg(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK78	Cation chloride cotransporter, putative	Low	5	1	979-999	GGIKNFVRSNRQQRRRSISSF	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMB1	Zn-dependent hydrolase/oxidoreductase family protein, putative	Low	5	1	2-24	HPFIRRLFATWRRKNHTPRSFSF	mito(23),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTF5	Uncharacterized protein	Low	9.6	1	12-39	GITRVRTGCYTCRRRKVKQSQYAGPAVS	nucl(12),mito(6),plas(5),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTT2	Ubiquinone biosynthesis protein, putative	Low	5.8	1	65-86	GSSSNGSKRSSRRRTAIRFAAA	mito(21),cyto(3),nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWF1	Endosomal peripheral membrane protein (Mon2), putative	Low	9.9	1	469-492	PLTVTESKSKRRKRMAMNDREQGL	nucl(18),cyto_nucl(13),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M006	Uncharacterized protein	Low	5	1	310-329	NVDGSRQIRRPNDNNRNQIS	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1H3	O-acyltransferase	Low	5	1	43-62	SSTSSEKKRGSKYRHIAAYH	plas(21),E.R.(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAD8	Bicyclomycin resistance protein, putative	Low	8	1	533-557	MSYGIAWRRAKKERDDRKAEAKRPS	plas(25)	RRAKKERDDRKAEAKRPS (540-557, prob:0.881)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIE8	Allantoate permease, putative	Low	5	1	468-493	LCLQTWYSQVKKKKQYTEKTNEADVK	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJA7	RNase H domain-containing protein	Low	5.4	1	43-64	AETWWPGRTRPRSRPQADTPPI	mito(15),extr(5),cyto(4),nucl(1),plas(1),pero(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKI9	Pre-rRNA-processing protein IPI1	Low	8.8	1	1-25	MGSSQKRKKEKQKDFQAKAKPANFT	mito(17),cyto(7),nucl(2)	RKKEK (7-11, prob:0.649)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPX4	60S ribosomal protein L32	Low	6.2	1	2-48	AAKSHIPIVKKRTKRFFRHQSDTFKCVPSSWRKPKGIDNRVRRRFKG	mito(18.5),mito_nucl(12),nucl(4.5),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRK2	Ubiquitin-protein ligase (Asi3), putative	Low	7.4	2	742-761, 916-935	GSNKRGKKTSRREQQAPLDF, GRIMTRSRFRRQDEHERARV	plas(22),mito(2),nucl(1),cyto(1),cyto_nucl(1),E.R.(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUC8	Pentafunctional AROM polypeptide, putative	Low	5	1	608-627	NGRASPPSTRGKRKGDPLGV	cyto(10),plas(10),mito(3),extr(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV33	Fatty acid synthase subunit beta, putative	Low	6.8	1	396-416	IDQNRVPYSKRKPPIQHQFLP	cyto(10),cyto_nucl(9),nucl(6),plas(5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY78	Mitochondrial Rho GTPase	Low	8.5	1	400-427	STTAALKVTKPRKRRRRPGRVGRNVVLC	cyto(10.5),cyto_nucl(6.5),mito(4),plas(4),E.R.(3),pero(2),nucl(1.5)	TKPRKRRRRPGRV (408-420, prob:0.978)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZC2	Phosphotransferase	Low	7.4	1	30-53	ETSSRRQRSVYGHGRKRRRSLDEL	cyto(12),nucl(6),mito(4),cysk(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M012	Uncharacterized protein	Low	9.4	1	935-960	AACECGRLPFRGRRRRRNLDSAGQEW	plas(11),extr(5),nucl(4),cyto(2),golg(2),mito(1),E.R.(1),vacu(1),cyto_pero(1)	RGRRRRRNLDSAGQEWRKKRV (945-965, prob:0.849)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2I2	DUF788 domain protein	Low	5	1	155-176	SGGASKRQQKLEKRGGQRVQYR	mito(11),extr(8),plas(3),E.R.(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5W1	HTH CENPB-type domain-containing protein	Low	8	1	43-64	YNRVKGRASKSTRKATNRLFTE	nucl(11.5),cyto_nucl(11),cyto(9.5),mito(3),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC88	Jerky, putative	Low	9.9	1	1-20	MQQQRAQRHRKAIPNEWKAA	nucl(18.5),mito_nucl(12),mito(4.5),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDT0	Laccase, putative	Low	6.2	1	1-20	MQRRLSKRQQQQDATKSPDA	plas(8),extr(6),nucl(3),golg(3),mito(2),cyto_nucl(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEW1	Integrase catalytic domain-containing protein	Low	9.3	1	184-226	VTRGRRPNRRTSSRNLRNGGNNSNSNRRERSNRNSRNKRLICN	nucl(16),cyto_nucl(13),cyto(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MI21	Pantothenate transporter, putative	Low	5	1	504-524	LTKVYYITRNKWKAKRLAAMS	plas(21),E.R.(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIE2	Protease S8 tripeptidyl peptidase I, putative	Low	5	1	179-201	MTQAVKRTVKKQKRASNSQASRT	extr(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKS1	Glutamate synthase Glt1, putative	Low	5	1	1615-1640	DKTRGFMKYHRRSEKYRNPTTRTRDW	cyto(14.5),cyto_nucl(9),cysk(6),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLG8	Cytochrome c oxidase assembly protein Cox11, putative	Low	6.4	1	3-26	MRGLRFLGRCRKICRPQSFNQLTT	mito(16),nucl(4),cyto(3),pero(3),cyto_pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MM94	Ariadne RING finger, putative	Low	8.7	1	50-75	DSNLRRVECKKVKCSWYKPSRTTWLN	nucl(10),mito(9),cyto(5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQR8	Integrase catalytic domain-containing protein	Low	7.8	1	112-138	NQNNRQTPRQGYRRQGRDDRNSRQQGD	nucl(9.5),cyto_nucl(9.5),cyto(8.5),pero(4),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRC9	PAP2 domain protein	Low	5	1	21-40	NSLPKWRYYPRQKLLPVVRF	plas(25)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRF2	Pyruvate formate lyase activating enzyme, putative	Low	8	1	281-305	YHPDAHVGKKKSRKRRQVGGEEEVE	mito(22),cyto(4.5),cyto_nucl(3)	GKKKSRKRR (288-296, prob:0.861)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTH4	Zn(2)-C6 fungal-type domain-containing protein	Low	8.5	1	1-25	MRASQGCRTCKRRKIGCDKQFPECW	nucl(16.5),mito_nucl(12.166),cyto_nucl(11.333),mito(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYV4	Uncharacterized protein	Low	5	1	327-346	LDNKDPNKRQHTWKHPQADE	plas(18),vacu(4),mito(2),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2J0	Biotin carboxylase	Low	5	1	2131-2151	EAKGTIRKPLQWKNARRFFYW	cyto(13.5),cyto_nucl(8.5),mito(7),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4T8	DUF803 domain protein	Low	5.4	1	42-67	DEKAPYELRRPPYKRRRWQLGMLMFV	plas(22),mito(2),nucl(1),E.R.(1),vacu(1),cyto_mito(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD36	Amino acid transporter, putative	Low	8	1	11-35	PSTGAAAHRGRRKRGKRDVFQGTAS	plas(20),E.R.(4),vacu(3)	HRGRRKRGKR (18-27, prob:0.886)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHY9	MFS multidrug transporter, putative	Low	7	2	307-326, 349-368	SVIARRFRRHQGHKYRRLDD, HPPPIRKKSPWKQLLHRNVI	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MI35	Uncharacterized protein	Low	9.2	1	5-27	LETWSDRRYKKEKTRLRPEPLAL	nucl(16.5),cyto_nucl(12),mito(6),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJH8	Acetamidase/formamidase family protein	Low	5	1	6-25	HVHSHHKHLKWSNRQPPVLT	mito(13),cyto(7),cyto_pero(5.833),cyto_nucl(4.833),pero(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSA6	Aa_trans domain-containing protein	Low	5	1	54-76	ESPKLNWREWVLRKKHHHNTDVL	plas(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4P1	HhH-GPD family base excision DNA repair protein	Low	5	1	8-36	ALQTPTKKPTKPTSSNNKRQKSNSSTIKA	mito(20.5),cyto_mito(13.5),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M659	Zeaxanthin epoxidase, putative	Low	5.8	1	358-379	EPGALVRSKRRFQRRLESQGNL	mito(10),cyto(9),cysk(3),nucl(2),extr(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9V5	T5orf172 domain-containing protein	Low	9.9	1	109-130	LEVNDRQRQHRRPTERDARYQR	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMX8	MFS amine transporter, putative	Low	8	1	458-482	VIWVDGSIRKRRIKRADLRGREEVS	plas(19),mito(4),E.R.(3)	RKRRIKRA (466-473, prob:0.736)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNW0	N2,N2-dimethylguanosine tRNA methyltransferase	Low	8.3	1	475-500	QNLNRLNRRKKGKEGKKRKREEGEED	plas(20),E.R.(3),nucl(1),mito(1),cyto(1),cyto_nucl(1),golg(1),cyto_mito(1),mito_nucl(1)	NRRKKGKEGKKRKR (481-494, prob:0.991)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTS2	CCHC-type domain-containing protein	Low	6.5	1	421-440	HLNRNCPLRKKNTTEIKWVE	golg(8),E.R.(7),nucl(4),mito(2),plas(2),extr(2),cyto_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVG2	Polymerase, putative	Low	9.5	1	1447-1468	FIFCQIAKRKAPRFPRHPSEVI	nucl(15.5),cyto_nucl(10.5),cyto(4.5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUJ6	Aspartic-type endopeptidase (CtsD), putative	Low	5	1	62-81	LTLPLKKRSTVNKRENKYTI	extr(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW28	Uncharacterized protein	Low	9.9	1	116-135	KLSPKHQLRLERKYRRRAAL	mito(14),nucl(5.5),plas(4),cyto_nucl(4),cyto(1.5)	PKHQLRLERKYRRRAALKYARPR (119-141, prob:0.858)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYW7	Tr-type G domain-containing protein	Low	6.1	1	846-871	DDDEKEKQKQENRFRRTRQESEKTID	cyto(19),cyto_nucl(12.833),cyto_mito(10.833),nucl(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1Y4	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial	Low	8.5	1	105-130	KEIEEDGKPPRRKRIRPSGPWQVQVM	mito(15.5),cyto_mito(11),cyto(5.5),nucl(2),plas(1),extr(1),pero(1),golg(1)	GKPPRRKRIRP (111-121, prob:0.859)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M309	Uncharacterized protein	Low	8	1	18-46	GESTHNPFKKIRVNRRRKRTRDIERDLAL	plas(25)	KKIRVNRRRKRT (26-37, prob:0.857)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7Q5	Probable E3 ubiquitin ligase complex SCF subunit sconB	Low	9.4	1	95-117	RPMNSRYCYRHRPDLKCRRQADE	nucl(15.5),cyto_nucl(11),cyto(5.5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCZ4	SRR1 domain-containing protein	Low	9.4	1	1-23	MPHTSSKHRKKFTHPKRIEITDE	nucl(16),cyto_nucl(11.5),cyto(5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGC4	Uncharacterized protein	Low	7.3	1	68-90	ELLDCRRRGSKERKTKFNHASFT	mito(16),nucl(6),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR57	DUF803 domain membrane protein	Low	6.8	1	597-617	TPAGRRRSTPRTPQSNQRNSV	plas(17),nucl(5),vacu(2),mito(1),cyto(1),extr(1),cyto_mito(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRE7	Sulfite reductase, putative	Low	7.6	1	1227-1250	MLVQRDHGDRKNRKHARLKYTIDD	cyto(9.5),nucl(9),cyto_mito(7.5),mito(4.5),extr(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRU8	Zn(2)-C6 fungal-type domain-containing protein	Low	6.9	1	12-38	ARQSCIQCYTQKRKCSRQIPQCELCLK	mito(11),nucl(5),cyto(5),cyto_nucl(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSF1	Uncharacterized protein	Low	5	1	236-257	LETIHRDRKETKRKMRIWYAVF	plas(25)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT80	GTPase activating protein (Gyp1), putative	Low	9.9	1	133-152	PSIASMRKKGKNTRRTPSTF	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZK8	DUF2235 domain-containing protein	Low	8.5	1	617-636	VRETYIRKKAGKKAEENQHP	nucl(11),cyto(7.5),mito_nucl(7.5),cyto_pero(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D0	Uncharacterized protein	Low	7.9	1	162-181	CAYITRRKRRTPSQIGDREK	nucl(8),mito(6),plas(3),extr(3),golg(3),vacu(1),E.R.(1),pero(1),cyto(1),cyto_pero(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M783	Calcium/calmodulin dependent protein kinase, putative	Low	8.3	1	3-25	APTPNKGQPQRPQIQPCRYKTGK	nucl(9),mito(9),mito_nucl(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAS8	Vacuolar protein sorting-associated protein 54	Low	8.5	1	341-360	GGLKVVKLRQRRQNIRKLAD	mito(11),nucl(9),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBF3	H(+)-transporting two-sector ATPase	Low	5	1	220-239	VPALDRKKKWDFKPTKKVGD	mito(17),cyto(7),cyto_nucl(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIR4	Gibberellin 3-beta hydroxylase, putative	Low	8.1	1	330-351	AGEYYLWRTRRQKRSWLIGENA	nucl(10),cyto(9.5),cyto_pero(6.5),mito(4),pero(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKL9	Structural maintenance of chromosomes protein 5	Low	8.2	1	50-69	TSLQVPPQGRRRRRVVDEEY	nucl(15),cyto_nucl(12.833),cyto(9.5),mito_nucl(8.833)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMD1	Purine nucleoside permease, putative	Low	8	1	387-410	LLTKRGSSVKKMRSMRKKGVVLRK	extr(21),plas(2),E.R.