ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6E0	Uncharacterized protein	Medium	14.1	1	339-362	HHYHTPKREEVRKPKKKRTSLTSS	nucl(23),cyto_nucl(14.5)	KREEVRKPKKKR (345-356, prob:0.875)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E8Y0	Uncharacterized protein	Medium	14.5	3	3-22, 242-261, 332-354	PSPTRERKEIKIRTPDNPED, HWNYRSQKPAKKLKLNTLNE, ITNTPTSKRSLRKTVRKAKHTFY	nucl(15.5),cyto_nucl(9.5),pero(4),mito(3),cyto(2.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EH95	Serine/threonine-protein kinase	Medium	10.6	1	69-94	IVKSHMSQKKMEQKKRKYLTEPEVRF	nucl(15),cyto(7),mito(2),plas(1),pero(1),cysk(1)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENY4	BAR domain-containing protein	Medium	14.4	1	407-435	ANARRAPPPPPSRTKKPAPPPPVKRAEIS	nucl(23.5),cyto_nucl(13)	ARRAPPPPPSRTKKPAPPPPVKR (409-431, prob:0.922)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQZ2	Uncharacterized protein	Medium	10.7	2	311-354, 384-404	LRIPTRQQRVQERERRKTLDQIQERIRVRQERERQNQERERQNL, QFQSVRPIKSKRSLRQLLKLR	nucl(12.5),mito(11),cyto_nucl(8),cyto(2.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWX0	C2H2-type domain-containing protein	Medium	14.5	1	172-199	IEDEKEREERRKKRRELAERKKEEKDKE	nucl(26.5),cyto_nucl(14)	EKEREERRKKRRELAERKKEEKDKE (175-199, prob:0.992)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F026	BZIP domain-containing protein	Medium	13.4	1	181-200	SARFRVKKKQREQALEQSAK	nucl(22),cyto_nucl(15),cyto(4)	RRRNTAASARFRVKKK (174-189, prob:0.738)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F517	Uncharacterized protein	Medium	12.9	2	51-73, 1284-1308	LHHLLQPRRKTKQYVPAERKMVS, SRNLGTMKKAKEEKRKQAQADPSDD	nucl(16),mito(8),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6F6	Methionine aminopeptidase 2	Medium	13.1	1	57-86	GDDDDERPRKRKKPKKKKKSAELGQSTPPR	nucl(18.5),cyto_nucl(12.5),mito(5)	RPRKRKKPKKKKKS (63-76, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9L3	Uncharacterized protein	Medium	13.2	1	30-54	SSLFQAKRFRKHRHPVKKQELLAHQ	nucl(13),mito(10),cyto(2)	RKHR (39-42, prob:0.636)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5Q0	Uncharacterized protein	Medium	12	1	40-67	LTISAIRRKVKLKRKHKYRQLGNGSIDH	plas(22),E.R.(2),vacu(2)	RRKVKLKRKHK (46-56, prob:0.886),GAKKGPKNAEKPSWWRRVLGKKR (429-451, prob:0.832),KPKGKKSKEKK (994-1004, prob:0.91)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5Y8	CCHC-type domain-containing protein	Medium	13.1	1	158-177	SSSRCCSKCGKPGHNSRTCQ	nucl(20.5),cyto_nucl(14.5),cyto(5.5)	R (112-112, prob:0.602)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EA36	BAH domain-containing protein	Medium	12.1	1	234-259	MPGKHPRYSKESKKRLKREEEKAVSQ	nucl(15),cyto_nucl(13),cyto(9)	KHPRYSKESKKRLKRE (237-252, prob:0.855)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EE85	Uncharacterized protein	Medium	11.4	1	184-219	DEIVRLKKEKNKLTKARTKAQRKAFKQKIKLQATRS	nucl(12),mito(11.5),cyto_mito(8),cyto(3.5)	LKKEKNKLTKARTKAQRKAFKQKIKLQATRSRKNAEAAKEKLRIKSER (189-236, prob:0.989)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EI93	Pre-rRNA-processing protein ipi1	Medium	12.6	1	1-29	MGSSARKKKEKKKDFQKTKLRVGKTKAKA	nucl(12),cyto(5),mito(4),plas(3),pero(2)	ARKKKEKKKDFQKTKLRVGKTKAK (5-28, prob:0.978)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKL6	Uncharacterized protein	Medium	13.9	2	352-373, 377-397	TNCNGRSYSFRPKRANFKREAE, EENLSSPQKRARARKEKAKAE	nucl(15.5),cyto_nucl(13.5),cyto(10.5)	KRARARKEKAKAE (385-397, prob:0.902)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPH6	Septin-type G domain-containing protein	Medium	12	1	257-280	TTPGRVTEKRRHSKHKARHGDGNM	nucl(10),cyto(9),plas(4),mito(2)	KRRHSKHKA (265-273, prob:0.698)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQR8	Uncharacterized protein	Medium	10.4	1	65-86	IYDALKRKYNKQSKGNYRRHVH	nucl(14),mito(12)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3Y5	Uncharacterized protein	Medium	10	1	82-105	LQTALFMRNRRRERDKNKGIFVLE	nucl(20.5),cyto_nucl(12.833),cyto(4),cyto_pero(3.333)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4U1	Uncharacterized protein	Medium	12.2	1	71-93	EEGRGEGKKKRKNTNIKTSIERK	nucl(13.5),mito(10),cyto_nucl(9)	SKVKRNGEEGRGEGKKKRKNT (64-84, prob:0.964)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F718	RING-type domain-containing protein	Medium	13.5	1	7-28	EHNIKPASQSTRPRRRPSMSSF	nucl(22.5),cyto_nucl(14),cyto(4.5)	RERMR (192-196, prob:0.612)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4J0	Ribosomal lysine N-methyltransferase 4	Medium	12.5	1	450-469	KKNAKRKGEETEQPKKKGRA	nucl(18),cyto_nucl(14),cyto(8)	KKNAKRKGEETEQPKKKGRAR (450-470, prob:0.966)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5N0	Uncharacterized protein	Medium	12.3	1	34-62	GAPAERKVKKIIRRKKRPARPQVDPSTIK	nucl(16),cyto_nucl(13),cyto(8)	ERKVKKIIRRKKRPAR (38-53, prob:0.984)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9I8	Uncharacterized protein	Medium	13.8	1	47-82	GEKDPKKRPVKDEVHQRREKHRPKRQETMREKVQHT	nucl(21.5),cyto_nucl(11.5),mito(4)	KDPKKRPVKDEVHQRREKHRPKR (49-71, prob:0.92)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAA4	Uncharacterized protein	Medium	10.7	1	103-132	TKELCAEILPKRKKRKKKVKETRRLKMSFI	cyto(15.5),cyto_nucl(13.5),nucl(10.5)	PKRKKRKKKVKETRRLK (112-128, prob:0.996)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECD5	Uncharacterized protein	Medium	13.5	2	325-352, 377-398	SSKVSSSTLKKHKCKICEKRFTRPSSLQ, VVSNLRRHKKVHKGDARSEAGS	nucl(26.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDD2	Uncharacterized protein	Medium	11.6	1	78-119	REFWREKKLQNAKKAREHRRKDSWSLRPRISKRRDLQDTPRH	mito(12),nucl(9),cyto(4)	REKKLQNAKKAREHRRKDSWSLRPRISKRR (82-111, prob:0.963)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENV4	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.1	1	3-50	GPGGGPPRRSHTKSRKGCETCKRRHIRCDENFPQCRNCTKHNCRCPYM	nucl(21),mito(3),plas(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQ30	C3H1-type domain-containing protein	Medium	13.4	1	94-114	ARVNYNKWKRIIKREPVVNDT	nucl(20),cyto_nucl(13),cyto(4)	SSRGGSSRGNSRGGRGKG (23-40, prob:0.725)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQ46	Uncharacterized protein	Medium	10.5	1	547-572	QQSLRGHASQRQRRNSPNPNIPRAHC	nucl(22),cyto_nucl(14),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F038	Uncharacterized protein	Medium	12.9	1	23-43	QEYIRWRKNLRRKSYKDDYAS	nucl(17.5),cyto_nucl(9.5),mito(9)	KNQKKRLKKKS (47-57, prob:0.915)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7FA15	BHLH domain-containing protein	Medium	14.1	1	329-352	LQSQEMKRRRRRESHNLVERRRRD	nucl(24),cyto_nucl(15.333)	KRRRRRES (335-342, prob:0.769)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E960	Methyltransf_11 domain-containing protein	Medium	10	2	9-30, 562-582	ATTYRPPTSPVQAQRRRRLLNT, STYHRAFKRSIRKTHRRDVFV	mito(13),nucl(9.5),cyto_nucl(6.5),cyto(2.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECY9	Uncharacterized protein	Medium	10.5	1	965-985	TEPALSKRPKKIQSHCNFFRT	nucl(22.5),cyto_nucl(14),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKB3	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.3	1	46-65	AERRRQPGVKRACNECRQQK	nucl(17),mito(4),cyto(3),plas(1),pero(1),golg(1)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVG1	Uncharacterized protein	Medium	10.5	1	1-20	MKKKRKKAEKKGVDRKIVIE	cyto_nucl(12),nucl(9.5),mito(9),cyto(7.5)	KKKRKKAEKKGV (2-13, prob:0.96)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EX28	SAP domain-containing protein	Medium	10.8	1	329-348	AEAQRKRKLEEEKKANAKAE	cyto(12.5),cyto_nucl(12),nucl(10.5),pero(3)	RKRKLEEEKKANAKAEAEGKAKKPK (333-357, prob:0.931)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EY61	C2H2-type domain-containing protein	Medium	13.8	1	379-398	NCPHPNCKRHTGKGFSRQEN	nucl(22),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZQ2	Uncharacterized protein	Medium	11.2	1	12-33	ADERKARLAKLKSLKRKQPADE	nucl(12),cyto_nucl(12),cyto(8),mito(5)	KARLAKLKSLKRK (16-28, prob:0.7)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5Y2	Endo/exonuclease/phosphatase domain-containing protein	Medium	12.8	1	242-261	HWNYRSQKPAKKLKLNTLNE	nucl(21),cyto(2),mito(1),plas(1),pero(1),cysk(1)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9D2	Uncharacterized protein	Medium	12.4	1	419-447	SSPSGPKISEKKKGKKKKRKGNDNGQTDT	nucl(16.5),cyto_nucl(11.5),mito(6),cyto(3.5)	PKISEKKKGKKKKRKG (424-439, prob:0.996)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJG2	Uncharacterized protein	Medium	10.8	1	292-327	NEKERVKSGKGRCKWSKFYTRRKRHRMGKGLALRFM	cyto(9.5),nucl(8),mito(6),cyto_pero(5.5)	KSGKGRCKWSKFYTRRKRHRMGK (298-320, prob:0.844)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMP8	