(2),vacu(2)	KRGSSVKKMRSMRKKGVVLRK (390-410, prob:0.895)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPQ8	Reverse transcriptase Ty1/copia-type domain-containing protein	Low	8.5	1	99-119	DTPTPQARPAQRPQRNRQLLA	nucl(14),cyto_nucl(13.5),cyto(7),mito(2),pero(2),cysk(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQH2	Cytochrome P450 monooxygenase, putative	Low	7.1	1	536-556	LYVRAERRVKWPPRSDQSTTA	pero(12),cyto_nucl(8),nucl(7.5),cyto(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS67	Uncharacterized protein	Low	8.3	1	97-116	IIKLRDIYNKKRKLRDKFLD	nucl(11),mito(11),mito_nucl(11)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUL9	N-arginine dibasic convertase, putative	Low	5	1	5-28	VTKQLLKPKLDRRQYRVLRLRNGL	mito(22),cyto(2.5),cyto_nucl(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVD4	Cytochrome P450, putative	Low	8.6	1	136-155	TENHELHRRRRKPLEPFFSR	nucl(9),cysk(7),cyto(5),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUR3	Uncharacterized protein	Low	5	1	513-535	ATRLHALKRQNAKTKTRDLRESK	plas(15),E.R.(5),mito(2),cyto(2),extr(2),cyto_mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXX3	Uncharacterized protein	Low	9.9	1	193-213	DEIRRRKSQSLKRVRSRERSV	mito(14),nucl(6),cyto(6),cyto_nucl(6)	RRRKSQSLKRVR (196-207, prob:0.712)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9T9	Uncharacterized protein	Low	5.7	1	20-40	AYGLHKKSDKHRLNPKTLMRE	mito(17),cyto(6.5),cyto_pero(4.5),nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBI7	MYND-type zinc finger protein samB	Low	8.4	1	542-561	DKWPMRLSKRPTKREFELLR	nucl(13.5),cyto_nucl(10.833),cyto(7),cyto_mito(4.333),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGH1	ABC transporter (Adp1), putative	Low	5	1	679-699	SRPNTKRQPSLKQRQDKQLFT	plas(14),extr(8),E.R.(2),mito(1),pero(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ66	Transmembrane 9 superfamily member	Low	8	1	328-351	LEEGKLKKRRSKSPNKEPKKPDEG	plas(22),E.R.(3)	KLKKRRSKSPNKEPKK (332-347, prob:0.956)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M177	DUF2433 domain-containing protein	Low	8.7	1	558-581	RQPIEHKKPTPQGQPRKPNVKFFE	mito(12.5),cyto_mito(10.166),cyto(6.5),cyto_nucl(5.833),nucl(3),extr(3)	RGRGGFGRGRGGRGSDRGGRGRGGRGG (621-647, prob:0.942)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M697	GAS2 domain protein	Low	9.6	1	15-41	PPPPSAHSPLRSPKRRQRLPVDEDPLL	nucl(15.5),cyto_nucl(9.5),mito(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7P7	Uncharacterized protein	Low	6.1	1	12-31	GRSVHPSKRRRLEVNHSEGP	cyto(16.5),cyto_nucl(11.833),cyto_pero(10.666),nucl(5),pero(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M895	YeeE/YedE family integral membrane protein	Low	5	1	40-63	QDPALLLRRQKQKEKQPNGPVDVN	extr(17),plas(6),E.R.(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9R2	tRNA-splicing endonuclease subunit Sen2	Low	8.5	1	14-38	QAGGKDKHPRPAKPNYKHIHRFPLP	nucl(12),cyto_nucl(9.5),mito(8),cyto(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC28	Beta-N-acetylglucosaminidase, putative	Low	8.1	1	839-860	YIPALHKKDKEREKQVNGSNTS	cysk(13),nucl(8),cyto(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDK0	Plasma membrane ATPase	Low	5	1	13-34	GQQSRTSRRMSRAERRMSRAIS	plas(25)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEC8	Uncharacterized protein	Low	9.6	1	434-455	NSTIMRQKSNRRRGQPSPPELD	nucl(18),cyto_nucl(12.5),cyto(5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFB3	Transposon I factor, putative	Low	8.2	1	24-44	VLTYARKKKGIRTSQLRPFTS	mito(13),nucl(8),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFL4	Fanconi-associated nuclease	Low	5	1	6-27	DFFETRRPSAKRQKVSHGVNFE	cyto_mito(9.166),mito(9),cyto(9),cyto_nucl(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJT4	Uncharacterized protein	Low	5.8	1	45-68	ALPVRYRHLYKKRTKEGRPKSCLV	plas(15),mito(7),nucl(2),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUQ2	Uncharacterized protein	Low	9.1	1	37-59	MRTNPQGDRRRGDKKRNSTTDGS	nucl(11),mito(8),cyto_nucl(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUS8	Uncharacterized protein (Fragment)	Low	8.1	1	98-119	PSQWRHAKIIPLKKPNKKDYTI	cyto_nucl(12),nucl(11.5),cyto(11.5),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTN6	Nuclear pore complex subunit Nup133, putative	Low	9.5	1	11-49	ASSLRTSRRRQRTSLEDSAKPPAAKRQRSTLRQEYRPSV	nucl(15.5),cyto_nucl(9.5),mito(7),cyto(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUG6	Uncharacterized protein	Low	7.9	1	6-26	TVSRGRSSGRWRNGRGSRQPS	mito(14),nucl(9.5),cyto_nucl(6.5),cyto(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUM9	Uncharacterized protein	Low	5	1	190-211	LEFTKDKRKRFIRSRQLKYTAF	plas(20),E.R.(4),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYA8	Integral membrane protein 25D9-6	Low	6.9	1	210-233	YVNTHTKKKRLEALRRQYDQRRGG	cyto(10),mito(9),nucl(5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0I5	Uncharacterized protein	Low	8.9	1	49-68	NSRTIRRRLKEWGIKRRVRT	nucl(14.5),cyto_nucl(10.5),cyto(5.5),pero(3),mito(2),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1T4	Phenol monooxygenase, putative	Low	8.1	1	8-32	AHASRELRIKRSRARPLPRLSAQPD	nucl(8),cyto(6),plas(6),mito_nucl(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M794	Guanylate kinase	Low	5	1	2-22	FYIRCLRTPITTKRRNAKYMF	mito(22),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGB5	SLATT_fungal domain-containing protein	Low	9.4	1	17-42	ESSPLLPKTDKKKQNETPNKQQQSNT	nucl(12),plas(9),cyto(2),pero(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLH9	Midasin	Low	7	1	4582-4602	ASQYKRDKIWMRRSIPSKRNY	cyto_nucl(8.5),cyto(8),plas(8),nucl(7),mito(1),pero(1),E.R.(1),golg(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MM21	Reverse transcriptase Ty1/copia-type domain-containing protein	Low	9.8	1	410-435	PQNRSRFTRKPSRHFRGPRNDKKTCY	nucl(13),cyto(7),mito_nucl(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP64	Fungal_trans domain-containing protein	Low	8.2	1	28-47	SCDPCRSRKCVAQRPRLAMN	nucl(9),plas(7),cyto_nucl(7),cyto(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS45	MIPC synthase subunit (SurA), putative	Low	5	1	311-332	ISVSKIRRRPFARMPRFFRRIS	plas(21),E.R.(3),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUN5	Uncharacterized protein	Low	9.4	1	4-26	QVEHPIQTKRPVQRSKNPQSVVT	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY34	ATP-dependent helicase dcl1	Low	6.2	1	1459-1479	LSVSRFREKYHCKCSRNVSSH	plas(16),nucl(3),E.R.(2),vacu(2),mito_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8B6	Uncharacterized protein	Low	8.4	1	630-655	LRQMWDKSHRRALKRQQKQDARDGNT	nucl(11),cyto(6.5),cyto_pero(6.5),pero(5.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9P7	Periplasmic nitrate reductase, putative	Low	8.7	2	628-650, 719-744	NVYHFHTRTKTGRKDRLQRAFPE, GPNLQTTNFQVRRRQNRKSPRRPENC	cyto_nucl(11.833),cyto(11.5),cyto_pero(9.332),nucl(8),pero(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAB4	ABC1 domain protein	Low	7	2	21-47, 58-80	LQLPPRQSTFPQPRRLQRRFIHPNEFK, GKAAPAKTYTRTRKWLRRLFYIS	mito(23),cyto(2),plas(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCQ4	Uncharacterized protein	Low	9.7	1	228-247	SNSTRRERSNRNSRNKRLIC	nucl(18),cyto_nucl(13.5),cyto(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDX1	Amino acid transporter, putative	Low	5	1	500-520	VYSRRNFRPPRQLYVRNLQQT	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFU6	Protein kinase domain-containing protein	Low	9.8	1	35-56	EAIELSKKRKHSPSRENLDQAP	nucl(19.5),cyto_nucl(14),cyto(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MI86	Uncharacterized protein	Low	9	1	412-438	EEKTTQVRQSVRLRKRPREKDDQYIYH	nucl(13.5),mito(9),cyto_nucl(8.5),cyto(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNK1	Alpha methylacyl-CoA racemase, putative	Low	6.1	1	43-67	VDPPLKPQKKTQKRWLDSLCRHKKS	cyto(8.5),cyto_nucl(6.5),mito(4),nucl(3.5),extr(3),pero(3),plas(2),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQN0	Methionyl-tRNA synthetase	Low	9.2	1	617-647	AEKAAAKKLAKEKEKEKKRLKKEAAAAAKKA	cyto(19),cyto_mito(11),nucl(4)	KALEAEKAAAKKLAKEKEKEKKRLKKEAAAAAKK (613-646, prob:0.997)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2L2	Uncharacterized protein	Low	5	1	363-386	HSIKQFGKTRYNRMLKKDNNEKMT	plas(13),mito(6),E.R.(2),golg(2),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2W7	cAMP-specific phosphodiesterase, putative	Low	9.3	1	358-387	KPDHQQQKGQKRRGRSSKRKRKDSDTLDYA	cyto(10.5),cyto_nucl(8),nucl(4.5),mito(4),extr(2),plas(2),pero(1),E.R.(1),golg(1),vacu(1)	KGQKRRGRSSKRKRK (365-379, prob:0.971)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEA1	Uncharacterized protein	Low	6.2	1	111-135	EVHGRCRPSKLWRQKKRKCDCLSSL	extr(11),cyto(6.5),cyto_nucl(5.5),nucl(3.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF73	Uncharacterized protein	Low	8	1	24-53	RSHVTRHQWKQFGRRDKRQHGRKRILPSIT	plas(14),mito(3),cyto(3),golg(3),cyto_mito(3)	RRDKRQHGRKR (37-47, prob:0.73)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFX9	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	1-31	MGKSKVRTGCRTCKIRKVKCDEKYPVCHRCS	nucl(11),plas(7),mito_nucl(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG81	ELMO/CED-12 family protein	Low	9.2	1	287-308	NESDMKKSRRHNPEKWRRLGFQ	nucl(16),cyto_nucl(12.5),cyto(7),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJT1	Fungal_trans domain-containing protein	Low	8.8	1	83-108	KFCSVDPSFKRTKKRQYYRYYHPICP	nucl(13.5),cyto_nucl(11.5),cyto(8.5),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNN8	Uncharacterized protein	Low	7.9	1	112-133	EGLTKAKPSKQIKSKRPSTVIH	nucl(10),mito(8),cyto(8),cyto_mito(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQA4	Uncharacterized protein	Low	8.4	1	32-55	QGPVKVKVPRKRGRPVGSKKISNS	cyto(9),plas(8),mito(3),E.R.(3),nucl(1),pero(1),golg(1),vacu(1)	VKVPRKRGRPVGSKK (37-51, prob:0.868)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQZ9	C6 transcription factor, putative	Low	7	1	9-42	IRRPPHPTTRVSRACQRCRRQKLKCDEARPCTMC	plas(20),nucl(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS24	Translation factor guf1, mitochondrial	Low	8	1	626-650	ASDVSRRRKLLEKQKEGRKRLNAIG	mito(22),cyto(4)	RRRKLLEKQKEGRKR (631-645, prob:0.785)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU08	Membrane associated DnaJ chaperone, putative	Low	6	1	34-54	DPRPQPGTPRFDKHRRRIFIF	extr(7),mito(5),cyto(4),plas(4),mito_nucl(4),nucl(3),cyto_pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWE4	Uncharacterized protein	Low	5	1	8-27	SSTHIPRPVRTQKRLTGQQN	mito(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY24	Leucine carboxyl methyltransferase 2	Low	6.5	1	62-84	YEFFRPFVKKPQRRAPLINRGYW	plas(10),nucl(4),mito(4),pero(4),mito_nucl(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3C6	CDP-diacylglycerol synthase	Low	9.9	1	492-515	WTYVSEKRKKHVNSKKRSLTDPDH	mito(19),nucl(5),cyto(2)	KK (500-501, prob:0.614)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7F5	Zn(2)-C6 fungal-type domain-containing protein	Low	7.3	1	1-22	MNPAVPRPRWHRSPPVRQLWVF	mito(16),nucl(6),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M954	IQ calmodulin-binding motif protein	Low	8.7	1	515-536	NYTAKDRKSPVHNKFKHRSSHV	nucl(13.5),cyto_nucl(12.5),cyto(10.