Uncharacterized protein	Medium	13.2	1	302-325	DDATVKPQKRKGNKKMKPGKNGLY	nucl(20.5),cyto_nucl(13.5),cyto(5.5)	PQKRKGNKKMKPGK (308-321, prob:0.91)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPC8	Uncharacterized protein	Medium	14.2	2	595-614, 880-906	ISTPRRKRYKPTQLDKIKES, LLISCPIYKTKRKEIFKKIPLSKNTIQ	nucl(18),cyto(5),mito(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F089	Uncharacterized protein	Medium	11	1	81-109	GMGALKKRDKKQAKEKLKAKKRKMGTTTV	cyto(10.5),nucl(10),cyto_mito(8),mito(4.5)	LKKRDKKQAKEKLKAKKRKMG (85-105, prob:0.993)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0F7	Uncharacterized protein	Medium	11.6	1	51-73	SQDGGKKTSKKVRVQSPPPSSPS	mito(13),nucl(12),cyto_nucl(8)	KKPPPP (246-251, prob:0.639)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5Z6	MFS domain-containing protein	Medium	10	2	319-348, 765-785	PETFWDRTPRPKRSRSRSRSRKNSNMSQII, YIWGKRARMWTVKKNWIERFG	plas(27)	PRPKRSRSRSRSRK (327-340, prob:0.873)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F770	Uncharacterized protein	Medium	10.7	1	63-89	NPSKTSTRPKGKARKTAKKVKVSTRQV	mito(14),nucl(9),cyto_nucl(7),cyto(3)	STRPKGKARKTAKKVK (68-83, prob:0.935)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F842	Uncharacterized protein	Medium	14.8	1	75-114	DVNVRKFVRKHVRNDYLSKRTRESKRRPKVRSTTIKHVVD	nucl(17),cyto(4),plas(4)	KRTRESKRRPKV (93-104, prob:0.824)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8E5	Uncharacterized protein	Medium	10	1	1031-1050	AEDSPKNSPKEKKKGKAFGL	plas(13),mito(7),nucl(5)	GKSKKDKDKDNGRKEGSGSGAEDSPKNSPKEKKKGK (1011-1046, prob:0.931)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4P4	Uncharacterized protein	Medium	12.9	1	309-333	ENLGLGKRRKRYQHRHKSKGSNAGS	nucl(18.5),cyto_nucl(11.5),cyto(3.5),mito(2),pero(2)	GKRRKRYQHRHKSKG (314-328, prob:0.89)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6S9	Uncharacterized protein	Medium	14.1	2	222-246, 607-626	DFHSGVKAPKRKRKEFNRREKLKVH, IQICKWKMEKLKGERLKDEK	nucl(16.5),cyto_nucl(14.5),cyto(9.5)	KAPKRKRKEFNRREKLK (228-244, prob:0.951)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9C5	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.3	1	56-80	GFGLAEPPKKRQKRNKPTLSCVECV	mito(8),nucl(6),cyto(6),cyto_nucl(6)	KKRQKR (64-69, prob:0.708)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EER5	Mannose-1-phosphate guanylyltransferase	Medium	11.5	1	300-341	SAQSDLKKRKRNFSNRTKTGCMTCRRRKKKCDESRPECNNCL	nucl(26.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EH28	Uncharacterized protein	Medium	12.3	2	438-459, 512-539	GQDGWGKYTRRRKWYRDAELVE, SSRSGRYSSKKSSLKKERLERGSRKSSM	plas(18),nucl(6),cyto(2)	KKSSLKKERLER (521-532, prob:0.684)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHL2	Diacylglycerol O-acyltransferase	Medium	10.4	1	110-135	LDDTPKSPPRHRHRKSSSQKSNGTNE	nucl(14),cyto(12)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EI72	Uncharacterized protein	Medium	13.3	1	133-157	PVHNHIITKRRCRKRQSKDGANSSA	nucl(22),cyto_nucl(14.5),cyto(5)	KSKPSSSKR (167-175, prob:0.639)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXR6	Zn(2)-C6 fungal-type domain-containing protein	Medium	12	1	10-45	LADEEHRKKRVRKGTKSCWECKRRKVKCQLSSENVS	nucl(20),mito_nucl(13.333),cyto_nucl(11.333),mito(5.5)	RKKRVRK (16-22, prob:0.735)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4B1	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	Medium	10	1	495-514	ISKDEKRKGKGKKGEIESSA	mito(25.5),cyto_mito(13.5)	EKK (468-470, prob:0.617),EKRKGKGKK (499-507, prob:0.857)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4V1	Uncharacterized protein	Medium	11	1	107-127	ERAEIARKARLKKEKCKRRRS	mito(14.5),mito_nucl(14),nucl(12.5)	ARKARLKKEKCKRRRS (112-127, prob:0.958)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7E5	Uncharacterized protein	Medium	13.5	1	430-457	NSPPPSPSPSPRRRTRPQPSPRRGSDTG	nucl(19.5),cyto_nucl(12),mito(4)	SPRRRTRPQPSPR (439-451, prob:0.727)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7V8	C2H2-type domain-containing protein	Medium	11.1	1	631-651	YPTNRRPSSYKSPYRSRTHST	nucl(23),cyto_nucl(14.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPV3	Uncharacterized protein	Medium	10.9	1	2-25	SRDCSQKKPFAAKGKKQVRFGNRR	nucl(11),cyto_nucl(10.5),mito(10),cyto(6)	KGKKQ (14-18, prob:0.661)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6U7	DNA replication licensing factor MCM2	Medium	10.9	1	2-28	SSANRGVDSSRNRRKRSREPEDEDLPG	nucl(22.5),cyto_nucl(13),cyto(2.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E853	Uncharacterized protein	Medium	10	1	214-238	VWKWTNTKRLFLKEKTKRHKDGSSF	nucl(13),cyto(9),pero(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECY6	Uncharacterized protein	Medium	14.2	1	359-385	DTSTQYQKSAERRRRERRLNSDNPDEA	nucl(24),cyto_nucl(14.5)	PHRSGDGHRERDREDKDRGKSRRS (126-149, prob:0.817)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEI4	Uncharacterized protein	Medium	13.8	3	14-39, 72-95, 192-212	FHGNRDRGKYHKNEGRPRENRQQYGD, GHRARDCRSKKSSGRDYHKKFGKG, TGWFPQRKAGRPCKKGRSEEI	nucl(14.5),cyto_nucl(13),cyto(10.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EF72	Uncharacterized protein	Medium	13.3	1	151-173	QQRLDKKKQAEIARRNRERFQNP	nucl(19.5),cyto_nucl(12.5),cyto(4.5)	KQKKKKEEDTSKK (85-97, prob:0.757)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EL17	Uncharacterized protein	Medium	12.5	2	88-107, 143-167	RDEKGNPRPNRARDKLLRLS, PPYLLPKNTFHPKRNQARQKLSTLP	nucl(22.5),cyto_nucl(14),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F087	Uncharacterized protein	Medium	12.9	1	2-58	ADDSYRPQRERSRSPRRQRSRSPGRTQRRRSYSPRSRSRSRDEHRRNDRRSRSPMSG	nucl(18.5),cyto_nucl(13),cyto(6.5)	RERSRSPRRQRSRSPGRTQRRRSYSPRSRSRSRDEHRRNDRRSR (10-53, prob:0.988)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1S7	MYND-type zinc finger protein samB	Medium	11.2	1	591-622	KWEEYTRQFAKCRRCRRTKYCSKECQKSAWVF	nucl(16),mito(6),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9J1	CCHC-type domain-containing protein	Medium	11.4	1	454-475	EGQIVNRRRRRRTALEYWNEDD	nucl(23.5),cyto_nucl(13)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EA54	Uncharacterized protein	Medium	13.6	1	5-34	GFWRSEENPSKPKKKHHQRPPPKIISIRSK	nucl(20.5),cyto_nucl(12),mito(4)	SKPKKKHHQRPPPKI (14-28, prob:0.91)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EI66	Uncharacterized protein	Medium	10.5	1	107-130	EVDEKMDRRRKIRREAREKAEREE	cyto_nucl(9.166),nucl(9),cyto(9),cyto_mito(9)	RRRKIRREAREKA (114-126, prob:0.862)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ER42	Uncharacterized protein	Medium	11	1	583-610	VWKQRKGIVEAKDKKKRNGSGRGSDKSM	mito(13),nucl(9.5),cyto_nucl(6.5),cyto(2.5)	EAKDKKKRNGS (592-602, prob:0.822)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ER70	Uncharacterized protein	Medium	12	1	167-187	QVSPRRVPSKERKSNVKPPPL	nucl(14.5),cyto_nucl(12.5),cyto(7.5),mito(2)	KKPPRPPPFSSKPTSIKHTQVSPRRVPSKERKSNV (148-182, prob:0.754)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2S3	ATP-dependent rRNA helicase spb4	Medium	13.2	1	544-588	EEQIARKKQREAWSQKHEKQDLKELKREKKKRKREIERLDKMTDE	nucl(18.5),mito_nucl(10),cyto(7)	RKKQREAWSQKHEKQDLKELKREKKKRKRE (549-578, prob:0.991)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9X6	Uncharacterized protein	Medium	11.9	1	385-411	KEKYSELKRDKSKFKRRENEIVRHKRE	nucl(11),extr(6),cyto_nucl(6),mito(5)	RRTKEKYSELKRDKSKFKRRENEIVRHK (382-409, prob:0.89)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4G3	Fcf2 domain-containing protein	Medium	14.3	1	199-219	AAKASGKKEHYKKMKALRKRR	nucl(23.5),cyto_nucl(14)	KASGKKEHYKKMKALRKRR (201-219, prob:0.976)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECE4	Fanconi-associated nuclease	Medium	13.7	2	554-574, 800-828	DLQKRIRKLEKNLKIPKREKH, KTKNNSNKINTKPQTKQRKKEVRFVEVKS	nucl(14.5),cyto_nucl(12),cyto(8.5),pero(4)	IRKLEKNLKIPKR (559-571, prob:0.683)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHN1	Non-specific serine/threonine protein kinase	Medium	10.9	2	145-164, 662-687	SVWARDRKTGKQKWRMELPE, GDVASPAKKKPRKRGQRGGVKHRKAG	extr(9),cyto(5.5),cyto_nucl(4.5),plas(4),golg(3),nucl(2.5)	AKKKPRKRGQRGGVKHRKAGK (668-688, prob:0.996)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKI8	Uncharacterized protein	Medium	10.8	1	416-438	APQWADKYRPRKPRYFNRVQMGY	nucl(20.5),cyto_nucl(12),mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMI2	Uncharacterized protein	Medium	13.5	2	252-274, 414-433	RGEEGKKKLKHNDRQRLAKRPIF, ATEAKAKKKAKAERDPGLQT	cyto(12.5),cyto_nucl(9.5),mito(8),nucl(5.5)	GKKKLKHNDRQRLAKR (256-271, prob:0.761),EAKAKKKAKA (416-425, prob:0.849)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPU6	HABP4_PAI-RBP1 domain-containing protein	Medium	14	1	228-247	AGTGGKTKRERQRAQKQVVE	nucl(14.5),cyto_nucl(12),cyto(6.5),mito(3)	HPRAGGRGRGGARGGAK (97-113, prob:0.832),RGGRGGFRGGRGRGDGQPRGDRGGFRGRGEGQRGRARGDRGPPRQS (258-303, prob:0.974)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ER57	Uncharacterized protein	Medium	14.1	1	378-401	ASGTENKAEKKKRRKANSSSEFAV	nucl(23.5),cyto_nucl(15)	KAEKKKRRK (384-392, prob:0.884)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETI5	XPGI domain-containing protein	Medium	10.7	1	165-186	TLLIRFCYVDKRKVKKSRRNEN	cyto(11.5),nucl(9),cyto_mito(6.5),pero(6)	RKVKKSRR (176-183, prob:0.724)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVI2	Uncharacterized protein	Medium	13.2	1	1-32	MTSRRKKANSQPKPPRNRKKGPPDIRPSKASK	nucl(14),cyto(8),mito(5)	RRKKANSQPKPPRNRKKGPPDIRPSKA (4-30, prob:0.985)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6B5	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.3	1	144-165	CEICRSRKSRCDGTKPKCKLCT	nucl(19),cyto(3),pero(2),cyto_mito(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6Z0	Uncharacterized protein	Medium	13.5	2	153-178, 191-210	HPDDHSKQEKKKKGRRFSSLNREKPT, QAKEQKEKAKEQERARKRNS	nucl(13),cyto_nucl(10.5),mito(10),cyto(4)	QEKKKKGRRFSSLNREKPTQSRQERESAKRQQAKEQKEKAKEQERARKRN (160-209, prob:0.972)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9M8	Uncharacterized protein	Medium	14.1	1	42-69	GTTGSTPKKTRAPRNPSKKTPKKTALSS	nucl(11),cyto(8),mito_nucl(8)	KKTRAPRNPSKKTPKK (49-64, prob:0.846),SPVKKESMNKVKGGRVEKKNGTP (89-111, prob:0.789)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECF0	Uncharacterized protein	Medium	11	1	67-91	SAEQNGGRYRKRRHKVIIHTSPFLR	nucl(15),mito(4),cyto(3),extr(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPG3	Cytochrome b561 domain-containing protein	Medium	12.8	2	266-292, 883-911	LLGNRDRKRSKSRTRTRTRSSSSHRSS, SPDSGTDHARERRQRRRMERQRRSIGAGT	plas(23),nucl(2)	RDRKRSKSRTRTRTRSSSSHRSSSSRSRSHS (270-300, prob:0.902),ERRQRRRMERQRR (893-905, prob:0.777)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUU5	Uncharacterized protein	Medium	10.4	1	124-143	AEFKRLHRAKDTFQRRWKKF	nucl(14),cyto(7),pero(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZK9	Uncharacterized protein	Medium	14.9	1	931-961	AGEEKTRKMDHQRKMLRKKMQQYRVPLQQLK	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	KKKKGADRKGGAANERRRR (138-156, prob:0.942),KKKSK (1077-1081, prob:0.656)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2N2	F-box domain-containing protein	Medium	12.4	1	644-673	CLWVRVRSEGKSKSKKSKSKCVGVLSSKRL	nucl(17.5),cyto_nucl(12.333),cyto(6),cyto_mito(4.333)	KSKSKKSK (654-661, prob:0.725)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E664	Nucleolar protein 16	Medium	12.3	1	1-32	MGRELQKKKNRSGNAKIKLKPKSKRVNPLGNA	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(5)	KKKNRSGNAKIKLKPKSKR (7-25, prob:0.951)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAG5	Amidase	Medium	10.2	1	1060-1090	MEMNETGKMKKKRKRKSKKSNDTKSQPVEVR	plas(17),nucl(6),cyto(2),golg(2)	GKMKKKRKRKSKKS (1066-1079, prob:0.994)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBH1	Uncharacterized protein	Medium	13	1	718-739	EDRNNSKRHTNKLNPRNSKDFT	nucl(20),cyto(3),mito(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBI3	Uncharacterized protein	Medium	10.8	1	78-102	LKETGFPRRSERTRQKGRRQERGKR	nucl(9.5),cyto_nucl(9),cyto(7.5),mito(4),extr(2),pero(2)	RRSERTRQKGRRQERGKR (85-102, prob:0.957)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGC5	Uncharacterized protein	Medium	10.1	1	224-243	EEKAEPTKTHRRRWTSLIRR	nucl(19),cyto_nucl(13),cyto(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHT0	Uncharacterized protein	Medium	14.4	1	203-228	LLFEKGFRRRNLKDKRHKIPKFILYL	nucl(16),cyto(9)	RRRNLKDKRHKI (210-221, prob:0.771)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EI41	WD_REPEATS_REGION domain-containing protein	Medium	10.7	1	359-382	TLEEYDKKNKKRKHTSGVEKRLRG	mito(10),nucl(7),cyto(6),plas(3)	KKNKKRKHT (365-373, prob:0.791)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EI47	Ras-GAP domain-containing protein	Medium	11.7	1	601-623	KTGPTSSSKEKEKKEKQNFWEAT	cyto(11),nucl(10),mito(2),pero(2),cysk(2)	RRKGK (679-683, prob:0.649)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETG7	DNA-directed RNA polymerase	Medium	11.8	1	1224-1247	AHRKIFQYRKSLKPSKRGKIHELL	mito(12),nucl(11),cyto(2),pero(2),cyto_pero(2)	KPSKR (1236-1240, prob:0.643)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F148	Uncharacterized protein	Medium	11.3	1	150-170	GEVRIRPLPRNSKKKKAYFTI	plas(13),nucl(9),vacu(2),cyto(1),E.R.(1),golg(1)	NSKKK (160-164, prob:0.649)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F467	Uncharacterized protein	Medium	13.2	2	252-275, 459-483	LEWLKHFDKHTKNRRKGKYRMLVL, LRTANEALSKRRRAKKTQLRQGGVL	nucl(12),cyto_nucl(12),cyto(10),mito(3)	KRRRAK (468-473, prob:0.682)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4G3	Uncharacterized protein	Medium	10.5	1	36-58	LIGSRSPKQCRERYHQNLKPTLN	nucl(20.5),cyto_nucl(11.5),mito(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6D5	Exosome complex protein	Medium	13.6	1	210-243	SSSTSNSKSKKSKRGAQEKKSKSKLKKVKSKSKN	nucl(20.5),mito_nucl(11),cyto(5)	KSKKSKRGAQEKKSKSKLKKVKSKSKN (217-243, prob:0.997)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7X7	RING-type domain-containing protein	Medium	11	1	277-297	RNDGKEKAKKGDKEKIKPGLV	mito(17),nucl(9.5),cyto_nucl(5.5)	KEKAKKGDKEKIK (281-293, prob:0.784)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7J7	SPX domain-containing protein	Medium	11.9	1	739-760	GMYLYRSNSIRQRKNIKYYDAW	plas(13),nucl(5.5),cyto_nucl(4.5),pero(3),cyto(2.5)	RKEGKK (343-348, prob:0.647),AKKFKAPPGKK (662-672, prob:0.743)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDT2	Uncharacterized protein	Medium	13.4	1	370-395	ITSRADSQRQNKKRKREAKPSAGPTA	nucl(21.5),cyto_nucl(13.5),cyto(4.5)	NKKRKREAKP (380-389, prob:0.836)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EH15	Uncharacterized protein	Medium	11	1	295-316	RLFSRWERCHGWKKPKVQFVYA	nucl(15),cyto(6),mito(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMC5	HET domain-containing protein	Medium	14.5	1	242-268	QKDYPGGMRKRLQRRNRRGTGNGKSGK	nucl(17),mito(7),cyto(2)	GGMRKRLQRRNRRGTGNGK (247-265, prob:0.868)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EN61	Uncharacterized protein	Medium	14.4	1	1-23	MFISHDRKKKNKGRKDAFAKELL	nucl(24.5),cyto_nucl(13.5)	RKKKNKGRK (7-15, prob:0.847)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETZ1	Uncharacterized protein	Medium	11.4	1	1-25	MSSPPNPRARKQPRRGRHSSQLASS	mito(19.5),cyto_mito(11.5),nucl(5)	RARKQPRRGR (8-17, prob:0.754),RGGGGGGGGGGEGRSVGSGGRGGGGGRSIGSGGRGGGEGRSIGSGGRGGARGGHEERSVGIGGRGGGEGRSAGGGERGGARGGARGGGEGRNAGSGGRGGARGGRG (556-661, prob:0.976)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUS8	Uncharacterized protein	Medium	14.5	1	264-294	SKLLCSYLRHHKRKRSTKPRKVHFNKRDDAY	nucl(25.5),cyto_nucl(14)	HHKRKRSTKPRKV (273-285, prob:0.912)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWT1	Uncharacterized protein	Medium	14.3	1	39-69	RSETNSQSPERRTKRKREVDNMRPRRNRAAA	nucl(25),cyto_nucl(14.5)	RRTKRKREVDNMRPRRNR (49-66, prob:0.845)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9H5	NUP214 domain-containing protein	Medium	13.2	1	1482-1501	SEVARRKREARDKLRMAVNR	nucl(21),cyto_nucl(14),cyto(5)	KR (1488-1489, prob:0.612)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E641	Uncharacterized protein	Medium	12.3	1	24-49	SPTKTFSKSPAPKSAKKNVPKSPSTP	cyto(11),cyto_nucl(10.5),nucl(8),mito(2),E.R.(2),vacu(2)	KSPAPKSAKK (31-40, prob:0.682),RKKATKAGKGVKSKATTTGKAAKKTTESKAGNAKDKTKSKAGDVKKT (142-188, prob:0.943)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9U5	Uncharacterized protein	Medium	11.5	1	771-794	AQGSVRSKKHKVPQKPQLIKPLGN	nucl(25.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIW6	Uncharacterized protein	Medium	11	1	36-66	QAIQAKLPSQPRKYKNRRRNPNRGGKKEENV	mito(11),nucl(8),cyto(4),golg(2),cyto_pero(2)	PRKYKNRRRNPNRGGKK (46-62, prob:0.921)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQ56	Uncharacterized protein	Medium	11.5	1	147-169	GNDASSGKRRRHRQLRQSSDDSD	nucl(26.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERT7	Uncharacterized protein	Medium	13.5	1	678-715	EEEKRLKEEKRLRKEERLKKKERLKREKRLKEEERLKE	nucl(20.5),cyto_nucl(11),mito(6)	KRLKEEKRLRKEERLKKKERLKREKRLKEEERLKEEERLKEEERLKEEERLKEEERLKKEEERLKEEERLKEEERLKREEKRLKEERLKKEEERLKEEERLKKEEERLKKEEEKLKEEERLKKEEKRLKEEEKRLKEEERLKKEERLKKEEERLKKEEKRLKEEEKRLKEEERLKKEERLKKEEERLKKEEERLKEEERLKEEERLKKEEERLKEEKRLKEERLKEERLKKEEERLKKEEERLKKEEERLKKEEERLKE (681-939, prob:0.999)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVX8	DDE-1 domain-containing protein	Medium	12.4	1	342-363	RILRRANEALSKRRRAKKNSTT	nucl(12),mito(7),cyto(5),plas(1),pero(1),golg(1)	SKRRRAKK (352-359, prob:0.818)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EY00	Uncharacterized protein	Medium	10.4	2	18-38, 168-187	ITKLSLHRKFGKQIQKRQLEV, FSKILKKWDKTSKSKTKELY	nucl(12.5),cyto_nucl(12.5),cyto(11.