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC27	Zn(2)-C6 fungal-type domain-containing protein	Low	9.9	1	12-38	RTTTNGSKSSTRPRRRQVARACDWCRI	nucl(18.5),cyto_nucl(12),cyto(4.5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFZ7	Uncharacterized protein	Low	6.7	1	5-25	IKGVNCRKSLTKRPNIKQLLE	mito(17.5),mito_nucl(13.166),nucl(7.5),cyto_nucl(5.333)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGW0	1-phosphatidylinositol-3-phosphate 5-kinase	Low	8.2	1	633-654	RSHPMGHKRHHSRQQHIRGFKS	nucl(11.5),cyto_nucl(9.5),mito(8),cyto(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ75	ATP-dependent DNA helicase	Low	9.6	1	1716-1737	FDYDRFVRKKPHPTMVMRKEDG	nucl(16.5),cyto_nucl(11),cyto(4.5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPK6	Monooxygenase, putative	Low	6.8	1	96-118	SALPVKYQSRRVRRTRLQRALLN	cyto(14.5),cyto_nucl(11),nucl(6.5),pero(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTA3	DDE-1 domain-containing protein	Low	8.7	1	349-376	HDLRAAHEREKQKRQRSKQQISYEQGIT	nucl(14),cyto_nucl(11.5),cyto(7),pero(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUU9	Uncharacterized protein	Low	9.2	1	25-44	HLEKSIRQLRRKRVAWKQVM	nucl(14.5),mito_nucl(9.5),cyto(7),mito(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M183	HD domain-containing protein	Low	7.3	1	32-55	ARIEKPPGQRKRGIRTPQDRDDSI	mito(13),cyto(7),nucl(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4C5	DNA polymerase kappa	Low	8.8	1	631-653	KEQYSRKRKTTSETDPRQKRLFF	nucl(15),cyto_nucl(14),cyto(11)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6G1	WD repeat protein	Low	9.7	1	1403-1426	ATANERRRRTSSSNRKPQFDRIET	cyto(9.5),cyto_nucl(8),nucl(5.5),mito(4),plas(4),pero(2)	KKKEARKP (1119-1126, prob:0.683)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCD5	Uncharacterized protein	Low	7.4	1	60-86	KKDCMPSSSVRKRRSTPRNPSQTARLE	mito(13.5),cyto_mito(9),nucl(8),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFB1	Endo/exonuclease/phosphatase domain-containing protein	Low	9.1	1	297-324	SEWDLRPECNKNPKPKRAYDRADWDKIG	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(3),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKW1	Zn(2)-C6 fungal-type domain-containing protein	Low	8.1	1	3-32	NYGVSRACETCRKRRKKYDEGRPTCSRCAK	mito(9),nucl(8),cyto(5),plas(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMT0	60S ribosomal protein L37	Low	8	1	102-121	AAKTRKYNWSEKAKRRKTTG	mito(23.5),cyto_mito(12.5)	KAKRRK (113-118, prob:0.676)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0R1	Heme/steroid binding domain protein, putative	Low	9.9	1	36-63	TEQQRTRNRLEREYKKSNKKYVVKDDAD	nucl(19),cyto_nucl(12),cyto(3),mito(1),plas(1),pero(1),cysk(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4N9	Uncharacterized protein	Low	9.4	1	3-22	ADEARPPKRARQACEPCRQD	nucl(15.5),cyto_nucl(11),cyto(5.5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDZ2	Dolichyl-diphosphooligosaccharide--protein glycotransferase	Low	8	1	715-741	QTAVAFEKGHKKKKSTKRKGPPVLRVE	plas(20),E.R.(3),mito(2),vacu(2)	KGHKKKKSTKRKGPP (722-736, prob:0.973)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKT7	Uncharacterized protein	Low	8.6	1	767-790	ELYSVRRWNRTLRQKNPFRFSRIL	nucl(12.5),mito(9),cyto_nucl(7.5),cyto(1.5),plas(1),extr(1),pero(1),golg(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML40	DDE-1 domain-containing protein	Low	9.4	1	192-217	LRGAHEKEKQKCQRSKQQISHEQGIT	nucl(15.5),cyto_nucl(11),cyto(5.5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN15	Uncharacterized protein	Low	5	1	540-570	FGFGVRKPSKQVPFRIRRRTDLTKKDTKFNF	plas(13),extr(8),E.R.(3),mito(1),golg(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR62	Integral membrane protein	Low	9.1	2	38-65, 617-636	QQQPSTRPSLRLRRSSRQPSIRLRRLSS, AMKKVEKRKMKETVEQSRKS	plas(17),nucl(6.5),cyto_nucl(5),cyto(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSL9	Sugar transporter, putative	Low	5	1	472-491	VSAKKSRYWKPESQSRGQKI	plas(19),E.R.(5),mito(1),pero(1),golg(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTS7	BED-type domain-containing protein	Low	9.3	1	88-107	KTEYGAKKRIRWDSNRRFSS	nucl(20),cyto_nucl(11.333),mito_nucl(10.833),golg(2),cysk(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU87	Uncharacterized protein	Low	8.2	1	19-38	TDDLRQTRTQHRHRVHSHVS	nucl(10),mito(7),cyto(7),cyto_mito(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXJ8	Copper-transporting ATPase, putative	Low	5	1	1201-1221	LNVLHRSSRHRPKCSLTQRQL	plas(20),E.R.(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4P0	Uncharacterized protein	Low	5.7	1	132-157	PSIQYKCSAGWRRKDREKAEQRDGEG	mito(8),E.R.(6),cyto(4),plas(4),cyto_nucl(4),nucl(2),extr(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M955	C6 finger domain protein, putative	Low	9.3	2	2-32, 39-66	VAKLRTLTGCLQCRRRRKKCDETKPACAGCR, QWPGPDSVDKRCRRYRRAATPKSQSPPE	mito(17),nucl(6),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC49	Nonsense-mediated mRNA decay protein (Nmd5), putative	Low	7.4	1	251-270	ETNHWWKCKKWAYGNLNRLF	plas(8),nucl(6),mito(4),cyto(3),E.R.(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGK7	40S ribosomal protein S8	Low	9.7	1	8-39	RHKRSATGAKRATYRKKRAFEKGRQPANTRIG	nucl(9),mito(9),cyto(9),cyto_nucl(9),cyto_mito(9),mito_nucl(9)	RHKRSATGAKRATYRKKRAFEKGRQPANTRIGPKRVH (8-44, prob:0.976)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH89	Uncharacterized protein	Low	6	1	3-22	GNSRDHRHTGRRRYRIGPSV	mito(21),nucl(3),cyto(3),cyto_nucl(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKB7	Uncharacterized protein	Low	9.1	1	382-404	RFQAMGRKLRDRKRASRPFDTAA	cysk(16),cyto(8),nucl(3)	DRKR (392-395, prob:0.624)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMP8	Uncharacterized protein	Low	9.8	1	248-267	GFRRLIPRLRTKRQSRIIKG	nucl(17),cyto_nucl(11.5),cyto(4),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPW5	Mitochondrial thiamine pyrophosphate carrier 1	Low	9.8	1	288-309	DSDAPRKSGKRQGKRRLQLTAS	mito(11),cyto(7.5),cyto_nucl(7),nucl(5.5)	RKSGKRQGKR (293-302, prob:0.746)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSV0	Uncharacterized protein	Low	6.8	1	107-133	TIQGMFQKIHKRKWKCRNINLMIRRFC	mito_nucl(7.666),nucl(7.5),mito(7.5),plas(7),cyto_nucl(5.833),cyto_mito(5.833)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0B9	Uncharacterized protein	Low	9.9	1	731-753	SASTEPKRPQQKRSPYFTRSRAR	nucl(20),cyto_nucl(15),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1W3	Efflux pump antibiotic resistance protein, putative	Low	5	1	3-22	SCLLARRKFEQNAKRTRPTE	plas(25)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2U2	2-isopropylmalate synthase	Low	6.8	1	1-27	MPMLKDPSKKYKRFKPIHLPDRTWPNK	plas(7),cyto_nucl(6),nucl(5.5),cyto(5.5),mito(3),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M333	Solid-state culture expressed protein (Aos23), putative	Low	8.4	1	262-281	GQSPKSKTSKLEKVKSKLHL	cyto_nucl(14),nucl(12.5),cyto(10.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3H4	FHA domain-containing protein	Low	9.5	1	139-163	GTCEKCDKDRLVKRKPRETRTPFVH	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3Y8	Signal transduction protein BroA, putative	Low	8.6	1	980-999	AQSRPPYVSHQPQQHQHKGS	nucl(14.5),cyto_nucl(13),cyto(8.5),mito(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC98	Mitochondrial genome maintenance protein MGM101	Low	6.7	1	248-267	HVVNKRKSKIWIRKDEEVGY	mito(17),cyto_nucl(6),nucl(5.5),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCV4	Mitochondrial intermediate peptidase	Low	9.9	1	1-23	MVARNTRSPRKIKVHNVPWSPNS	nucl(19.5),mito_nucl(13.5),mito(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MI19	Dibenzothiophene desulfurization enzyme A, putative	Low	5	1	22-47	LSFGQWRNPKDRSKTKRRDLSYWTDL	cyto(13.5),cyto_mito(11.666),cyto_nucl(8.833),mito(8.5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZN4	HTH CENPB-type domain-containing protein	Low	9.4	2	94-115, 527-552	AKALSACQHKKKTNFSKLSREY, FAKVRDTSTRKNQKTTKRQVKSSGAL	mito(15.5),cyto_mito(10),nucl(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2W5	GPI-anchored wall transfer protein	Low	5	1	96-117	FKPVYSRQKQAKPSRANQQQNA	plas(20),mito(3),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF07	Transposable element tc1 transposase, putative	Low	7.9	1	123-143	ARALKKRGYTRCKALNKPPLS	nucl(10.5),cyto_nucl(9.5),cyto(7.5),pero(5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFZ9	Uncharacterized protein	Low	8.3	1	16-36	CTVEQYYKRVNQRERVKQLED	nucl(9),cyto(9),cyto_nucl(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTV2	MBOAT family protein, putative	Low	8	1	208-234	DTDPSKVPPTRKKRKIPRSGRPAFKKM	plas(18),E.R.(5),vacu(2)	PPTRKKRKIPRSGRPAFKK (215-233, prob:0.969)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTM3	Uncharacterized protein	Low	8.8	1	448-472	ATSPKCPKAREARQRAIRRMREQSL	nucl(12.5),cyto_nucl(9),mito(7),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWY7	Uncharacterized protein	Low	9.2	1	440-461	GDPTNRSSKKPMRAQWDKDLVI	nucl(13.5),cyto_nucl(8),plas(4),pero(4),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0C6	Kinesin, putative	Low	7.5	1	205-227	DTCGKCDKDKLVKRQPRATRTPY	mito(8.5),nucl(8),cyto_mito(6.5),cyto(3.5),plas(3),extr(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0W3	RNase H domain-containing protein	Low	8	1	1-22	MRKSSGKARKRGHKGSRAITGI	mito(26)	KSSGKARKRGHKGSR (3-17, prob:0.9)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M686	MFS transporter, putative	Low	5	1	22-41	STPPPKSRGRPPSHDSDRSH	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA32	Fungal_trans domain-containing protein	Low	8	1	4-29	SDAAFSTMKKRRRHFRSQLRVKELEQ	mito(13),nucl(9.5),cyto_nucl(6.5),cyto(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB03	MFS transporter, putative	Low	5	1	447-469	QTILLRIENRKRQRGDRDYRIEG	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDH4	C6 finger domain protein, putative	Low	7.8	1	8-34	AALACIFCRSRKRRCDARKPSCSNCLD	plas(13),nucl(7),mito(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKV6	alpha-1,2-Mannosidase	Low	5	1	82-107	QYDFPKEKSSDRRKRLERQASVKEAF	golg(7),E.R.(5),mito(4),plas(4),extr(3),mito_nucl(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV81	Uncharacterized protein	Low	7	1	501-520	HAKHGRHRYRIIKEPTKRLL	cyto(7.5),cyto_nucl(7.5),nucl(6.5),cysk(5),mito(3),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZJ7	DNA-directed RNA polymerase subunit beta	Low	6.9	1	14-34	FDTLRREKLFRNPPKDRSAYP	cyto(14),nucl(5),pero(3),mito(2),cysk(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4X1	DUF1212 domain membrane protein Prm10, putative	Low	5.8	1	353-372	SGIVKPTKRKWWEKNSSQSS	plas(16),extr(3),E.R.(3),nucl(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M596	Glycerol-3-phosphate O-acyltransferase, putative	Low	8	1	633-661	PSEPQTPNRSRSRSRSRGRRPSDSWQGFS	plas(20),E.R.