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F084	Uncharacterized protein	Medium	14.4	2	21-42, 1152-1174	SSELRRDSQRKRAKISNGQSSS, DDVKIHKLKAPRDRNQRSIPEMI	nucl(20),cyto(7)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F379	Uncharacterized protein	Medium	14.8	2	127-146, 275-304	SSHSRSRSKSKKFQNSNVNP, DGENEKRRPMKWRFMKKGKWRAIGRRLSCW	nucl(12),mito(5),cysk(5),cyto(3)	KRRPMKWRFMKKGKWRAIGR (280-299, prob:0.928)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3U6	Uncharacterized protein	Medium	14.4	1	363-388	FEGVVKKTVKRGRPRKNRPDDEERLG	nucl(26),cyto_nucl(14.5)	KKTVKRGRPRKNRPDDEERLGKASRTRSK (368-396, prob:0.951)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5H7	Fungal_trans domain-containing protein	Medium	12	2	59-79, 680-704	SNEAKRRRIARCEIYRGPRES, LDKAEKETSTRRKRKSHDDSGKSSH	cyto(8),nucl(6),cyto_mito(6),plas(5),mito_nucl(5)	RKR (691-693, prob:0.614)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDU6	Uncharacterized protein	Medium	12.5	1	783-811	EETPLPKPQKTKFQLWKEKRDTYRAVRKE	nucl(17),cyto_nucl(12.5),cyto(6),plas(2)	SKKAKEAEKSEETPLPKPQKTKFQLWKEKRDTYRAVRKEERAVKKEARQAIKAANKEARAAAKRA (773-837, prob:0.959)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJY1	Uncharacterized protein	Medium	10.2	1	175-198	STQAAKGKEKRGRKCKGKPEVGEE	mito(8),nucl(7.5),cyto_nucl(7.5),cyto(6.5),cysk(4)	AKGKEKRGRKCKGK (179-192, prob:0.897)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUL2	MMtag domain-containing protein	Medium	12.4	1	139-166	AGGNREGRSKDKDRRRHRSRSADVMRAL	nucl(17),cyto_nucl(12.5),cyto(6),mito(3)	REGRSKDKDRRRHRSR (143-158, prob:0.875)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3W1	Uncharacterized protein	Medium	13.4	1	50-94	SSSPPKANTSRERDRSRKMHKSTPSGGKHSATKAKPKNTNVKRAS	nucl(12.5),cyto_nucl(11.5),cyto(7.5),plas(5)	RERDRSRKMHKSTPSGGKHSATKAKPKNTNVKR (60-92, prob:0.89),EEKEKEKGKEKEKEKEKEKEKEKEKEKEK (229-257, prob:0.994)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6A6	Uncharacterized protein	Medium	10.8	1	32-54	APPAAPAQKGKKKAKAAKADDDG	cyto(14),cyto_mito(12),mito(8),nucl(3)	AQKGKKKAKAA (38-48, prob:0.876),PKPKKEEAASKAPAPKAKAAPKPAAPKSSTAKEGEKKRSADESAEPPAKRTRSSVSKSPNVSEKAKSP (672-739, prob:0.993)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F975	C3H1-type domain-containing protein	Medium	12.4	2	8-31, 213-240	QPELRRPTSSPRPKGRENAKDTLC, QLEESSPVKKKNRRRRRRYGQRSSDVPH	plas(16),nucl(7.5),cyto_nucl(5.5),cyto(2.5)	KKKNRRRRRRY (221-231, prob:0.97)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7V8	Uncharacterized protein	Medium	11.7	1	13-39	CVYTASKRGGARRRKKHASSEGRIEQS	mito(14),nucl(10),cyto(3)	KRGGARRRKKHA (19-30, prob:0.915)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ED88	Brr6_like_C_C domain-containing protein	Medium	12	2	126-149, 415-443	KLVGQPIAKKRKRQHRDEREDETM, FKTIERSPSKNRGRTKGRSPSKGERRYLE	plas(23),pero(2)	QPIAKKRKRQH (130-140, prob:0.85),PSKNRGRTKGRSPSKGER (422-439, prob:0.86)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EME9	Reverse transcriptase	Medium	11.2	1	1451-1477	RYVRNCDLCRRSKVPRDKKPGLLKPLS	nucl(23),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMZ5	CID domain-containing protein	Medium	12.6	1	613-632	GRMERKMKWGRLRAEKWKRS	nucl(17),cyto_nucl(13),cyto(7)	KKKTFEGLGRMERKMKWGRLRAEKWKR (605-631, prob:0.864)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQ48	Uncharacterized protein	Medium	12.6	1	1-50	MERKWKWKWKWKWKWKWKWRKGRKKDNVKKGKGRRRRRRMQEKEKEEEQE	nucl(15.5),mito(9),cyto_nucl(9)	RKWKWKWKWKWKWKWKWRKGRKKDNVKKGKGRRRRRRMQE (3-42, prob:0.999)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ESP6	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.7	1	115-138	LGCEYIRERKKRGKASRKDLAQQA	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	ERKKRGKASRK (122-132, prob:0.862)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EU18	H/ACA ribonucleoprotein complex subunit CBF5	Medium	10.6	1	434-481	TNDDEEKNDKKRKRHDGETAEEKAERKRKKKEKKIKRESKKSAAGSSD	cyto(14.5),cyto_nucl(12.5),nucl(9.5)	DKKRKRHDGETAEEKAERKRKKKEKKIKRESKKS (442-475, prob:0.999)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EV34	Uncharacterized protein	Medium	12.6	1	80-106	HGQTRVQKGRIRKPKGPKSINKNESIA	nucl(19.5),cyto_nucl(13.333),cyto(6),cyto_mito(3.833)	KGRIRKPKGPKS (87-98, prob:0.856)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZX0	Uncharacterized protein	Medium	14.7	2	72-104, 178-197	SELTPVATTKKHKKSKKKKKAKNNGKTKDSAKE, PGGPTGRGPRRRQRMQQMDL	nucl(16.5),cyto_nucl(10),mito(6),cyto(2.5)	KKHKKSKKKKKAKNNGKTK (81-99, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0C7	CRAL-TRIO domain-containing protein	Medium	10.9	1	58-84	DTSASEKPKKKRFSALRRKHKDDDSAS	cyto(11.5),cyto_nucl(11.5),nucl(10.5),mito(3)	KPKKKRFSALRRKHK (64-78, prob:0.917)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDA8	Uncharacterized protein	Medium	14	2	1-22, 392-413	MGEVRKDRKKKGKDREMEIGFD, IGEKRNDTRKKVKDLEKKLWVG	nucl(15.5),cyto_nucl(14),cyto(9.5)	RKDRKKKGK (5-13, prob:0.828)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGI7	Uncharacterized protein	Medium	11	1	27-55	RISDVFRIKPRHHRSRKGRMKGKSSNSGS	nucl(14),mito_nucl(12.833),mito(10.5),cyto_nucl(8.833)	RIKPRHHRSRKGRMKGKSSNSGSVR (33-57, prob:0.976)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGS9	Uncharacterized protein	Medium	14.8	1	458-480	VMSAEWRSRRRGQEKKAGRWTDG	nucl(17),cyto(6),pero(2)	RSRRRGQEKK (464-473, prob:0.708)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EI96	40S ribosomal protein S30	Medium	11	1	15-45	KSQTPKVEPQEKKKRPKGRAAKREKFTRRFV	mito(12),nucl(8),cyto(7)	KVKSQTPKVEPQEKKKRPKGRAAKREKFTRR (13-43, prob:0.995)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQW2	ATP pyrophosphate-lyase	Medium	14.9	2	379-401, 1670-1689	LNLTGRFKRHKDKDHTPSRLKET, DGYVPSKRPKKKTDDVDDSM	nucl(22),mito(2),cyto(2),cyto_mito(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5F5	DNA helicase	Medium	10.8	1	725-749	NGNPNFTKGQRPPKRRRVDTTDQMG	nucl(15),cyto(7),mito(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EC11	Aminotran_5 domain-containing protein	Medium	10.7	1	475-504	EVNKRVGHKTWPEKRERRHSNENEKGKSKE	cyto_nucl(10.5),nucl(10),cyto(9),mito(4),pero(3)	GHKTWPEKRERRHSNENEKGKSKESRPTEEKGKRPEKTLSKAKSFWGLNKVVKGRSKG (481-538, prob:0.98)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPA2	Uncharacterized protein	Medium	12.3	1	114-133	QYRASKSKGRPRKHINSQTL	nucl(15.5),cyto_nucl(12),cyto(5.5),pero(3)	SKSKGRPRK (118-126, prob:0.716)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EX88	Uncharacterized protein	Medium	10.2	1	145-164	ALSKRRYTKKIQLRNRGVLT	nucl(20),cyto_nucl(13.5),cyto(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0Z1	Uncharacterized protein	Medium	11.3	1	27-55	YATKKRESSTQPTETRKKRKVQFEEVADA	nucl(23.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F237	BZIP domain-containing protein	Medium	14.5	1	68-94	AGTPAPEKKPVKKRKSWGQQLPEPKTN	nucl(26.5),cyto_nucl(14)	PEKKPVKKRKSWGQQLPEPKTNLPPRKRAKTEDEKEQRRVERVLRNRRAAQTSRERK (73-129, prob:0.949)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4I2	Uncharacterized protein	Medium	14.7	1	16-38	TSGIRLLKASRKRRRSGNEAIDT	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(4)	SRKRRR (25-30, prob:0.679),SKSSKKGAAKPKTHA (117-131, prob:0.814)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9P6	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.3	1	6-29	LEGTTITRRRNGKRPSCEPCRVGK	nucl(9),plas(8),cyto(4),mito(3),extr(1),pero(1),E.R.(1)	KKREKEKTGTEGDERRAKEKEK (743-764, prob:0.724)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E569	Uncharacterized protein	Medium	10.7	1	53-72	QEMFRKTNVTKKKRTKSTAL	nucl(16),cyto(4),pero(4),cyto_pero(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EB14	Uncharacterized protein	Medium	13.1	1	30-141	EQTQQTHQTKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRNKETNTLKIIR	nucl(21),cyto_nucl(14),mito(3),cyto(3)	KKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRSKEAKKQRNK (39-132, prob:0.999)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F238	Uncharacterized protein	Medium	12.6	1	63-86	LLTGLHKHAKRHRRKNGIFNYFVF	nucl(7.5),plas(7),cyto_nucl(5),golg(4),mito(2),pero(2),cyto(1.5)	AKRHRRK (71-77, prob:0.704),IRGQIRGAHKRG (407-418, prob:0.675)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUG3	Uncharacterized protein	Medium	10.9	1	62-89	KSPINRPTFQFNKKRRRQPSHSEPHINS	nucl(21.5),cyto_nucl(12.5),cyto(2.