(5)	RSRSRSRGR (643-651, prob:0.685)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCQ5	Integrase catalytic domain-containing protein	Low	7.6	1	406-425	GCKPIPSKWVFKRKLSPDEG	cyto_nucl(10),nucl(9.5),cyto(9.5),mito(4),pero(2),cysk(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ11	Uncharacterized protein	Low	9.8	1	1233-1255	RDTAERKAGKKTKRQVKAVGALY	pero(8),cyto(7),nucl(6),mito(6),mito_nucl(6)	RKAGKKTKR (1238-1246, prob:0.73)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2S9	Uncharacterized protein	Low	9	1	126-149	VDRVYLACKQKRRNRDQKVLIGEY	nucl(15.5),cyto_nucl(11.5),cyto(6.5),mito(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M307	Vacuolar membrane-associated protein IML1	Low	7.1	1	694-717	NVLRPTPKKYHSRKTNPRRLLESK	mito(14.5),mito_nucl(11.5),nucl(7.5),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3I8	Zn(2)-C6 fungal-type domain-containing protein	Low	6.8	1	4-42	RRSHEKSRYGCSNCKRRRVKCDEKRPYCKNCTQRNGTCV	plas(17),nucl(5),mito(3),cyto_nucl(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6Z7	C6 finger domain protein, putative	Low	7.3	1	2-23	TMEGKRYATSRRKACQHCSSAK	mito(10),nucl(6),cyto(5),plas(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M792	Meiotic recombination protein Ski8/Rec14, putative	Low	8.6	1	60-87	SVLRAVPKKKTSHMKKRHRQMAGKALKD	mito(18.5),cyto_mito(11.833),cyto(4),cyto_nucl(3.833),nucl(2.5)	PKKKTSHMKKRHRQMAGK (66-83, prob:0.886)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9Z2	ABC metal ion transporter, putative	Low	5	1	78-97	WFLLKRREPQHVPKNWHFYA	plas(21),E.R.(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEL0	Polyketide synthase, putative	Low	7	1	2527-2546	TPERKASPAGHKQDHKRSAE	cyto(14.5),cyto_mito(9.5),nucl(7),mito(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFQ8	Aspartate--tRNA ligase	Low	5	1	54-79	DDSSSPMSKNQQKRLARQQARQAKSR	mito(19),cyto(3),pero(3),cyto_pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG93	C6 transcription factor, putative	Low	8	1	24-48	LEQEEPPTKRRKTRLACDECRIKKI	nucl(10.5),cyto_nucl(9),cyto(6.5),plas(5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKS8	Uncharacterized protein	Low	9.9	1	413-436	QRKFLEREKEKEQRKMMKKSTRRG	cyto(13),cyto_nucl(12),nucl(7),mito(4)	RNAREEEIRKLRRADEEEKAEERKYAAEKLKKEERERLLRGMTAEEQRKFLEREKEKEQRKMMKKSTRRG (367-436, prob:0.943)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUQ4	Uncharacterized protein	Low	9.8	2	314-336, 374-401	LIALCKRRDRRPVKTRCSPEPVL, DLPLEERQCRYKRKYTLQKHVDRCRLKY	cyto_nucl(12.5),cyto(11.5),nucl(10.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV43	RNase H domain-containing protein	Low	5	1	462-487	EASQRFCSRGPKDPQQQNPRQRPTTG	mito(17),extr(7),cyto(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTW1	37S ribosomal protein S25, mitochondrial	Low	7.2	1	71-96	FESINQRRTNRNKKPSKLFQPLKIKY	mito(19),nucl(6.5),cyto_nucl(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX60	Uncharacterized protein	Low	9	1	109-130	SIGWSKKVVRQKAKERNQDLRD	nucl(10),cyto(9),mito(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZV8	Transmembrane transporter, putative	Low	5	1	438-457	VENKRRGKGKHDDRLRLGES	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M890	Polynucleotide adenylyltransferase	Low	9.2	1	365-388	FEPGETRPVRPKKKVAKPATAAAP	cyto(11),mito(10),nucl(3),pero(2)	VRPKKKVAKP (373-382, prob:0.792)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAT0	Glycogen [starch] synthase	Low	5	1	564-587	MFEFASKSRRQRINQRNRTERLSD	mito(9),cyto(9),cyto_mito(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME32	Uncharacterized protein	Low	7.7	1	431-456	STLRGRFRNCTKEKHERVRKPEWTLI	mito(12),nucl(8.5),cyto_nucl(7),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGL6	Uncharacterized protein	Low	6.4	1	502-527	PLTPSRLVTKRDRKRLDKSNGLKVLH	plas(7),mito(5),extr(5),nucl(4),cyto(4),cyto_nucl(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIL9	RNA polymerase TFIIH complex subunit Ssl1, putative	Low	7.3	1	22-45	VTSGARTRSGRKKQRGGANWEVSR	cyto(13.5),cyto_nucl(11.5),nucl(8.5),cysk(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTU1	MFS monosaccharide transporter, putative	Low	8	1	819-848	LNDYLRRRRRSTLRGQPSRRKKHDLGNINE	plas(23),E.R.(3)	RRRRRSTLRGQPSRRKK (824-840, prob:0.837)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3N5	Uncharacterized protein	Low	6.7	1	27-53	KDVKDPAERKRLQNRLRQRAWRKLLSS	cysk(14),nucl(5),cyto(5),cyto_nucl(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5M3	Component of oligomeric Golgi complex 3	Low	7.9	1	12-33	PSDPSGTQRKKAKAKAPVQFTQ	mito(13),nucl(9),cyto_mito(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M993	Autophagy-related protein 9	Low	8.7	1	156-183	VGPSSTRSRKRWESPRNRRKGHQFLPTP	plas(21),nucl(2),mito(2),vacu(2),mito_nucl(2)	SRKRWESPRNRRK (163-175, prob:0.757)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9K6	Tropolone cluster transcription factor tropK	Low	9.8	1	19-47	QPPGSACLHCRNKKMKCDALQPRCKNCFN	nucl(15.5),cyto_nucl(9),mito(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9X1	Leucine permease transcriptional regulator (SAC3), putative	Low	9.3	1	1055-1076	DEETPKPKRAAHQKQKKTSLAL	nucl(16),cyto_nucl(12.5),cyto(7),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC97	Serine/threonine protein kinase	Low	8.3	1	69-88	SPNDEKPQHRPGPGRRKKTG	plas(22),nucl(1),mito(1),cyto(1),cyto_nucl(1),E.R.(1),vacu(1),cyto_mito(1),mito_nucl(1)	RPGPGRRKK (78-86, prob:0.772)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME13	Actin cytoskeleton-regulatory complex protein SLA1	Low	9.5	1	541-561	NKVQRHKREKSDKSSKQKPDA	cysk(17),cyto(5),nucl(4)	HKREKSDKSS (546-555, prob:0.664)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTA6	Calcium binding modulator protein (Alg2), putative	Low	8.2	1	27-49	QSQPQTKNKYEQQRPPPPPKSNG	nucl(11.5),cyto_nucl(11.5),cyto(10.5),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTF6	Siderophore iron transporter, putative	Low	8	1	236-257	SLYINKRKGKKLRKAEGTYQRL	plas(27)	KRKGKKLRK (241-249, prob:0.83)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUZ9	Arylsulfatase, putative	Low	7.7	1	322-347	VTNYWPTRFSRNRRYKYHRNLAWRLD	nucl(9.5),cyto_nucl(9.5),cyto(8.5),pero(5),extr(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYI5	Protein kinase domain-containing protein	Low	9.3	1	338-359	CKSAARLWKKSSRDKCNGESKC	nucl(16.5),cyto_nucl(12.5),cyto(5.5),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5X5	PXA domain protein	Low	6.9	1	31-52	SQQPGRTKSRTEHRRNTPDAEL	mito(15),nucl(5.5),cyto_nucl(5),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDM6	Mitochondrial ribosomal protein DAP3, putative	Low	9.1	1	58-87	EGSPKFRESKSARMRKPKKATTDRGRPPLV	mito(20.5),cyto_mito(11.5),nucl(4)	SRSMEGSPKFRESKSARMRKPKKATTDRGRPPLVGERKALRKR (54-96, prob:0.988)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGE6	Acylamino-acid-releasing enzyme, putative	Low	7.5	1	690-712	VIDWMNKHVKPKNKEYRLYEEKI	nucl(9.5),cyto_nucl(9.333),cyto(8),cyto_pero(5.333),extr(4),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJS0	Uncharacterized protein	Low	9.1	1	226-247	NSNSNRRERSNRNSRNKRLICN	nucl(15.5),cyto_nucl(13),cyto(9.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMY7	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	229-249	MTTKSEQQQRKTRQKACNACI	nucl(12),mito(6),cyto(3),extr(3),plas(1),pero(1),golg(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN18	Efflux pump antibiotic resistance protein, putative	Low	5	1	596-619	MEWLNAKKVARKRQAQEEGNKDKE	plas(19),E.R.(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ19	Pentatricopeptide repeat protein	Low	6.7	1	840-868	ELVTLLQNNKKRKRMAKQFYHPQIHRWRN	mito(14.5),cyto_mito(10),nucl(6),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSX3	NACHT domain protein	Low	9.1	1	258-277	YDYASTWRRIRKKGKTASLS	nucl(15.5),cyto_nucl(12),cyto(7.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUF9	Dimer_Tnp_hAT domain-containing protein	Low	6.7	1	40-65	NDVAKQSWKKIKRIQKWDNRPDCTKA	mito(18),nucl(5.5),cyto_nucl(5),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW83	V-type proton ATPase subunit H	Low	8.6	1	34-57	DEHLRKIKAVDKVRKQERKQTVET	nucl(12.5),cyto_nucl(10),cyto(6.5),mito(4),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYF3	Protein HOL1, putative	Low	5	1	506-525	PMMYWGKKCRQWTKARYLDF	plas(19),E.R.(4),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYY4	Uncharacterized protein	Low	7.4	1	161-184	TALARNEYDRRVRKKNREGVVHLG	mito(10),nucl(7.5),cyto_nucl(7.5),cyto(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFH7	Cut9 interacting protein Scn1, putative	Low	7.9	1	247-266	HERKVESSRQRKKRVDEEKI	nucl(13),mito_nucl(10.333),cyto_nucl(9.833),mito(6.5),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIQ7	Fungal_trans domain-containing protein	Low	5	1	7-30	SKGLSRRFQCLRLRKSCRYEDENG	mito(23),cyto(2),pero(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ54	C6 transcription factor, putative	Low	9.7	1	91-117	AFNNCKQLARDLKRQRPSRRRLPAAIY	nucl(18),cyto_nucl(12.5),cyto(5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMH6	Phosphatidylinositol:UDP-GlcNAc transferase PIG-C	Low	8	1	87-119	GTEPRKNDIRKFRDGRRKKRKGVWKKLLWVRQS	plas(24),E.R.(2)	PRKNDIRKFRDGRRKKRKGVWKK (90-112, prob:0.992)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZC8	Peroxin-1	Low	6.5	1	1121-1143	ARLAALKQARRRQRQAEHGTHAD	cyto(10),mito(9),nucl(4),extr(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2L9	Voltage-gated chloride channel (ClcA), putative	Low	5	1	72-93	TTGGTLRRSRHHSRRASARFPV	plas(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD45	Probable endonuclease LCL3	Low	6.5	1	714-733	DNEWYRAKIRRNDREKKTAE	cyto(18),cyto_nucl(13.333),nucl(6.5),mito_nucl(4.666)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME15	Sulfonate biosynthesis enzyme, putative	Low	9.5	1	76-100	GFGFARSNPRPKKPRMKGVTEIRGP	mito(19),nucl(4),cyto(3)	RPKKPR (85-90, prob:0.703)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJT5	HTH CENPB-type domain-containing protein	Low	9.6	2	18-40, 391-415	GYGVSHKKLSRRWNGPPSRSTRS, SSMKVRDTAKRKQQQTTKRQVKAMG	mito(20),nucl(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKR4	Large-conductance mechanosensitive channel, putative	Low	8	1	221-246	KNLYNSPLRRSKRRRVVQDRKTGPGL	plas(25)	KR (232-233, prob:0.61)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRG6	Uncharacterized protein	Low	5.8	1	22-41	QFMRYYKSRGQKRERKEFKD	mito(12),cyto(5.5),cyto_nucl(4.5),pero(3),nucl(2.5),plas(2),extr(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAE0	Uncharacterized protein	Low	9.9	1	1-20	MSSKQKLNPLKRKASRELPP	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAG6	Uncharacterized protein	Low	9.2	1	41-69	SFLPRRSRPLSRPRSPFHRRPQQPPTSMP	nucl(14.5),cyto_nucl(10.5),cyto(5.5),mito(2),plas(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIK4	Nucleolar RNAse III, putative	Low	7.8	1	10-33	DKNCATFSNLHKRHKTNRAGSDCD	mito(14),nucl(7),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMI9	MFS transporter, putative	Low	8	1	278-301	PETFWDRTPRRKPKSKRPGFYRSV	plas(25)	PRRKPKSKRP (286-295, prob:0.878)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNI6	Reverse transcriptase, putative	Low	7	1	1126-1147	VLIHCPKLKTIRQELRKKIGTA	mito(6.5),cyto_mito(6.5),nucl(6),extr(6),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ58	Endo-1,3(4)-beta-glucanase, putative	Low	9.6	1	202-221	EGYKEKTKQRREQRDAARHE	nucl(17.5),cyto_nucl(13),cyto(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUY3	Reverse transcriptase, putative	Low	7.5	1	1087-1108	VLIHCPKLKTIRQELRKKIGTA	nucl(8.5),cyto_nucl(7.5),mito(6),cyto(5.5),pero(3),plas(2),extr(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU38	Patatin-like serine hydrolase, putative	Low	9.8	1	927-959	CPACDPSRLPFRGRRRRRNSNLTAEHRRKRVCV	mito(9.5),cyto_mito(7),nucl(6),cyto(3.5),plas(3),extr(2),pero(2)	RGRRRRRNSNLTAEHRRK (938-955, prob:0.852)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUP3	Phospholipid:diacylglycerol acyltransferase, putative	Low	9.2	1	29-81	SDAETKTKTSRKAHKHGTNAERDKKQSLSPIVRLKRYITKPRGKRRHSFVFLL	plas(16),nucl(3),E.R.(2),golg(2),mito_nucl(2)	RKAHKHGTNAERDKKQSLSPIVRLKRYITKPRGKRR (39-74, prob:0.862)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYM6	Ankyrin repeat-containing protein, putative	Low	5.9	1	653-678	GRHLDIVKRLRERKPNFNPQREEFGN	cyto_mito(11.666),cyto(11),mito(10),cyto_nucl(8.666),nucl(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0U7	Isoleucyl-tRNA synthetase	Low	8	1	895-914	WPTLGKKLKKDAQKVKKFLP	cyto_nucl(12),nucl(11),cyto(11),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4A6	Isoleucyl-tRNA synthetase	Low	6.1	1	1026-1046	LLPPLKQKKSKGTKEQKVSGP	cyto(11),cyto_nucl(8.5),mito(8),nucl(4),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4Q5	Ribosomal protein L14	Low	5	1	120-139	FERFKVMRLKKQSRYEVLKA	cyto(24),mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9B3	Uncharacterized protein	Low	5.4	1	1-21	MRARVIPKKNQNYFCKHRILR	plas(19),E.R.(4),nucl(1),mito(1),pero(1),vacu(1),mito_nucl(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBN8	Sister chromatid cohesion protein Dcc1, putative	Low	6.8	1	385-404	SGAKAKNSRNWHERFKSQRK	mito(13.5),cyto_mito(9.833),nucl(7.5),cyto_nucl(6.833),cyto(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHU2	Uncharacterized protein	Low	8	1	242-270	LCCFCLVRNRRKAAKRRRNNMHNRWAPNA	extr(21),mito(2),plas(2)	NRRKAAKRRR (250-259, prob:0.873)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU40	Integral membrane protein	Low	5	1	950-975	STHSSNRPPVPRKSSRRYGPHDPLDE	plas(16),extr(8),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWY5	Transposable element tc1 transposase, putative	Low	9.2	1	44-63	STIRNTIKKEHQRVNQRSLP	nucl(16.5),mito_nucl(11.5),mito(5.5),cyto(2),pero(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ72	Uncharacterized protein	Low	8	1	1-22	MPKKGGKKHNKNKNKGAGGAKV	mito(23.5),mito_nucl(13.5)	KKGGKKHNKNKNKGAGGAK (3-21, prob:0.941)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0A8	Uncharacterized protein	Low	9.9	1	10-31	QAVARRRKTVFRKLRQLCLQYN	nucl(17.5),cyto_nucl(11),mito(4),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M109	Nonribosomal siderophore peptide synthase SidC	Low	5	1	686-707	AEYLTRQKEKFTKKRTFRDSLE	plas(18),cyto(3),mito(2),cyto_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1N3	Chloride channel protein	Low	5	1	78-97	DEVQEQIRRRARRREGHGFW	plas(25)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M363	Uncharacterized protein	Low	7.2	1	277-296	QPTQTKQPSKHRRKAAPSDL	mito(13.5),mito_nucl(11.833),nucl(9),cyto_nucl(6.333)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4R1	Copper homeostasis protein cutC homolog	Low	6.5	1	356-376	VRSTNVKELRRQNPRARFFHS	mito(11.5),cyto_mito(9.666),cyto_nucl(7.333),cyto(6.5),nucl(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG01	Aconitase, mitochondrial, putative	Low	8.1	2	381-400, 835-856	LDFVNRRRIRKHKNNAIYFQ, IFQRVKMPTIRKKDPLKSDQIE	cyto(14),mito(7),nucl(3),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ28	Phosphotransferase	Low	8.6	1	130-151	SERSRDTIRKAQRQRVRRTLEK	nucl(14),cyto_nucl(13.5),cyto(11)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT87	NUDIX domain protein	Low	5	1	260-279	KSITKPRPQTRLKSIQKRIQ	mito(20.5),cyto_mito(12.333),cyto_nucl(3.333),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWZ7	Nitrate reductase [NADPH]	Low	9.4	1	148-167	TDNQKPQKEHEWRRSRGENE	nucl(16.5),cyto_nucl(11.5),cyto(5.5),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYC8	Uncharacterized protein	Low	9.2	1	151-181	WCSLLRRKTRNYHWRCCHKRRDRSKSTSGFS	nucl(11),cyto(8),cysk(3),mito(2),plas(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZP0	Uncharacterized protein	Low	7.1	1	50-76	ENVRTCLKKYTNKRKTRTRPILKTANM	cyto(8.5),cyto_nucl(8.5),nucl(7.5),mito(5),pero(3),cysk(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9B1	RTA1 domain protein, putative	Low	5	1	204-225	VSAVFHWRVKRRKSRNISPLSG	plas(20),mito(4),E.R.(2),cyto_mito(2),mito_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBY2	WAPL domain-containing protein	Low	9.8	1	69-92	SQDGRSSVRSPKRRKLTPVDDDDD	nucl(15.5),cyto_nucl(9),plas(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME79	Aminopeptidase	Low	5	1	81-105	CLPQISKRYCSYRRMCRSRHADESF	mito(15.5),cyto_mito(11),cyto(5.5),extr(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFM8	C3H1-type domain-containing protein	Low	9.6	1	8-38	REFAKSGTCKFKKCKFRHKKDDQMAPHTKEN	nucl(12),mito(11),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH17	Patatin-like phospholipase domain-containing protein	Low	8.8	1	58-99	VAINDWRPIRQRVRRPFRSRTVSSTPKKTPRRSKDETREGFL	plas(21),nucl(2),E.R.(2)	VRRPFRSRTVSSTPKKTPRR (70-89, prob:0.693)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHL2	Uncharacterized protein	Low	6.1	1	345-365	FNLHFKRNRALQRKVPPRGVF	mito(19),nucl(3),cyto(3),cyto_nucl(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MID9	Fungal specific transcription factor, putative	Low	7.3	1	10-39	ANHARYVCRSCKTRKRKCNKALPGCSSCSK	plas(17),nucl(6),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJN9	DDE-1 domain-containing protein	Low	9.2	2	188-207, 209-230	VTRGRRPNRRTSSRNLRNEG, NSNSNRREQSNRNSRNKRLICN	mito(18),nucl(6),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ39	Uncharacterized protein	Low	7	1	1-23	MAKLGKPKGTRNKKTLERLNQMA	plas(10),nucl(5),mito(4),golg(3),cyto_mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR22	DUF2439 domain-containing protein	Low	9.2	1	24-45	IKFRCLYTHDVRRKAKRWQDGY	nucl(16),cyto_nucl(12.5),cyto(7),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR96	Uncharacterized protein	Low	7.8	1	27-48	SVYFLSQKVKHHKKQSMTTPSS	cyto(14.5),cyto_nucl(14.5),nucl(11.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT01	Fungal specific transcription factor, putative	Low	9.3	1	6-31	LGVGPSCNECRRRKIKCDRSIPCSYC	nucl(16.5),cyto_nucl(11),mito(6),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0B8	Uncharacterized protein	Low	9.2	1	197-219	TPSSSIPRRRSARHQNRHGPLSV	nucl(20),mito_nucl(12.333),cyto_nucl(11.833),mito(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M505	Cytochrome P450, putative	Low	5	1	497-518	GAKPFPCKITPRSNKRRETIME	plas(7),extr(7),E.R.(5),mito(2),pero(2),golg(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9S0	Uncharacterized protein	Low	8.3	1	4-23	SVVTRRRDMKCKTKMKTGCS	mito(11),nucl(9),plas(2),pero(2),cyto(1),extr(1),golg(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAK6	GTP binding protein (EngB), putative	Low	5.5	1	224-244	LCDKIKSIKHWHYNRKIKLSK	mito(24),cyto_nucl(2),nucl(1.5),cyto(1.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP36	YL1_C domain-containing protein	Low	8.4	1	39-67	IASLPRPFRNRNWKPSQRRNKNVKQLLSE	nucl(14.5),cyto_nucl(9.833),mito(7.5),cyto_mito(6.333),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPW2	ATPase synthesis protein 25, mitochondrial	Low	9	1	192-212	GRNELKIKLRRKARRARLASS	mito(21),nucl(3),cyto(3),cyto_nucl(3)	KIKLRRKARRAR (197-208, prob:0.883)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUP5	Uncharacterized protein	Low	7.4	1	153-175	YAQKCPTVRKTQRSKNRILPKHG	mito(12.5),mito_nucl(11.833),nucl(10),cyto_nucl(6.833)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVP4	Sterol desaturase family	Low	8	1	67-88	IALPSGHKRRKISRKEVKIIGW	plas(19),vacu(3),mito(2),E.R.(2)	HKRRKISRK (73-81, prob:0.758)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVS7	MFS monosaccharide transporter, putative	Low	5	1	490-514	EAPNPVRKSLEKRPRRTVEHTTYHE	plas(24),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY74	Stromal membrane-associated protein	Low	7.8	1	23-46	LESNKTCADCKRNKHPRWASWNLG	nucl(9),cyto_nucl(7.5),mito(7),extr(5),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYH2	Uncharacterized protein	Low	8	1	68-92	NAGVLKKKAKNKKLTRSQRLRQQKG	mito(25)	KKKAKNKKLTRSQRLR (73-88, prob:0.902)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYV9	Dimethylaniline monooxygenase, putative	Low	5	1	471-490	DTFVRLIKRRQEWWKRAAEQ	extr(8),plas(5),cyto(4),E.R.(4),mito(2),cyto_nucl(2),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZF7	Uncharacterized protein	Low	5.8	1	10-29	VSGIKKRKSVATPRNRAFPF	mito(20),cyto(3.5),cyto_nucl(3.5),nucl(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0D3	Hsp70 family protein	Low	5.8	1	2-27	TSRFKQFGFSSKRKNSNNPPPPQTTP	mito(17.5),cyto_mito(11.5),cyto(4.5),nucl(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5C3	COPII-coated vesicle protein (Erv41), putative	Low	8.3	1	163-187	HHVLSHTRRNPRRKFPKTPRLSAKY	plas(21),cyto(2),nucl(1),mito(1),E.R.(1),golg(1),mito_nucl(1),cyto_pero(1)	RNPRRKFPK (171-179, prob:0.698)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNR8	Uncharacterized protein	Low	6.9	1	81-102	RFFARARKSKWRDDNSRQQPAK	cysk(18),nucl(5),cyto(2),plas(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQZ0	RHOMBOID-like protein	Low	8	1	118-144	PMDPVMGARKKRRRTRRGGFFGKRTPW	plas(25)	ARKKRRRTRRGGF (125-137, prob:0.963)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRB2	MAP kinase kinase kinase SteC	Low	9.1	1	121-142	IKQLRNKALLNRKKKNNTASLT	nucl(15.5),cyto_nucl(11),mito(6),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7S3	HEAT repeat protein	Low	6.8	1	1493-1517	VVTRLMRETFPKKKRNEFKSFETLF	cyto(10),cyto_nucl(9),nucl(6),plas(3),mito(2),pero(2),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7Y3	Seryl-tRNA synthetase	Low	5.8	1	669-689	DYQSRRLGTRIRNNQDQKSRY	plas(21),E.R.(3),nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGM2	Cytoplasmic tRNA 2-thiolation protein 1	Low	6.2	1	8-33	NCQTSRAVIIRPKNRHKLCKSCFISI	mito(20.5),mito_nucl(13),nucl(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMP5	C6 finger domain protein, putative	Low	8.7	1	23-53	KSRRTLSCLSCQKRKLKCDRVKPCRACCMRG	nucl(12.5),cyto_nucl(9.5),mito(6),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQK7	Uncharacterized protein	Low	7.7	1	512-531	EQEKEKKTTPLPKRASRAVF	nucl(11),cyto_nucl(9.833),cyto_mito(7.166),mito(6.5),cyto(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR28	Uncharacterized protein	Low	8	1	44-63	ARALKEAKRRSRKHAFRLSN	mito(9),extr(9),cyto(4),plas(4)	LKEAKRRSRKH (47-57, prob:0.815)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUL3	Actin filament organization protein App1-like, putative	Low	7.6	1	56-83	EEVVRRRSHSVEKKTSRKHLHRILRIIG	mito(13),nucl(8.5),cyto_nucl(7),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWY9	Efflux pump antibiotic resistance protein, putative	Low	5	1	9-28	ESATRSKRPVPTNERVSRKV	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYB6	Cell division control protein Cdc48	Low	9.7	1	28-49	LDTATAILKKKKKPNSLIVTDA	nucl(18),cyto_nucl(13.5),cyto(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYF7	Ribosome assembly factor mrt4	Low	9.3	1	5-31	KRARIVHESKTSKKNHKEQTRRLFANI	nucl(16),cyto_nucl(11.5),mito(5),cyto(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Y5	WD repeat protein	Low	9.7	1	358-381	SSDRAAARARDKKKYKDEKRFRPY	mito(11.5),cyto_mito(8.166),nucl(7),cyto_nucl(6.333),extr(4),cyto(3.5)	ARARDKKKYKDEKRFR (364-379, prob:0.844)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M781	Cytochrome c oxidase assembly protein COX20, mitochondrial	Low	7.1	1	9-28	DPASNKSPTNRPKHEFPKTQ	