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F339	Uncharacterized protein	Medium	10	1	476-512	TNYVMTRKEHKKERKLQKKEKKARKKATRHQQTINEG	plas(18),E.R.(6),extr(1),pero(1),vacu(1)	KRVKRLIRGGRRRKS (400-414, prob:0.914),RKEHKKERKLQKKEKKARKKAT (482-503, prob:0.997)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5C2	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.5	1	1-40	MPRPKKAGAPEPKKRSRNGCWPCKTRKVKCDETRPTCVNC	nucl(23.5),cyto_nucl(12.5)	RPKKAGAPEPKKRS (3-16, prob:0.821)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8J5	Uncharacterized protein	Medium	10.8	1	195-214	LVRAMRKERRAKIKEGNYLK	mito(24),nucl(2)	KSKKLRRAAAKARRKA (140-155, prob:0.951),KERRAK (201-206, prob:0.662)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A0A0K0PSZ8	Laglidadg endonuclease (Fragment)	Medium	10.5	1	257-280	ITWIVLYNNKKKGKKKGNGKERRT	mito(15),nucl(7),cyto(2),pero(2),cyto_pero(2)	KKKGKKKGNGKERRT (266-280, prob:0.986)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EB49	Uncharacterized protein	Medium	12	1	72-93	AIYMIRRTRIKHKNPKYIPTVF	nucl(13.5),cyto_nucl(10),cyto(5.5),mito(3),golg(2)	RRRENEEREERRRLRREARE (222-241, prob:0.842)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFI5	C2 domain-containing protein	Medium	13.6	2	87-112, 536-563	LKAAKEKLTSKQQKLRDKNNPPGGFD, DEHLQKMKQGQRERKKKEGKEINMVQNS	nucl(13.5),cyto_nucl(13.5),cyto(10.5)	RERKKKE (547-553, prob:0.729)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQ35	Uncharacterized protein	Medium	10	2	8-28, 391-418	LPPSSATRHRQHLRRDHVKIF, AKSTDISPLRRRGRPRKSTKSQQDTTYV	plas(19),E.R.(4),mito(3)	RRRGRPRK (400-407, prob:0.762)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETG9	Uncharacterized protein	Medium	12.8	1	169-193	RLANTQGKKAKRKARERQLEESRRL	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	GKKAKRKARERQLEESRRLAVLQKRRELK (175-203, prob:0.958)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F063	DUF2013 domain-containing protein	Medium	13.2	1	444-473	VRASNLQKKVPPKTPPRRRTRLKAMVTLPP	nucl(21.5),cyto_nucl(14),cyto(5.5)	KKRALPPLPPTVRASNLQKKVPPKTPPRRRTRL (433-465, prob:0.895)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E494	Uncharacterized protein	Medium	10.2	1	8-27	QHPLSFPEKKRRASNKPILI	nucl(13),mito(12)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5G9	60S ribosomal protein L39	Medium	14.8	2	1-25, 31-51	MPSQKSFRTKQKLARAQKQNRPIPQ, TGNTIRYNAKRRHWRKTRIGL	nucl(17.5),mito_nucl(12.5),mito(6.5)	KRRHWRKT (40-47, prob:0.699)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E656	Uncharacterized protein	Medium	10.7	1	357-377	GASARFRQRRKEKEKEASSNI	nucl(8),mito(8),mito_nucl(8),extr(6)	RRK (365-367, prob:0.617)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECD4	Uncharacterized protein	Medium	11.9	1	32-55	TKKARPSTKYPAEHKKKQGKISSV	nucl(13.5),mito(12),cyto_nucl(9)	HKKK (45-48, prob:0.631)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECD8	U2 snRNP auxiliary factor large subunit	Medium	12.4	1	94-117	QRAAKRDKSPTPPPKKKEPTPDLT	nucl(17),cyto_nucl(13.5),cyto(8)	RERRGGEREWDRDRGAARRDARRDDDERPPRRDNRDLFDDRRGGGGGGGRRGGERGDRGDRRDRGDRGDDGGFAAQRAAKRDKSPTPPPKKK (19-110, prob:0.969)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EG79	Uncharacterized protein	Medium	14.9	2	884-923, 981-1003	AVDDARKKRKKWKLLMRLRKGQKEKKRKDEEKEKPKRDAD, RTDSHKSHKSHKSAKSQRFERSK	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(2)	KGKSSTKKAFEAVDDARKKRKKWKLLMRLRKGQKEKKRKDEEKEKPKRDA (873-922, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHX6	HTH CENPB-type domain-containing protein	Medium	10.7	1	482-509	ANNLRAIMKKRTIRKKGKRLVLKGHFHI	nucl(12.5),mito_nucl(11.666),mito(9.5),cyto_nucl(9.333),cyto(4)	MKKRTIRKKGKRL (489-501, prob:0.924)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJB0	Uncharacterized protein	Medium	14.3	2	7-28, 46-74	QDKMSSKSHRSRKSSSISRKLL, YRNRATWKPNWDPNRPVRKGPPKKRDGGI	mito(13),nucl(7.5),cyto_nucl(7),cyto(5.5)	RPVRKGPPKKR (60-70, prob:0.794),GKGER (459-463, prob:0.618)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EL00	Uncharacterized protein	Medium	14.3	1	12-39	RQRSNSPPPHQLSKRDKRRSMLQDKLAE	nucl(25),cyto_nucl(14.5)	RKR (235-237, prob:0.616)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQP4	Uncharacterized protein	Medium	12	2	325-346, 668-689	ETFFWGSRRKRTRKAALARDVI, GQEEIERRNRRKKERLAESGDV	mito(11),plas(7),cyto_mito(7),mito_nucl(7)	KR (334-335, prob:0.607),RNRRKK (675-680, prob:0.698)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ET47	Uncharacterized protein	Medium	10.5	1	7-37	AIKKFCRAAKSMVKRKRKSKRPTPARTDLAI	mito(16),mito_nucl(14),nucl(10)	AKSMVKRKRKSKRPT (15-29, prob:0.964)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EY44	Uncharacterized protein	Medium	13.4	1	285-319	SMTGTKLMKKRSHHRRRRRKHKQKEKERNEDDDDP	nucl(21.5),cyto_nucl(13.5),cyto(4.5)	MKKRSHHRRRRRKHKQKEKE (292-311, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5B4	Uncharacterized protein	Medium	10.9	1	525-545	NERLSKAKYARQKQMRDELRP	nucl(16),cyto(8),mito(1),golg(1),cysk(1)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6A0	Uncharacterized protein	Medium	10.4	1	76-98	SCPPYSYRSKNSKIKTERRTYVS	nucl(11),mito(10),cyto_nucl(9.666),cyto_mito(9.166),cyto(6)	KRSKRD (894-899, prob:0.643)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E777	60S ribosomal protein L6	Medium	13.3	1	33-53	VSAPRKVRKSIRPSKVRPSLE	nucl(17),mito(5),cyto(5),cyto_mito(5)	RKVRKSIRPSKVR (37-49, prob:0.748)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E880	Uncharacterized protein	Medium	11.3	1	13-33	SDTTPPTHKRHKSSKAENSDE	nucl(23),cyto_nucl(13.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EF28	Uncharacterized protein	Medium	10.4	1	7-28	SEDLTKSKKKEKDEKICKRDCG	nucl(20.5),cyto_nucl(13),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGI2	BTB domain-containing protein	Medium	11.1	1	167-198	GTASDERSRRRRESRRRRQERAWEQRQRKEPG	nucl(11.5),cyto_nucl(11),cyto(9.5),mito(5)	RSRRRRESRRRRQERAWEQRQRKEPGRHR (173-201, prob:0.985)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMI0	Non-specific serine/threonine protein kinase	Medium	14.3	1	222-242	ATLIERRRKRREAIKAKYRGS	nucl(23.5),cyto_nucl(14)	RRRKRREAIKAK (227-238, prob:0.882)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPQ1	CRIB domain-containing protein	Medium	12.4	2	14-38, 128-150	HPNNNGPLSKRKMSRKDNAPPTDKH, FGKTIFSRSSKKFRRNHPSMGGS	nucl(20),cyto_nucl(13),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPV6	Uncharacterized protein	Medium	11.5	1	114-134	EFCGKAFKRPQDLKKHVKTHA	nucl(26.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQ99	Myb-like domain-containing protein	Medium	10	1	250-276	TLRGRFRTLTKDKKDRVRKPEWTENDL	nucl(20.5),cyto_nucl(12.833),cyto(4),cyto_mito(3.833)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETD7	Uncharacterized protein	Medium	13.5	1	109-145	DIRRLRSKKTPKPSSSERKKRRCYCRKLDSNTKIGRV	nucl(21),cyto_nucl(13.5),cyto(4)	RRLRSKKTPKPSSSERKKRR (111-130, prob:0.918)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVU4	Uncharacterized protein	Medium	14.9	2	9-32, 568-593	LRKIAPLPNRSKKRELSQGRPSSQ, IDSAKRKGDKKLKKELERKKRWLFIE	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	KRKGDKKLKKELERKKR (572-588, prob:0.972)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWF1	Uncharacterized protein	Medium	10.5	1	201-225	DTEQNRKIAERRNKRKEMQNIEEGE	nucl(19.5),cyto_nucl(11),mito(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWZ4	Uncharacterized protein	Medium	10.8	1	1-28	MSKFKTSTKSKAKPKSIKEKSKLRSTLI	mito(11),nucl(9.5),cyto_nucl(8),cyto(5.5)	TKSKAKPKSIKEKSKLRSTLIRTGDKHHIHKHPAPSKIKAKPK (8-50, prob:0.966)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXY5	Uncharacterized protein	Medium	10.2	1	132-153	SELSSKDRAKARQRERDEQQVA	nucl(13),mito(8),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F492	Uncharacterized protein	Medium	12.7	1	828-854	LLISCPIYKTKRKEIFKKIPLSKNTIQ	nucl(20),cyto(4),mito(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F725	Uncharacterized protein	Medium	13.2	1	42-63	KANEALSKRRRMKKTQLRQGGV	nucl(21),cyto_nucl(13),mito(3),cyto(3)	KRRRMK (49-54, prob:0.65)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E939	C2H2-type domain-containing protein	Medium	12.7	1	52-81	SFYRGRSPVGDRQRRNPRDRDRSRSPVDRY	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	KKGKK (478-482, prob:0.657)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBN2	Uncharacterized protein	Medium	10.5	1	168-188	QYPKSSVRLYRGRQHKKENTS	nucl(22.5),cyto_nucl(14),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECM3	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.4	1	7-49	GSSSKPPLERNRPIHGRQRARKACIPCRQRKRKCDVEFPCSMC	nucl(16),plas(6),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECM5	Uncharacterized protein	Medium	14.2	1	84-133	ADMKEFSPKIKKRRYDKEERVKVAANRGFACARHRRQKMKCDPERCSRNK	nucl(21),mito_nucl(12.833),cyto_nucl(12.333),mito(3.5)	IKKRR (93-97, prob:0.695),RSAGKEKKP (469-477, prob:0.718)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3J2	Uncharacterized protein	Medium	13.9	1	1-22	MPKSLKKTSKHISKKRGGEVTA	nucl(19),mito_nucl(12.833),cyto_nucl(11.333),mito(5.5)	KTSKHISKKRG (7-17, prob:0.702),RRAGGRDDKLERMAAERKRH (34-53, prob:0.679)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4Y8	Usp domain-containing protein	Medium	11.6	1	469-500	SSVPVMVARKRLRKHNKQKRTPNIRLANNLTN	nucl(16),cyto_nucl(13.333),cyto(8.5),cyto_mito(6.166)	RKRLRKHNKQKR (477-488, prob:0.841)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E8T3	DUF1752 domain-containing protein	Medium	11.2	1	390-411	AIMMKRSTSKRQLPPMRKKVIS	nucl(18),cyto_mito(4),mito(3.5),cyto(3.