cyto(11.5),cyto_nucl(10),nucl(7.5),pero(4),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9J9	3-methylorcinaldehyde synthase tropA	Low	8.8	1	1637-1659	TPIPKAAAPKKEKKRPGNPKLDV	cyto(10.5),cyto_nucl(7),mito(5),plas(5),nucl(2.5),extr(2)	KAAAPKKEKKRPGNP (1641-1655, prob:0.915)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9M5	Mitochondrial fusion protein (Ugo1), putative	Low	7.7	1	447-471	VSRIVGTQGRQRRKRPGQGIQGLYR	nucl(8),mito(6),cyto_nucl(6),plas(5),cyto_mito(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFD0	Mitochondrial dihydroxy acid dehydratase, putative (Fragment)	Low	5	1	586-608	EEELEKRLKNWQPPKPQVTRGVM	cyto(15),cyto_mito(12.833),mito(9.5),cyto_nucl(8.333)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK43	C6 transcription factor, putative	Low	8.4	1	1-25	MPSPSKQCHSCRRSRLRCDGGQPTC	nucl(11.5),mito(9),cyto_nucl(7.5),plas(3),cyto(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLI0	Chloride channel protein	Low	5	1	49-74	DIEPTKTRISFKRKQKQPARFSLSKV	plas(25)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQI1	Transcription factor (Sin3), putative	Low	8.6	1	1496-1520	KELAVVKERRRDRFREKFINNPAWA	nucl(13.5),cyto_nucl(11),cyto(7.5),mito(3),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS79	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	16-52	SSLAPNRSRKSKVKSGCRTCKLRKIKCDEHRPMCMRC	nucl(12),cyto(6),plas(5),mito(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV20	C2H2-type domain-containing protein	Low	8.3	1	289-308	DSRSRNRKEKVQRPLLCFLC	nucl(12),mito(12),mito_nucl(12)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTP5	Protein-lysine N-methyltransferase EFM6	Low	9.2	1	207-231	PDTICYFCFKRRRRADLRCIKMIKK	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV27	Monoxygenase, putative	Low	5	1	389-409	IYEWQYKPTGRDKKKCEEEVY	cyto(14.5),cyto_nucl(8),mito(4),extr(3),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYL8	Uncharacterized protein	Low	8	1	212-235	GRNSSDKKAAQKLKHKRPHFDLER	extr(18),plas(5),golg(3)	KKAAQKLKHKR (218-228, prob:0.689)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M072	Fe-S cluster assembly protein dre2	Low	9.2	1	204-225	AECQPETAKKRRRACKDCTCGL	nucl(16.5),cyto_nucl(13.5),cyto(9.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M812	Probable E3 ubiquitin ligase complex SCF subunit sconB	Low	7.4	1	5-26	DSYPHRSARRRPSLLLRARPKT	mito(15),nucl(8),cyto_nucl(6),cyto(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MST7	C6 transcription factor, putative	Low	6.2	1	33-56	KQIVSQTKWKKGKQSLLHSRRSSQ	plas(22),nucl(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTN9	NADH-ubiquinone oxidoreductase subunit B, putative	Low	5.8	1	228-247	IFQLQKKMRHTKITRMWYRR	mito(17),cyto(4),nucl(2),plas(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVG6	Uncharacterized protein	Low	8	1	274-300	CCCACCGGRKARKQLKAQASRRKEQSL	plas(23),E.R.(2)	KARKQLKAQASRRK (283-296, prob:0.698)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0U6	Intracellular protein transport protein (UsoA), putative	Low	9.5	2	887-908, 947-966	FENKLKQATKRASKAEKRAQAF, FGDLETKRKQEKQRLKELGE	cyto_nucl(9.5),nucl(8.5),cyto(7.5),mito(4),E.R.(3),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1C6	BRCT domain-containing protein	Low	8.8	1	1-27	MNPPAKRSETNPKPKNKHIFDPWNSSS	nucl(18),mito_nucl(12.833),cyto_nucl(10.333),mito(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7M5	Uncharacterized protein	Low	9.4	1	194-214	VGSVSEKRRSNKKSLKKSSVV	mito(20.5),cyto_mito(11),nucl(5)	SEKRRSNKKSLKK (198-210, prob:0.824)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ73	3-oxoacyl-acyl carrier protein reductase	Low	6.2	1	218-237	LKSCMRARSREKNRKLNDTE	mito(16),cyto(5.5),cyto_nucl(5),nucl(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWH9	Zn(2)-C6 fungal-type domain-containing protein	Low	8.9	1	37-70	TNSKQFVCTNCKLRKKKCDKVKPRCGYCCRKSLS	nucl(13.5),cyto_nucl(11),cyto(7.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ73	Glutamate decarboxylase	Low	7.6	1	158-177	ATLAMKKRWQNRRKAEGKDW	nucl(10.5),cyto_nucl(9.833),cyto(8),mito(6),cyto_pero(5.833)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBY5	Transcription elongation factor 1 homolog	Low	8.8	1	1-22	MGKRKKSSRGPQGPKKREPLAT	cyto(15),mito(8),nucl(2)	KRKKSSRGPQGPKKR (3-17, prob:0.892)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEV1	Uncharacterized protein	Low	9.3	1	123-142	NDILQKRRTRRTKALQADGI	nucl(16.5),cyto_nucl(10.333),mito(6.5),cyto_mito(5.333)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJX2	GNAT family acetyltransferase, putative	Low	9.3	1	191-212	ELDQWKNWKSKRWRRGVMARKS	cysk(12),cyto(7),cyto_nucl(6.333),cyto_mito(5.833),nucl(4.5)	KSKRWRRGVMARK (199-211, prob:0.746)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXU3	Uncharacterized protein	Low	9.4	1	136-161	QIKEKAERVLRQKKPRNHRVRLDDIE	extr(6),E.R.(5),golg(5),nucl(4),cyto(3),vacu(2),cyto_mito(2),cyto_pero(2)	K (149-149, prob:0.602)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8N4	Uncharacterized protein	Low	8.8	1	28-47	QDEHKVGRKRRRSEVDDLIE	nucl(14.5),cyto_nucl(11),cyto(6.5),mito(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9N3	Uncharacterized protein	Low	8.7	1	118-139	EEQFFWAPRKKKTRQAQVASEV	nucl(10),plas(8),cyto(4),golg(2),mito(1),pero(1),E.R.(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME14	Cytochrome P450 alkane hydroxylase, putative	Low	5.8	1	23-46	SSIYKNIKNRRNAAARRCQPPNKI	mito(8),extr(8),cyto(4),pero(3),nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKC5	Uncharacterized protein	Low	8.2	2	4-28, 39-66	YCCIPINIKHRGKKNSKSTKDTTSE, LGSTPNRQQRKQPPRRSQAQQRAAARER	mito(18.5),cyto_mito(10.833),nucl(4.5),cyto_nucl(3.833)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMF5	Uncharacterized protein	Low	8.3	1	27-47	IQTRTKKKAANKVRDSKFNLI	cysk(13),nucl(9),cyto(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTG5	Peroxisome biosynthesis protein (PAS8/Peroxin-6), putative	Low	8	1	5-32	AVSAAPVHKRRRALRKRIRAQSPISGRL	mito(19.5),cyto_mito(13.833),cyto(7)	HKRRRALRKRIR (12-23, prob:0.897)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUA5	DDE_3 domain-containing protein	Low	7.4	1	84-106	SIGWSKKVVRQKAKERNRALRDE	mito(16),nucl(7),cyto(2),pero(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZM4	Uncharacterized protein	Low	5	1	519-538	LTVRRWAAAREKRWERKSSQ	plas(22),E.R.(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5B4	Alpha-1,6 mannosyltransferase subunit (Mnn9), putative	Low	5.4	1	51-75	HPLSPPTKPFPKKHTQGRKGQDAPP	extr(7),golg(7),E.R.(4),mito(3),plas(3),nucl(1),cyto(1),cyto_nucl(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6F2	Uncharacterized protein	Low	9.4	1	1-26	MHTEQPIRSRRRPRPLQDSTPKEVYK	nucl(14),mito(6),cyto(6),cyto_mito(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8K2	AP complex subunit beta	Low	7	1	23-43	NSGGKKDKNHSAKKIALKKIV	cyto(17.5),cyto_nucl(13),nucl(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8Y8	Uncharacterized protein	Low	8.3	1	450-471	RDIATRKNQKTTKRQVKASGAL	cyto(13),nucl(9),pero(2),mito(1),extr(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAA1	Uncharacterized protein	Low	8.2	1	415-441	CRINWFRQMCQSRRRHGRTMRPDEEEI	nucl(8),plas(6),mito_nucl(6),golg(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ04	Uncharacterized protein	Low	9.1	1	72-105	STRPSSPDDGRRKKNKAGKKKRAVKSRIPPESKL	cyto(6),mito(5),plas(4),mito_nucl(4),nucl(3),extr(3),golg(3)	GRRKKNKAGKKKRAVKSRIP (81-100, prob:0.996)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJM8	Zn(2)-C6 fungal-type domain-containing protein	Low	9.8	1	18-41	LACNTCRERRTKCDGQRPKCSFCM	nucl(12),mito(5),plas(4),cyto_mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV38	Uncharacterized protein	Low	5	1	133-152	SVEPYKVKLKRCYHCQKFGH	cyto(16),mito(9),cyto_nucl(9)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUP9	GTPase activating protein Sar1, putative	Low	8.2	1	665-689	HNVRSQSEGKSRKQQKNQELGPYKF	mito(12.5),mito_nucl(12.5),nucl(11.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVZ8	Glycerol-3-phosphate acyltransferase Sct1, putative	Low	8	1	693-714	VSKRIRGAMRERGKERRQRSED	plas(19),E.R.(4),cyto(1),extr(1),pero(1),vacu(1),cyto_pero(1)	RIRGAMRERGKERR (696-709, prob:0.722)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAR3	MFS multidrug transporter, putative	Low	8	1	275-296	APSLLKKRAKKLRKTENDDKYV	plas(27)	KKRAKKLR (280-287, prob:0.751)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHF3	UDP-galactose 4-epimerase, putative	Low	9.1	1	166-185	APLKEARKRHKEKWHDSGVR	cyto(13),cyto_mito(11),mito(7),nucl(4)	KR (173-174, prob:0.615)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MM50	ATP-dependent DNA helicase	Low	7.3	1	358-377	YERFVRKKPHPTMVMRKEDA	cyto_nucl(11.333),cyto(10.5),nucl(10),cyto_mito(6.666),pero(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMW4	SURF1-like protein	Low	5.3	1	328-349	LWMVVRKRPNEALRRVRQSRNM	mito(13),plas(9),E.R.(2),nucl(1),cyto(1),cyto_nucl(1),pero(1),cyto_pero(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPE9	CFEM domain-containing protein	Low	6.2	1	259-281	AMILCGRRLRRRKLRQAAPQSFE	extr(12),plas(5),mito(4),nucl(3),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUS0	C6 transcription factor, putative	Low	9.2	1	107-132	SARSSSRKAVRSSRRNPTPRNVQNSL	nucl(11),mito(6),cyto(5),extr(2),golg(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAH7	Mutator-like element transposase, putative	Low	8.3	1	55-78	CDRACIPPTPRERQRKTTTRGTSC	nucl(12),cyto_nucl(10.5),cyto(7),pero(4),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB86	C6 transcription factor, putative	Low	8.8	1	20-43	ACDACRTRKSRCDGRRPKCGMCED	mito(11),nucl(10),cyto(3),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGC3	DDE-1 domain-containing protein	Low	8.4	1	321-344	DLRAAHEKEKQKRQISHEQLRHSY	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(3),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHU6	26S proteasome regulatory subunit RPN2	Low	5	1	914-940	VLSTTNQAKRRAQRREKQQRRESMDVD	cyto(13.5),cysk(12),cyto_nucl(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML12	Sugar transporter, putative	Low	5	1	8-34	DSNATLRRRKEPLNRRRQNFNNLLRNN	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVD9	Uncharacterized protein	Low	9.5	1	625-648	APDQVPRRSRQRLERIIREHHRRD	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTM6	Reverse transcriptase, putative	Low	6.7	1	143-163	LNKHCKQIKLCARSKRWWNSE	mito(11),cyto_nucl(6.5),nucl(5.5),pero(5),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU95	HTH CENPB-type domain-containing protein	Low	8	1	554-576	RDIATRKNQKTTKRQVKASGALY	extr(12),E.R.(4),golg(4),vacu(3),plas(2)	RKKLSRRWHG (106-115, prob:0.702)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWN3	Xanthine dehydrogenase HxA, putative	Low	5.5	1	261-280	LAIGNKKKRWYRPVTLQQLL	cyto(18),cyto_nucl(11),cysk(5),nucl(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY56	General transcription and DNA repair factor IIH subunit TFB4	Low	9.8	1	345-372	DYGARPAVLGKKKKKKKARLNGSSATAT	extr(9),cyto_nucl(6),nucl(5.5),cyto(5.5),mito(3),plas(2)	LGKKKKKKKAR (353-363, prob:0.984)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2F9	Chitin synthase	Low	5	1	228-247	SRFPHGGKRHCQKRTFKLID	plas(17),mito(6),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4U2	Phospholipid-transporting ATPase	Low	5	1	21-40	TSEISKPTNRQRWATRRLQN	plas(24),cyto(1),golg(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8B0	Mitochondrial import inner membrane translocase subunit TIM50	Low	5	1	37-56	VLPNQKPKPAQPNPARSQSN	mito(26.5),cyto_mito(14)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA77	Reverse transcriptase, putative	Low	9.3	2	143-164, 1049-1070	LNKHCKQIRLCARSKRWWNSEI, LNKHCKQIRLCARSKRWWNSEI	cyto_nucl(9.5),nucl(8.5),cyto(7.5),mito(6),pero(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCD9	Uncharacterized protein	Low	5	1	68-90	VVYSSSSRPRRERRSRGYRSGGG	extr(10),mito(7),cyto(5),plas(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDK8	Mitochondrial large ribosomal subunit protein L1, putative	Low	8	1	42-74	RTATSNPQAKGKKNKQKESKKKVKGARDYQQKD	mito(20),cyto(5),cyto_nucl(4.5)	AKGKKNKQKESKKKVKGA (50-67, prob:0.963)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDU8	Homeobox transcription factor, putative	Low	9.1	1	181-200	GDNSKKTKRFRLTHNQTRFL	nucl(14.5),cyto_nucl(9.5),mito(8),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQD3	C6 transcription factor, putative	Low	9.4	2	19-43, 54-78	RQGCLNCKARRVKCQETRPQPYYNC, PENQLGRRRNGSRRNSDRKGPSRLD	mito(10),nucl(6),cyto_mito(6),plas(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRW0	Sodium/hydrogen antiporter, putative	Low	7	2	377-396, 505-525	KTSTTERKTDRRKSREASRL, VGTLTKRVKKLQRLRVDSGGE	plas(17),E.R.(5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSJ4	Uncharacterized protein	Low	7	1	499-526	RSDCRLFKHSNKERRRARERFNDYQRVD	mito(16),nucl(6.5),cyto_nucl(6),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUM2	Alpha-glucosidase, putative	Low	6.9	1	1-20	MPQREFVPKKYKLREQDGTN	cyto(10),cyto_nucl(9.5),nucl(7),mito(6),extr(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWK5	MFS transporter, putative	Low	8	1	538-565	YIWGMEWRQKRWKKAAEKAKRERQNGTV	plas(27)	QKRWKKAAEKAKRER (546-560, prob:0.876)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX82	Uncharacterized protein	Low	8.6	1	11-30	GQVIRASKRRKLDEHRDSEQ	nucl(12),cyto_nucl(9.5),mito(7),cyto(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1N6	Pentatricopeptide repeat protein	Low	5	1	104-124	DSDWRQFQFKRRIGWKPKDEV	mito(23),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M908	MFS multidrug transporter, putative	Low	5	1	147-166	LGVVYSKPSKRKNRAFACFS	plas(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG97	Zn(2)-C6 fungal-type domain-containing protein	Low	8.6	1	18-58	PDSRTKTKSGANRKLRIPKACYPCYKRKVKCDRNSPCSLCV	nucl(10),plas(6),mito(4),cyto(4),cyto_mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJW8	Ion channel, putative	Low	5	1	189-216	GSMIKRTVKCKYCRKWINRKAVRCVNCS	plas(15),mito(4),E.R.(4),extr(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMU2	SMP-LTD domain-containing protein	Low	8.3	1	637-659	KTEGDSPKAHRRNRSKRDATSSM	extr(7),golg(6),E.R.(5),vacu(4),cyto(2),mito_nucl(1),plas(1),mito(1),nucl(1),cyto_pero(1)	RKPVPPAPGQSSEEKKEDKRPVPSPPLPKRK (834-864, prob:0.776)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUU4	Mitochondrial inner membrane translocase subunit TIM44, putative	Low	6.4	1	248-269	GWIEKEERRRQRQQREENEAKS	mito(18.5),cyto_mito(11.5),nucl(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYV7	60S ribosomal protein L10	Low	7.4	1	1-31	MARRPARCYRYCKNKPYPKSRFNRGVPDPKI	mito(15),nucl(6),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M005	Protein kinase domain-containing protein	Low	6.7	1	17-36	PDIDRRRKVLHKTCHPNLVN	mito(10),cyto(7.5),cyto_nucl(7),nucl(5.5),plas(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2A8	Polyketide synthase, putative	Low	6.6	1	371-392	QIPPQMHFKKPNPKINWDRILV	cyto(11),cyto_nucl(9.5),nucl(6),mito(3),plas(3),extr(1),pero(1),E.R.(1),golg(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2X0	Uncharacterized protein	Low	9.5	1	1-23	MGQRHNRRRTRPRSRNRAASLDS	mito(10),plas(6),cyto_mito(6),nucl(4)	RRRTRPRSR (7-15, prob:0.722)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M482	Subtilisin, putative	Low	5.7	1	27-48	ILRTKGEPLNKRQKEKLKDLDV	cyto(20),cyto_nucl(13.333),cyto_mito(11.499),nucl(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCU7	Uncharacterized protein	Low	7	1	4-25	TTTVGARPRRGPRQQESRPAGK	mito(17.5),cyto_mito(10.5),nucl(7)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDJ1	Zn(2)-C6 fungal-type domain-containing protein	Low	8.4	1	31-70	ITACVACRKQKVKCNMRDGQAPCSRCKKRGLSCTVNRSLQ	nucl(12.5),cyto_nucl(9.5),cyto(5.5),mito(5),plas(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEA7	pH response protein PalF	Low	8.5	1	17-38	GWVNKLTSRFHNRKRNISEFYV	cyto_nucl(14),nucl(13.5),cyto(11.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEL9	Uncharacterized protein	Low	5	1	1-24	MSPSRPQKRPKTLRKWTVRLSALF	plas(11),extr(7),mito(6),cyto(1),E.R.(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIK6	LEM3/CDC50 family protein	Low	5	1	20-43	SDDADKKKNRRPANTAFRQQRLRA	plas(24),mito(1),cyto(1),pero(1),cyto_mito(1),cyto_pero(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIX4	Mitochondrial import inner membrane translocase TIM40	Low	5.8	1	47-69	FVPNPPSQKRRSWRNRLVRLGLA	mito(24),nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML30	Lectin C-type domain protein	Low	5.7	1	530-557	ATLFVKCNSNRRISRRKRVNQGWDYEGV	extr(16),cyto(3),nucl(2),E.R.(2),golg(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ44	Cytochrome P450, putative	Low	5.6	1	22-44	LSWARIRVKRRLHGCQLPPRYPH	extr(10),E.R.(4),plas(3),golg(3),cyto_mito(2),cyto_nucl(2),cyto(2),mito(2),nucl(2),mito_nucl(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ76	Uncharacterized protein	Low	7.2	1	390-412	AADGRDKRKTQRMKRTNIFLHAG	cyto_nucl(9.5),cyto(9),nucl(8),mito(6),extr(1),pero(1),E.R.(1),cysk(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTD0	Uncharacterized protein	Low	7.4	1	744-765	NEVNMVQKKSFKKPTRESIAGP	cyto(13),cyto_nucl(12.333),nucl(10.5),cyto_mito(7.333)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVF8	Uncharacterized protein	Low	9.6	1	44-67	IEKGLMRKYKLRKMKKFKWFLNIR	cyto(8.5),cyto_nucl(7.5),pero(7),mito(6),nucl(5.5)	RKYKLRKMKK (50-59, prob:0.716)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU37	Uncharacterized protein	Low	8.6	1	4-30	HIHDRRVRTKYEKRKRTVLKKLWEFFT	nucl(12.5),mito(10),cyto_nucl(8.5),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6U6	Uncharacterized protein	Low	9.3	1	77-97	TTTASNKQSGRQRNNQQPRVD	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBS6	Uncharacterized protein	Low	7.4	1	17-36	TTNNKSTQRRITSRNPQWTY	cyto(13),cyto_nucl(12),nucl(9),mito(2),extr(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIW8	Mitochondrial carrier protein, putative	Low	7.6	1	76-98	IQRLAARKKQPRSSDKADRQTGY	cyto_nucl(9),nucl(8.5),cyto(8.5),mito(4),plas(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNW3	Ser/Thr protein phosphatase family	Low	5	1	167-186	PLGPRFRKLTTKKKGYRIMA	extr(23),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUZ3	WD repeat-containing protein, putative	Low	6	1	169-195	ESILERNPRLRQKYRRPQPSSDRLFKA	cyto(11.5),cyto_nucl(8.833),cyto_mito(7.666),cysk(5),nucl(4),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV67	F-box domain-containing protein	Low	9.9	1	440-459	LWDRHCKEPKYRIYSRPIPD	nucl(18),cyto_nucl(13),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV84	Uncharacterized protein	Low	8.5	1	114-136	QLDTLKSEQKHQRKQKAQKVVEP	mito(14),nucl(9),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ79	Pro-apoptotic serine protease NMA111	Low	8.3	1	1-23	MTGESRPKRKHSSVSASDRPSKH	nucl(11.5),cyto_nucl(9),cyto(5.5),pero(5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2P3	Uncharacterized protein	Low	8.6	1	13-32	TTNTSPPSTKRPPLHRHTSS	nucl(13.5),cyto_nucl(10.5),mito(9),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIJ1	Reverse transcriptase, putative	Low	6.3	1	10-32	HDHVRIARWVRNRGKPRATFTPT	mito(14),pero(5),cyto_nucl(4.5),nucl(4),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKA3	Uncharacterized protein	Low	9.9	1	244-279	PVTGVIDKEERKRRKKERRQAEKKARKQQAREAGEE	cyto(14.5),cyto_nucl(11),nucl(6.5),cysk(3)	ERKRRKKERRQAEKKARKQ (253-271, prob:0.996)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRW3	DUF821 domain protein	Low	5.7	1	4-25	PGKVNTRQKMAKQQQSKPTWAT	mito(15),plas(6),nucl(2),cyto(1),extr(1),pero(1),vacu(1),cyto_pero(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSW8	C2H2-type domain-containing protein	Low	9.1	1	637-656	AELRKHMRKHHCASQNLRIR	nucl(13.5),cyto_nucl(8.5),pero(8),mito(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTT6	Uncharacterized protein	Low	9.3	1	67-93	QTVAVVSRNRRKDERKRQSRSSAQVMS	nucl(15),cyto_nucl(10.5),mito(5),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZG2	Eukaryotic translation initiation factor 3 subunit M	Low	7.7	1	435-460	GKGGDKKSTGDRRRHQQHQSQPHEVD	cysk(14),nucl(9),cyto_nucl(7),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZY7	Uncharacterized protein	Low	7.3	1	439-460	EANDILQKRRTRRTKALQADGI	cyto_nucl(11.833),nucl(11),cyto(10.5),cyto_mito(8.666),mito(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3H6	Cleavage and polyadenylation specifity factor, 73 kDa subunit, putative	Low	6.6	1	668-693	SSPASVKQSCKNKHHHHEHKDEPEEK	cyto(13),cyto_nucl(10.5),nucl(6),mito(4),plas(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M819	C6 transcription factor (Mut3), putative	Low	9.9	1	52-91	GESGKHPIPIQKRRRVTRACDECRRKKIKCDGKQPCTHCT	nucl(17.5),cyto_nucl(10),plas(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8Q6	DEAD/DEAH box helicase, putative	Low	9.4	1	25-58	TDPSRTKTPSSSSKRARKPKRNVADNNNTKRKPS	cyto(15),cyto_nucl(11),nucl(5),mito(5)	SKRARKPKRN (37-46, prob:0.859)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAT4	High affinity methionine permease	Low	8	1	442-462	LVLIRRRRKRAGLPQPQYRAW	plas(26)	RRRKR (447-451, prob:0.666)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF62	Ribosome production factor 2 homolog	Low	8.9	1	1-26	MLREVKPKNPRTARLLKKKEPQLIES	nucl(20),mito_nucl(13.833),cyto_nucl(10.833),mito(6.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJJ6	AB hydrolase-1 domain-containing protein	Low	5	1	392-413	MSNVNSTKKPVKRVRWEKVGYG	extr(12),cyto(6),plas(4),mito(3),cyto_nucl(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRP6	Uncharacterized protein	Low	9.7	1	392-411	QQHLLPRKRRRVQEPRERIE	nucl(18),cyto_nucl(14),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTF1	Transcription initiation factor TFIID subunit 8	Low	9.1	1	21-46	IHEPATKRQKRHYHHNHKLHHPVQTQ	nucl(16),cyto_nucl(12.5),cyto(7),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	H9CNN0	Intron-encoded LAGLIDADG endonuclease family protein	Low	9.2	2	38-59, 236-258	FFKNVKQEKKNIYKELRKKSGV, NAARQHFKVRWTKIKKNLDTQEW	mito(9),cyto(8.5),cyto_nucl(8.5),nucl(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LSX3	Uncharacterized protein	Low	8	1	274-299	RGSASDLPARKKRKHDSIRCKRDVIL	plas(21),E.R.(3),vacu(2)	KKR (284-286, prob:0.641)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY96	Hydrogen voltage-gated channel 1	Low	5	1	19-39	QPQTGNKDKHHHRSKTFPLPT	plas(17),mito(5),cyto(1.5),cyto_nucl(1.5),E.R.