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEH3	Protein kinase domain-containing protein	Medium	14.4	1	25-47	KSERTPGTPRRERKEKAVQDPGL	nucl(23.5),cyto_nucl(13)	KPSIPPPRPKSPVKARA (497-513, prob:0.788)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELX4	Uncharacterized protein	Medium	13.5	1	47-68	VPGRLRPKTKPEMRKEKRGGPE	nucl(22),cyto_nucl(14),cyto(4)	GRLRPKTKPEMRKEKRG (49-65, prob:0.861)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EYK2	Uncharacterized protein	Medium	11.3	1	20-45	LQQFLLRRNNLQQRPKKTKLTPEDYE	nucl(17),cyto(7),pero(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F664	WD_REPEATS_REGION domain-containing protein	Medium	10.1	1	184-205	KSRYLPETQSKRQRINRQGNFT	nucl(19.5),cyto_nucl(13),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6I2	Uncharacterized protein	Medium	13.4	1	23-47	NETALMPPPPKRIKRPKNVIDEDAY	nucl(18.5),cyto_nucl(11),mito(5)	KRIKR (33-37, prob:0.619)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9A0	Uncharacterized protein	Medium	13.5	1	370-398	EPALKQPKEAKDPKKSKHSKNPKLSDADP	nucl(22.5),cyto_nucl(14),cyto(4.5)	GHGRRREPALKQPKEAKDPKKSKHSKNPK (364-392, prob:0.975)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7A5	PHD domain-containing protein	Medium	14.4	1	186-208	AYKKNSKKGKAAARASKRRKTTD	nucl(23.5),cyto_nucl(13.5)	PPPSAPAYKKNSKKGKAAARASKRRK (180-205, prob:0.983)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFY6	Valyl-tRNA synthetase	Medium	11.7	2	66-91, 93-116	KELERERKKAEKQAKFDQKKQAQQAN, ASAASSKNKEKKAKAEKKAAEEVL	cyto(11.5),cyto_nucl(9),mito(7),nucl(5.5)	KKVKSEKELERERKKAEKQAKFDQKKQAQQANAASAASSKNKEKKAKAEKK (60-110, prob:0.933)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0U5	Uncharacterized protein	Medium	14.2	1	154-185	SPIPTARNSKKARQPPPTKWRSKKPNQSTTTL	nucl(24.5),cyto_nucl(15)	PDRPTSPIPTARNSKKARQPPPTKWRSKK (149-177, prob:0.901)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4B7	MFS domain-containing protein	Medium	10	1	120-149	GWTAMRDPRGKQKQKQKHKHKAGERANGNT	plas(26)	PRGKQKQKQKHKHKAG (127-142, prob:0.912),RRKGVRMRRLEADKEARGRRAA (665-686, prob:0.794)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEL0	Uncharacterized protein	Medium	10.7	1	51-76	HIVPCARDRRLKTRRKIRFHDACYRQ	nucl(22),cyto_nucl(13.5),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EN25	Uncharacterized protein	Medium	13	1	14-88	EKAEREKSERSSRKDKDRKHRHHHRSRHHRSKEDDGEDRDDHRHKRSRHSKHDDEEDDDRRKRTHEKLSDPKEDL	nucl(14),cyto(7),mito_nucl(7)	KAEREKSERSSRKDKDRKHRHHHRSRHHRSKEDDGEDRDDHRHKRSRH (15-62, prob:0.993)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENU3	Clustered mitochondria protein homolog	Medium	14.9	2	935-959, 1283-1307	AAPTGKSTNGKKKKKNAREGSPASI, GSDQANKNKKRPGRSNPKRRGGAAA	cyto_nucl(13.333),nucl(13),cyto(10.5),mito_nucl(7.499)	NGKKKKKNAR (943-952, prob:0.88),KNKKRPGRSNPKRRGGAAAAAGK (1289-1311, prob:0.981)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQM4	Velvet domain-containing protein	Medium	10.8	1	239-258	GCRVRIRRDVRMRRRDTKPG	nucl(21.5),cyto_nucl(12.5),mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ET43	Uncharacterized protein	Medium	11.4	1	30-53	YITCTYFSRRKKVRKGQYPGGPKM	cyto(10.5),cyto_nucl(8),nucl(4.5),extr(4),E.R.(4),mito(2)	KKVR (40-43, prob:0.63),EKRTGRRKAGDRRGVGRR (90-107, prob:0.904)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EU12	Fungal_trans domain-containing protein	Medium	10	1	58-82	LGTACWPCRQRKVKCDNRHPYDPNE	nucl(18.5),cyto_nucl(12),cyto(4.5),plas(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1B3	Uncharacterized protein	Medium	12.7	1	1066-1104	LDVLKSKPKSESKTKSKNKEKRNKGKKVGKQKQHLSIAM	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	KSKPKSESKTKSKNKEKRNKGKKVGKQKQHLSIAMMKKEA (1070-1109, prob:0.997)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F233	Transcription initiation factor IIE subunit beta	Medium	11.2	1	253-287	SEDPSKRIKATPKPKEKKRKAPRKGGRTTNTHMQH	mito(14),nucl(10),cyto_nucl(7.5)	PSKRIKATPKPKEKKRKAPRKGGR (256-279, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9U4	Reverse transcriptase domain-containing protein	Medium	10.2	1	126-146	TSIPRIKSTKRAKPWWSPELK	nucl(13),mito(6),cyto(4),pero(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4W6	Uncharacterized protein	Medium	10.1	1	61-80	HNSYQDRKPRGVRNNRIVKA	nucl(21),cyto_nucl(14.5),cyto(6)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E521	Uncharacterized protein	Medium	10.7	1	387-407	SETRSRRGSRGNERKTHIQEQ	nucl(21),cyto_nucl(13),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E579	TBP-associated factor 4	Medium	13.4	1	354-373	LDKPPTKKEMKKKAEAKTSE	nucl(12.5),cyto_nucl(11.5),cyto(9.5),mito(3)	RLRKRKARE (323-331, prob:0.807),KKEMKKK (360-366, prob:0.695)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7U8	Uncharacterized protein	Medium	12.6	1	514-533	KVEEATEKARLKKRRRKSVV	nucl(17.5),cyto_nucl(13),cyto(7.5)	KARLKKRRRKS (521-531, prob:0.937)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFP2	Uncharacterized protein	Medium	10.6	1	34-56	EDDAGKKKKKRVTKRTMKLSPSF	cyto(15),cyto_nucl(13.5),nucl(10)	GKKKKKRVTKR (38-48, prob:0.928)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGQ4	Uncharacterized protein	Medium	12.2	2	270-294, 1393-1415	DLERALKDKERYRKKLKENLTQHAA, LSPEDIRSPRRQKFQQDLPTPSF	nucl(21.5),cyto_nucl(14),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKR0	BTB domain-containing protein	Medium	12.4	1	9-32	SQTTESFSRNRRHKGKSSFREHAV	nucl(17),cyto_nucl(12),mito(5),cyto(5)	RRHKGKSSFREHAVSKHRHER (19-39, prob:0.764)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMF3	Uncharacterized protein	Medium	10.1	1	275-298	GPDICTRKSKSSNRKAHAKEERGR	mito(11.5),mito_nucl(11.333),nucl(10),cyto_nucl(8.333),cyto(5.5)	KSSNRKAHAKEERGR (284-298, prob:0.723)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ESP1	Ribonuclease P protein subunit	Medium	14.3	1	43-75	NNEQQHRRLERQRKLALRKKKLKPAPLSAREKR	nucl(17),cyto(7),mito(3)	RRLERQRKLALRKKKLKPAPLSAREK (49-74, prob:0.98)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWT2	Uncharacterized protein	Medium	10.7	1	536-556	LSTSQPPKKVKQLPPYQPTFV	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWY9	Uncharacterized protein	Medium	12.7	1	46-75	ANVFVKEEKRNNRERRRRRNTRGGMADRGK	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	EKRNNRERRRRRNTRGGMADRGKIGKQR (53-80, prob:0.977)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXB2	Uncharacterized protein	Medium	12.9	1	518-551	DEHTSPPKEAPPKKSKKSKKKSKKSAAAKEASKI	nucl(19),cyto_nucl(13.5),cyto(6)	PKEAPPKKSKKSKKKSKKSAAAK (524-546, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZD3	Uncharacterized protein	Medium	14.8	2	115-136, 444-476	TGRNRSREYRSSPRSRERSRST, GRSGKEEKGREKEKEREKKNRLKNMKMSEKLGR	nucl(20.5),cyto_nucl(13.333),cyto(5),cyto_mito(3.833)	SGKEEKGREKEKEREKKNRLKNMKMSEKLGRALRGFGRRSKG (446-487, prob:0.993)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZH2	40S ribosomal protein S8	Medium	12.8	2	11-34, 135-154	RSASGAKRSHYRKKRAFEAGRQEA, EPDTKKSKSVEKKHHERFAA	nucl(10.5),cyto_nucl(10),cyto(8.5),mito(8)	RHKRSASGAKRSHYRKKRAFEAGRQEAGTRIGTKRIHLVRTRGGNRKFR (8-56, prob:0.967)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6N8	WD_REPEATS_REGION domain-containing protein	Medium	14.5	2	1-21, 59-88	MAERRQTKRRRYDSDVSTPGY, ELDHTHPRHRSPRSPRSRRNSHHSRSRSTS	nucl(17.5),cyto_nucl(11.5),mito(5),cyto(4.5)	RHRSPRSPRSRRN (66-78, prob:0.747)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6R4	Uncharacterized protein	Medium	13.4	1	5-30	QAATVSNKIVRKRKRKDDEDADSDTN	nucl(13.5),mito_nucl(13.5),mito(12.5)	RKRKR (15-19, prob:0.666),KKPRR (63-67, prob:0.657)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECT2	Uncharacterized protein	Medium	11.8	1	1-20	MPPSRKRSKLDSSKEQSTNS	nucl(12.5),cyto_nucl(9.5),pero(6),mito(5)	DKKSKPGKKGRPK (350-362, prob:0.931)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERB2	Uncharacterized protein	Medium	10.8	1	419-459	EAITKKHKKGKGKSGRGRHGRGSKKSKKSKKDDDDDKKGIS	plas(9),nucl(7),mito(3),cyto(3),cyto_mito(3)	KKHKKGKGKSGRGRHGRGSKKSKKSKK (423-449, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0C9	C2H2-type domain-containing protein	Medium	12.3	1	56-75	LSHLKGKPHKRRVKALKEGP	nucl(14.5),cyto_nucl(9.5),pero(6),cyto(3.5)	KGKPHKRRVKA (60-70, prob:0.817)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0Q0	Uncharacterized protein	Medium	10.7	1	3-37	MIYRCCVRPGLRRRRERKEKKERVRKESEERRERE	mito(14.5),cyto_mito(9.5),nucl(9)	GLRRRRERKEKKERVRKESEERREREEREKEIRRLREEKEVLGRERERW (12-60, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7K5	Uncharacterized protein	Medium	14.2	1	29-59	YRSNHIIPSKGKRSKKRKRRDSKAGNEKSSE	nucl(16),cyto(6),mito(4)	SKGKRSKKRKRRDSKAG (37-53, prob:0.994)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E770	Uncharacterized protein	Medium	14	1	1-47	MPGSRKWRKRELEAKEKEREEKEREERERKEKERKERETKHHPGRQS	nucl(22.5),cyto_nucl(12),mito(3)	RKWRKRELEAKEKEREEKEREERERKEKERKERETKHHPGRQ (5-46, prob:0.995)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7Q2	Uncharacterized protein	Medium	12.1	1	543-573	LAGKCAGRARSRRGRGRRRGKKRGGVVYEGV	nucl(11),golg(5),cyto(4),mito(3),plas(1),pero(1),E.R.(1),cysk(1)	GRARSRRGRGRRRGKKRG (549-566, prob:0.996)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDU7	Uncharacterized protein	Medium	12.8	2	252-275, 459-483	LEWLKHFDKHTKNRRKGKYRMLVL, LRTANEALSKRRRAKKTQLRQGGVL	cyto_nucl(10),nucl(9.5),cyto(9.5),pero(3),mito(2)	KRRRAK (468-473, prob:0.682)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEX5	KOW domain-containing protein	Medium	14.1	2	10-32, 318-337	LAEKQAVRRLARRQRKNELDEFA, KELNKRERALRKAKGKGKLT	nucl(13),mito(11.5),cyto_mito(7.5)	ELNKRERALRKAKGKGKLTR (319-338, prob:0.965)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EM78	ATP-dependent RNA helicase dbp9	Medium	14.5	2	357-387, 572-602	EDAKDAKKETKQPSKKKQKTGKKDKEYGVSR, TTENRIRKARAANKAKGRGKGRKSDPLKTFK	cyto(17),nucl(7.5),mito_nucl(5)	DAKKETKQPSKKKQKTGKKDK (361-381, prob:0.956),RIRKARAANKAKGRGKGRKSDPLKTFKAKSRK (576-607, prob:0.997)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQW5	Uncharacterized protein	Medium	13	1	145-165	ASSPMKRTTKPSSKHPRQEEI	nucl(11.5),cyto_nucl(11.5),cyto(10.5),mito(1),plas(1),pero(1),golg(1),cysk(1)	R (144-144, prob:0.606),MKR (149-151, prob:0.615)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EYC4	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.4	2	22-45, 629-648	AQACDRCRSKKIRCDGIRPCCSQC, ALCLGPRKKNQPHPYKHISA	nucl(20),cyto(3),mito(2),plas(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4I0	Uncharacterized protein	Medium	10	1	1-21	MDKNSSKRRKLHQSTLNTFLP	nucl(13),mito(9),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5U4	Homeobox domain-containing protein	Medium	14.2	1	166-191	PQTAAERRAERRKMKRFRLTHQQTRF	nucl(24),cyto_nucl(14.5)	RAERRKMKR (173-181, prob:0.701)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EG19	Uncharacterized protein	Medium	12.3	1	73-97	TMSKLLRLRKQRKFIKERRKRMADR	nucl(16),cyto_nucl(13),cyto(8)	RLRKQRKFIKERRKRMA (79-95, prob:0.939)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EH66	Uncharacterized protein	Medium	11	1	1-27	MIPCKSTTKEERKKGRKNSERCDFKPG	nucl(11.5),mito_nucl(11.5),mito(10.5),cyto(5)	KKGR (13-16, prob:0.623)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMK3	Cation_ATPase_N domain-containing protein	Medium	10	2	240-260, 1024-1048	AKSLGQKSRKIREVKRNEAGK, IESWKWIKRVYFRHQKKRGTGVVRD	plas(25)	KSRKIREVKRNEAGKAKP (246-263, prob:0.823)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENH7	Casein kinase II subunit beta	Medium	11.2	1	80-102	SIACNECKRRKIKCNGNTPCQRC	nucl(24),cyto_nucl(14.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EP32	Uncharacterized protein	Medium	11.6	1	220-242	GITQESRKFPKHQRQNRHDDAGD	cyto(12.5),nucl(11),cyto_mito(7)	AKGKKQVR (293-300, prob:0.689)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERT8	Protein kinase domain-containing protein	Medium	10.6	1	41-63	RYGLKPPPSPKVKKVRPTLKSSA	cyto(15),nucl(7),pero(5)	GLKPPPSPKVKKVR (43-56, prob:0.759)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUZ2	Uncharacterized protein	Medium	11.7	1	49-77	NTIDARAKPKKTCRPTKRSRLERRVLHAG	mito(10),nucl(5),cyto(5),extr(5),cyto_nucl(5)	PKK (57-59, prob:0.616),KR (65-66, prob:0.609)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZS1	Uncharacterized protein	Medium	13.5	1	1-20	MRKSKSERKWKKGWEFEIYE	nucl(22),mito(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMQ8	Fungal_trans domain-containing protein	Medium	13	1	5-31	FAQERARTKARMRKTRCDPNLPRCLPC	nucl(20),mito(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F056	Jacalin-type lectin domain-containing protein	Medium	10.7	2	47-67, 848-874	APSFLKDLKRRSKPVAKTTDS, KTKLFLTKENKPRKRLPKSLKINNLTI	plas(13),cyto_mito(5),mito(4.5),cyto(4.5),nucl(2)	KPRKRLP (858-864, prob:0.7)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9Q2	Uncharacterized protein	Medium	10.8	1	92-116	TCPIHPIIQRTKWRRKLPAQLARYP	cyto(11),nucl(9),pero(6),cyto_mito(6)	KGIVRKLPGPPPKATASRKRQAKGLQPGPPSKHR (591-624, prob:0.943)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIC1	Uncharacterized protein	Medium	11.8	1	803-822	QKISNLKRRRTSKSPSHTHD	nucl(17),cyto(6),pero(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIN0	Uncharacterized protein	Medium	10	1	1-22	MKKENKTKRESRVIKNEKKGVR	nucl(18),cyto_nucl(11),mito(7)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKK4	Uncharacterized protein	Medium	13.9	1	246-270	IVKPKPTPRVPKAPKEPKPAKEPKA	cyto(16.5),cyto_nucl(12.833),nucl(8),mito_nucl(5.333)	KEKPAPSGRGRGRPPKPDSEKKVKAPSGRGRGRPSSGIVKPKPTPRVPKAPKEPKPAKEPKAAKEPKATKEPKAAKVPKSPKAKAPAADVEKKTPGKRGRPAKAAPAE (209-316, prob:0.998),SSGKRGRPAKDA (324-335, prob:0.761),PVSKKRKAADDAATPVSAGRGRPKKVKA (344-371, prob:0.892)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMG5	WSC domain-containing protein	Medium	14.7	1	338-362	DNEEIKRKAKWKKIIEKKYENKLRL	nucl(12),cyto_nucl(9.833),mito_nucl(9.833),mito(6.5),cyto(6.5)	KAKPKGKLHRR (235-245, prob:0.753),GKKIPPKKPRYSHSKISLRKRP (292-313, prob:0.922),KRKAKWKKIIEKK (343-355, prob:0.857),WGGQKWSGGKREGGKIHLERK (461-481, prob:0.786)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EP51	Uncharacterized protein	Medium	14.9	1	2-23	ASPPRRRSSRLRTPVKTLPNPN	nucl(16.5),cyto_nucl(10.5),mito(7)	ERKKNPEGSHMGGRK (159-173, prob:0.695),RPKARK (663-668, prob:0.697)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ESS2	Uncharacterized protein	Medium	13.7	1	447-476	ELESKREREKRLQREARKLEKEKERQRQEE	nucl(20.5),cyto_nucl(11.5),mito(4)	KREREKRLQREARKLEKEKER (451-471, prob:0.844)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F043	Histone H2B	Medium	12.9	1	30-54	GKKTTAGEGKPRKKKGRKETYSSYI	nucl(17.5),cyto_nucl(9.5),mito(9)	ATKAPASASKAPAKSDAGKKTTAGEGKPRKKKGRK (13-47, prob:0.992)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0B9	40S ribosomal protein S26	Medium	14.5	2	1-27, 81-116	MVKKRASNGRNKKGRGHVKPIRCSNCS, GKIVRVRSRVGRRNRAPPPRVRYNKDGKKVNPNQAA	mito(10.5),mito_nucl(10.5),nucl(9.5),cyto(7)	KKRASNGRNKKGRGHV (3-18, prob:0.837),RVRSRVGRRNRAPPPRVRYNKDGKKV (85-110, prob:0.912)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1V5	Uncharacterized protein	Medium	11.8	1	463-486	RLANTGLSKRRRAKKTQLRLGGAL	nucl(11),cyto(6),pero(6),cyto_pero(6)	KRRRAKK (471-477, prob:0.687)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1W9	Uncharacterized protein	Medium	13.3	1	17-46	EEERHKHDPSRAKQRHIFRRPLKKLSVFNK	nucl(18.5),cyto_nucl(11.5),mito(5)	RAKQRHIFRR (27-36, prob:0.631)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAF8	Uncharacterized protein	Medium	11.5	1	29-48	EKFRRASKKLQGRLHRQQLE	mito(17),nucl(9)	KFRRASKKL (30-38, prob:0.707)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEP1	Uncharacterized protein	Medium	13.5	1	514-537	AEEWCEKLGRKKRDEREAATPRNE	nucl(23),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ER69	Uncharacterized protein	Medium	10.1	1	440-467	DLEVRRWKGRVQREERTRRAKNWWETEG	nucl(17.5),cyto_nucl(10.5),mito(4),cyto(2.