(1),golg(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M840	KIX_2 domain-containing protein	Low	9.3	1	1108-1131	FSPDKLKIPPTKRRKQSHASVSVP	nucl(17),cyto_nucl(11.833),cyto(4.5),cyto_mito(4.166),mito(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8U0	Zn(2)-C6 fungal-type domain-containing protein	Low	9.4	1	49-90	WRPSLMPCKRCRKARIACTISSMDRPVSKKKTKDRVLAITKP	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(2),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAE6	Sugar transporter, putative	Low	5	1	663-688	LEYAGPKWPVKSRKSRNKEEVCMEVT	plas(25)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC21	Diadenosine tetraphosphate synthetase	Low	8	1	174-197	DEEADAKKKKKKVKDVKPVKLDDA	mito(20),cyto_mito(13),cyto(4)	KKKKKKVKDV (180-189, prob:0.936)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKM4	Pheromone response protein, putative	Low	7.1	1	14-35	SDSSKPDTTIRKRQKGDNFAES	cyto_nucl(10),cyto(9.5),pero(8),nucl(7.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLV7	MFS maltose permease, putative	Low	5	1	1105-1130	KGWFGNSKKKAEQKTLERKRWQAEKM	plas(27)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMF8	Phosphopantothenate-cysteine ligase, putative	Low	8.9	1	310-329	EEPHERWIRVPKSKRSKSIS	nucl(19.5),cyto_nucl(13.833),mito_nucl(10.666),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNJ0	Hydroxymethylglutaryl-CoA lyase	Low	6.3	1	497-518	ATKQDDKKEKWHRTLSSRPING	cyto(10.5),mito(10),cyto_nucl(9),nucl(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTJ3	Uncharacterized protein	Low	8	1	19-45	RNRGGPIRSRILRRARRERVDQQRSAA	plas(14),mito(3),cyto(3),E.R.(3),vacu(3),cyto_mito(3)	PIRSRILRRARR (24-35, prob:0.717)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUD5	Longevity-assurance protein (LAC1), putative	Low	5	1	23-42	SSPSPQPRPFQKKDATLREW	plas(20),E.R.(3),mito(2),vacu(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUF2	tRNA wybutosine-synthesizing protein 4	Low	7.8	1	4-26	IRIYRLSSKRVKHSRDTHSRIST	mito(11.5),mito_nucl(11.5),nucl(10.5),cyto(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M542	ABC multidrug transporter, putative	Low	5	1	252-275	YDAPIKWFRRMQRQRRPGSKTFFT	plas(24),mito(1),E.R.(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6E0	GTPase activating protein (Tsc2), putative	Low	6	1	208-231	AVANLRSKAKKSKQPRTIENEESH	plas(15),nucl(3),vacu(3),mito(2),cyto(2),E.R.(2),cyto_mito(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6J0	Uncharacterized protein	Low	9.8	1	442-466	ASFVIPQRKKELLKKNQARSMRSRM	nucl(15),cyto(8),mito_nucl(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M749	Rhomboid family protein, putative	Low	5.4	1	600-627	WAALYKSKGERERQRKRNEQRGFLERFG	plas(18),mito(5),nucl(1),cyto(1),cyto_nucl(1),E.R.(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAW8	Uncharacterized protein	Low	6.7	1	63-87	SRFPNSSRKHWRTCAIKKIKKDAED	cysk(12),cyto(7.5),nucl(5),cyto_pero(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFM3	Pogo transposable element, putative	Low	9	1	413-441	HDLRAAYEKEKQKRQKSKKQISHDQGITR	nucl(14.5),cyto_nucl(11),cyto(6.5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MI18	L-ornithine N(5)-monooxygenase	Low	5.7	1	25-44	DIVKETPKELWKPRDRPFDS	plas(7),mito(6),extr(5),nucl(2),cyto(2),cyto_nucl(2),pero(2),golg(2),cyto_pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ39	Jerky, putative	Low	9.1	1	22-46	YPSNMLQQRAQRRRKAIPNEWKAAL	nucl(14.5),cyto_nucl(9.5),mito(8),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLX9	Transposable element tc3 transposase, putative	Low	9.6	1	44-63	STIRNTIKKEHQRVNQRSLP	nucl(12),mito(9),cyto(3),pero(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MND9	Complex I intermediate associated protein (Cia30), putative	Low	8	1	328-350	AQEQEKKQRTKAEKKVSGTKGLK	mito(20),cyto(5.5),cyto_nucl(4)	KAEKK (338-342, prob:0.632)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSV5	HTH CENPB-type domain-containing protein	Low	9.1	1	33-53	KRLPTAYKKQKQKTIDPKRHL	nucl(11),cyto(6),mito(5),cyto_pero(5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV86	HTH CENPB-type domain-containing protein	Low	7.3	1	425-452	HDLRAAHEREKQKRQRSKQQISHEHGIT	mito(14),nucl(7.5),cyto_nucl(6.5),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M464	DUF1275 domain protein	Low	5	1	208-229	MIDPKIWKIRNRPRNRRSFFLL	plas(16),E.R.(8),vacu(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M965	Uncharacterized protein	Low	8	1	529-552	VILFLIWRRRKPRRSTRASETQVS	extr(14),plas(10),E.R.(2)	RRKPRR (537-542, prob:0.699)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA45	Calcium permease family membrane transporter	Low	5	1	89-109	SERTRKPSTIRRMSSKPYRGQ	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBV1	Sodium/hydrogen exchanger	Low	8	1	531-550	SPPSRSRSSARKTKKFSSAD	plas(21),E.R.(2),vacu(2)	PPSRSRSSARKTK (532-544, prob:0.685)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDW9	Nonribosomal peptide synthase, putative	Low	5.4	1	21-46	VRNATANTKTRRRMCSRINCDAQKVK	plas(17),E.R.(3),mito(2),extr(2),nucl(1),cyto(1),cyto_nucl(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY72	Smr domain protein	Low	8.9	1	200-226	FASPSTNGKRKGKNKRSKARNSPVFSN	cyto(16.5),cyto_nucl(11.333),cyto_mito(9.666),nucl(4),extr(4)	GKRKGKNKRSKAR (207-219, prob:0.941)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1M1	DUF1308 domain-containing protein	Low	9.7	1	154-173	KEDRQAKPPNKDKKKSAFVD	nucl(18),cyto_nucl(12.5),cyto(5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4Y0	PH domain protein	Low	9.4	1	832-855	VKMSGYLYRKPRRRSTFHRCQVIC	nucl(17.5),cyto_nucl(13.5),cyto(8.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6R8	C2H2 finger domain protein, putative	Low	9.2	1	37-58	AINANHRVTRRKSMSRRGTEST	nucl(14.5),mito(12),cyto_nucl(8)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9U1	Alpha-actinin, sarcomeric (F-actin cross linking protein)	Low	9.8	1	11-30	VQQKTFTKWLNNKLKVRNLA	nucl(13),mito(7),cyto(4),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD41	Beige/BEACH domain protein	Low	7.5	1	1501-1521	QESSRSRLNKRKDKLKQWVQE	plas(13),nucl(7),E.R.(2),vacu(2),mito(1),cyto(1),golg(1),cyto_mito(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHZ5	Alanyl-tRNA synthetase, putative	Low	6.6	1	301-320	LCGRTTVRKITRKQGQSKIS	cyto(10.5),cyto_nucl(9.5),nucl(5.5),pero(5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVD0	Transmembrane glycoprotein, putative	Low	9	2	35-54, 817-838	SDTLANKSPRKKKMEVCLEI, TSPFTRRSSRRYSKREPLKSIQ	plas(13),nucl(5),cyto(4),extr(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWM3	C6 transcription factor RegA	Low	9.3	1	76-101	NTNRDDSSSSRKRRRGPNDQSIPVRT	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(1),plas(1),pero(1),golg(1),cysk(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXP5	Lysine-specific histone demethylase Aof2, putative	Low	6.4	1	957-979	FQKDYWIRAKQRCETNKRQSTND	mito(9),plas(8),nucl(4),cyto(4),cyto_nucl(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZM1	Beta-ketoacyl-[acyl-carrier-protein] synthase I	Low	6.3	1	1519-1540	QEYCRLRQGRHSRAQQQFQNAF	cyto(10.5),cyto_nucl(8),cysk(7),nucl(4.5),pero(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0V3	Protein FYV4, mitochondrial	Low	9.5	1	192-213	GGERRRAEVRAKKRSAERRAAN	mito(12),cyto(11),nucl(4)	RGHKVDGGERRRAEVRAKKRSAERRAA (186-212, prob:0.964)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M372	ABC transporter, putative	Low	7	2	33-52, 1463-1492	VPVRSGSSHQRKRDGRDQKD, KKVLSIRKSKSSSKTKQNSGRTSEKNRSGS	plas(23),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M699	Dolichyldiphosphatase	Low	5	1	212-235	GWQRWEAQRKLKRREHSDATHKSD	plas(24),E.R.(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M831	L-serine dehydratase, putative	Low	5	1	1-23	MEPIPPNKSQRRRPWIKTPLIES	mito(20.5),cyto_mito(13.5),cyto(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9C1	WSC domain protein, putative	Low	5	1	195-216	AVFFLRRRQKQRVEEEYRRNAE	extr(19),plas(4),E.R.(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA51	FGGY-family carbohydrate kinase, putative	Low	6.2	1	1-21	MSSLPYRRQPSRQTSRQASTD	mito(8),cyto(5),pero(4),nucl(3),plas(3),golg(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIW6	Uncharacterized protein	Low	9.4	1	209-230	HFSVDYKEMKKRKNNSESVSRL	nucl(17.5),cyto_nucl(13),cyto(5.5),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKG1	Fungal_trans domain-containing protein	Low	9.6	1	25-68	QTNGRCERCKRLDKHCIMQDRSTPRPSKPSKSRRNDQARQIAQL	nucl(16.5),cyto_nucl(11.5),cyto(5.5),cysk(2)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRY6	Fungal_trans domain-containing protein	Low	5.4	1	131-154	EVQKYWSIKPRRKTCFMRHLWRDM	plas(19),mito(5),nucl(1),cyto(1),cyto_nucl(1),golg(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTW4	Uncharacterized protein	Low	9.6	2	357-386, 435-458	KEASKARKLEEQQKKKTQQRDERRHQRSVS, KFLTWGKTRYYKAKRKVSMPVPTF	mito(13),nucl(8.5),cyto_nucl(7),cyto(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU39	Uncharacterized protein	Low	8.6	1	186-205	NTVASNRQRNNHRIRRSRAV	nucl(15),cyto_nucl(12.333),cyto(5.5),cyto_pero(4.332),mito(4)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW63	DNA polymerase	Low	8.5	1	94-117	VSLQSEQPKCKKRRAPSAHVVPES	nucl(13),cyto_nucl(10.5),pero(8),cyto(6)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZU4	Uncharacterized protein	Low	7.6	1	119-138	VYVYKQDKKGRLVKCKRDSW	nucl(11.5),cyto_nucl(10.333),mito_nucl(8.166),cyto(7),mito(3.5),pero(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0J7	Cytochrome P450, putative	Low	7.5	2	54-74, 523-546	VFVTSKLRSRNRPPLPPGPKG, VPPAPFKVKFMPRRKTVREVVTKE	cyto(9.5),cyto_nucl(6),E.R.(5),plas(4),mito(3),extr(2),nucl(1.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1M8	Mitochondrial DNA polymerase catalytic subunit	Low	8	1	283-307	MCSQQRPTWMRHKKNRDLRDKVAND	mito(23),cyto_mito(13.333),mito_nucl(12.833)	VKGRKKGDPPRPAARQKKPGMP (481-502, prob:0.96)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M834	MAGE domain-containing protein	Low	7.2	1	20-41	SDDEQRPSQRRRQSPENPSGAS	plas(15),nucl(6.5),cyto_nucl(5),cyto(2.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG39	Glycosyl hydrolase, putative	Low	5	1	342-369	EQSTQRILRLRKNSKEKGHINKNAKGPS	extr(23),cyto(3)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MI45	HTH CENPB-type domain-containing protein	Low	8.9	2	354-374, 411-430	ANDILQKRRTRRTKALQADGI, PRCSNCWEIGHKRNRCPNIS	cyto_nucl(12.333),cyto(11.5),cyto_mito(9.332),nucl(9),mito(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT35	DUF221 domain protein, putative	Low	9.1	1	270-289	NLIVKCKKAQMKKARAEARK	plas(15),nucl(3),E.R.(3),vacu(3),mito(1),pero(1),golg(1)	KAQMKKARAEARKAGKKATKED (277-298, prob:0.961)
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVU0	Chromatin modification-related protein	Low	9.3	1	577-597	TTTVSTTKRNTHKKSNSTVSA	nucl(15.5),cyto_nucl(10),mito(7),cyto(3.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB77	Vitamin H transporter, putative	Low	5	1	486-507	MDVVRIARLKRQARKEGRVFAD	plas(26)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHZ2	C6 transcription factor, putative	Low	7.8	1	12-37	RSRFGCFVCRARHKKCDERHPLCSAC	mito(16),nucl(8.5),cyto_nucl(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MML8	Elongation factor 2 kinase, putative	Low	6.3	1	238-257	CNEFCRPHWIRPNAPKQHFS	mito(15.5),mito_nucl(10.5),cyto(5),nucl(4.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNI1	MAP kinase kinase Ste7	Low	7.7	1	1-23	MADQFKPRTMKRKNVKGLALNAT	mito(17),nucl(8.5),cyto_nucl(5.5)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP23	Uncharacterized protein	Low	7.6	1	450-471	RDIATRKNQKTTKRQVKASGAL	cyto(15),nucl(7),pero(2),mito(1),extr(1),vacu(1)	
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQN2	Uncharacterized protein	Low	7.7	1	172-194	VLEWGRDARKRKQRQQPAVLEAE	cyto_nucl(11.5),cyto(11),nucl(10),mito(2),pero(2)