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERM4	WD_REPEATS_REGION domain-containing protein	Medium	13.6	1	33-63	STTAQKIVPKPPPKRKSTTGKKAARVQKVAF	nucl(14),cyto(8),mito(3)	PKPPPKRKSTTGKKAARVQ (41-59, prob:0.911)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERP0	Uncharacterized protein	Medium	14.2	1	231-251	LRTGRCTRRKTSFRKHLSDEN	nucl(24),cyto(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EU93	WD_REPEATS_REGION domain-containing protein	Medium	12.2	1	183-205	NSRYLPETQSKRQRINRQGNFTN	nucl(18),cyto(3),mito(2),pero(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EV45	RNase H domain-containing protein	Medium	11	1	485-509	GISIECMKKKRKKAEKKGVDRKIVI	nucl(10),cyto_nucl(9),mito(8),cyto(6)	KKKRKKAEKKGV (492-503, prob:0.964)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EX04	Uncharacterized protein	Medium	13.4	1	293-315	IASPTRSERARSRRRREEDGDDS	nucl(22.5),cyto_nucl(14.833),cyto(4)	MSRPDSRSGSRPGSRSGSRGRSKSRIASPTRSERARSRRRR (268-308, prob:0.979)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EX56	RNA-dependent RNA polymerase	Medium	10.2	1	54-80	GEMFLRRYGERRPKNKQRNLLVSLPKL	nucl(14),cyto(9),mito(2),pero(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3H8	Nucleolar protein 58	Medium	10.1	1	456-505	IAPTSVSKQEKKSKDKKDKKDKKEKKDKSEKSEKKDKKRRHSEANGEEEG	cyto(13.5),cyto_nucl(11),nucl(7.5),mito(2),pero(2)	EKKSKDKKDKKDKKEKKDKSEKSEKKDKKRRHSEANGEEEGEKKKKKKSKAE (465-516, prob:0.999)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8Y8	Uncharacterized protein	Medium	11.4	1	29-54	STDPRFRLPSKKQTRTKIDKRFSRML	nucl(24.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6K0	Uncharacterized protein	Medium	14	2	13-42, 111-141	SLAYLPRKRASRHRGKVKSFPKDDKTKPVH, SDEVKRRFYKNWYKSKKKAFTKYAKKHSENS	mito(12),cyto(6),plas(5),E.R.(2)	PRKRASRHRGKVKSFPK (18-34, prob:0.905),KKK (126-128, prob:0.625),KKLPRKTHK (237-245, prob:0.678)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E721	BTB domain-containing protein	Medium	12.4	1	11-33	RVEKNIKLKKSHRDPAKLSRLQK	mito(14),nucl(11)	KK (19-20, prob:0.611)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E993	Ubiquitin	Medium	12.5	1	93-128	KMICRKCYARLPPRATNCRKKKCGHTNQLRPKKKLK	nucl(18),cyto_nucl(16),cyto(6)	RPKKKLK (122-128, prob:0.805)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAP4	Ubiquitin-activating enzyme E1-like	Medium	10.7	1	567-591	ASIPPESPIPRRKKPAREPEPTVSA	nucl(8.5),cyto_nucl(8),cyto(6.5),mito(6),E.R.(3)	RRKKP (577-581, prob:0.698)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EF20	Uncharacterized protein	Medium	10.5	1	198-217	GAASQRKKWMTKFKKVKERK	plas(8),nucl(7),cyto(5),golg(4),mito_nucl(4)	RKKWMTKFKKVKERK (203-217, prob:0.887)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EG89	Uncharacterized protein	Medium	10.3	1	45-68	DGKTYEPYKIRPKKKDASATTNGD	cyto(18),nucl(6),mito(2)	KEKAGKASKKAQKDKEAADAAAAKPVRLPNSKRP (327-360, prob:0.904)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHZ9	Btz domain-containing protein	Medium	13.9	1	147-168	QEQPHERRRREHEEYKKKRDAD	nucl(21.5),cyto_nucl(12.5),cyto(2.5)	GRGRGGRGR (197-205, prob:0.678)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMS4	Uncharacterized protein	Medium	14.6	2	225-252, 355-377	PPGTAKSDDPNKKKRKRTARERDLCDVK, RFLQKREKEDKKTQKTYHKRASG	nucl(16),cyto_nucl(11),cyto(4),pero(4)	RPPGTAKSDDPNKKKRKRTAR (224-244, prob:0.949)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQR7	Uncharacterized protein	Medium	13.6	1	77-103	GEASSSRCCRKQRKRKGAVRREVKTTD	nucl(21),cyto_nucl(12.5),mito(4)	KQRKRKGAVRR (87-97, prob:0.796)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWF5	Mitochondrial distribution and morphology protein 34	Medium	12.1	1	360-386	GANRGSRSHTTRKKKNRVVNLRKSKTT	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(2),plas(1),pero(1),golg(1),cysk(1)	RKKKN (371-375, prob:0.689)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0R0	Histone H1	Medium	13.4	1	220-241	PKKAAAPKKTATKKTTPKKAAA	mito(14),nucl(11),cyto_nucl(7.5)	KLAPKAKKAPADKPKKAATEKKTTEKKPAVKKAAPKKATATKEPKEPKEKKEKTGDAAAKPKAAPKKAAAKPKAAATKEPKEPKEKKASVAKPKKAAAPKAAPAV (93-197, prob:0.999),VLKKTASGRVTKTKSDGPKKAAAPKKTATKKTTPKKAAA (203-241, prob:0.982)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F859	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.5	1	13-37	GDSFKPPPTRRPKSGERRRVTQACD	nucl(25.5),cyto_nucl(13.5)	TRRPKSGER (21-29, prob:0.679)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4X9	SRP40_C domain-containing protein	Medium	14.4	1	454-481	LIVTKGKGFTKEKNKKKRGSYRGGYIDV	nucl(23.5),cyto_nucl(13)	KGFTKEKNKKKRG (460-472, prob:0.881)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5B5	Uncharacterized protein	Medium	13.4	1	754-775	PHFVRCIIPNHKKKPKQLSAPL	nucl(21),mito(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9T9	Uncharacterized protein	Medium	13.4	1	156-180	LTDQGTKPVARKRRKPWEKDVDEEA	nucl(20),cyto_nucl(13),cyto(4)	RKRRK (166-170, prob:0.713)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EB47	Nucleolar GTP-binding protein 2	Medium	14.1	1	591-615	LQKQLSKDSNTSRRKQQSKKRGQKT	nucl(15.5),cyto_nucl(13),cyto(9.5)	KR (505-506, prob:0.609),RKQQSKKRGQ (604-613, prob:0.711)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDR9	Uncharacterized protein	Medium	10.9	2	10-30, 54-76	QQEHEHRRRIRTRTYDTPTRN, LTNQTQHRPHRPHQSHHSRSPSH	nucl(13.5),cyto_nucl(9),plas(5),cyto(3.5),pero(2),golg(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPU5	BZIP domain-containing protein	Medium	14.5	1	48-67	TSEERKQRNRQAQAAFRERR	nucl(26.5),cyto_nucl(14)	RKGGRK (38-43, prob:0.636)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERU1	Uncharacterized protein	Medium	13.6	1	231-254	QASGNIRPKKRKRGKKDIPSCIDN	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	RPKKRKRGKK (237-246, prob:0.964)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5C1	PPIase cyclophilin-type domain-containing protein	Medium	12.6	1	27-52	GPQLPSAEAPKKKRRKLPYEKLYISA	nucl(17),cyto_nucl(13),cyto(7)	PKKKRRK (36-42, prob:0.842)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F944	Lipase_3 domain-containing protein	Medium	12.2	1	5-25	LQFHCQRPPPFRKHHTASWDE	nucl(14.5),cyto_nucl(9.5),cyto(3.5),mito(3),pero(2),golg(2)	SKPKLPPR (543-550, prob:0.659)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E965	Uncharacterized protein	Medium	12	1	116-138	LVSRLVKKKKDKAKNAGNEKEKR	nucl(10),cyto(8),mito(7)	SRLVKKKKDKAKNAGNEKEKR (118-138, prob:0.959)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMU9	Uncharacterized protein	Medium	14.3	2	185-214, 403-423	DAAARIEKRRQKFEKRRRRRKEENGSDDEL, NDTSTKRSKSGKKSNGNANLM	nucl(17.5),cyto_nucl(14),cyto(9.5)	IEKRRQKFEKRRRRRK (190-205, prob:0.987)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWA1	GTP cyclohydrolase 1	Medium	13.4	1	34-60	WEGGEMTKKKKRKSKANGHHGHRRHSV	nucl(21.5),cyto_nucl(13.5),cyto(4.5)	TKKKKRKSKANGHHGHRRHSV (40-60, prob:0.99)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWG3	Non-specific serine/threonine protein kinase	Medium	10.1	2	2-26, 338-357	LGHVMTRKYGKKRPALQGHNHSSVG, TTSKSKSKSKSKSQTPTSPH	nucl(13),cyto_nucl(10.333),cyto_mito(6.666),mito(6.5),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6N3	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.4	1	20-46	IRSNRGCWTCRIRKKKCDELQPGCSRC	nucl(16),cyto(5),mito(2),golg(2)	KR (86-87, prob:0.614)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EA93	HTH CENPB-type domain-containing protein	Medium	11	1	156-177	WLKHFDKYTSQRRKGKYRICAF	nucl(15),cyto(10)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECC9	Uncharacterized protein	Medium	10.2	1	898-920	VESPNPRRSEHKLHAHRLRAKVS	nucl(21.5),cyto_nucl(14),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEC6	Uncharacterized protein	Medium	14.2	1	51-70	GNKTSPAKSKNQNQNPPFRH	nucl(22.5),cyto_nucl(13.5)	ARYAKRVKAGSIARRGYQDRKPSRKYGNKT (25-54, prob:0.832)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHA9	Uncharacterized protein	Medium	13.7	1	1-25	MFLEQVKRERKEREKREKRGEEEGE	nucl(21.5),cyto_nucl(12),mito(4)	KRERKEREKREKR (7-19, prob:0.877)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKV5	Uncharacterized protein	Medium	14.5	2	419-440, 474-495	KANEALSKHRRAKKTQLRQGGV, ASSSRCCSKCGKPGHNSRTCQI	nucl(13),cyto(8),mito_nucl(8)	R (429-429, prob:0.603)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EME4	Uncharacterized protein	Medium	13.1	2	252-275, 459-483	LEWLKHFDKHTKNRRKGKYRMLVL, LRTANEALSKRRRAKKTQLRQGGVL	cyto_nucl(11.5),nucl(11),cyto(10),mito(3)	KRRRAK (468-473, prob:0.682)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXY2	Uncharacterized protein	Medium	10.7	2	288-311, 1147-1168	RILGKLWKDWKKRVRSSTNSESMS, DEDMMPKRKTRRVRDPYAIDFS	nucl(12.5),cyto_nucl(9),mito(8),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2W1	Uncharacterized protein	Medium	12.9	1	121-151	HPEPIGPVRPKKKSKKELKKIRKAQEAKEKG	nucl(17.5),mito_nucl(10),cyto(8)	VRPKKKSKKELKKIRKAQEAKEKGWFKQNVKPDLRK (128-163, prob:0.996)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F538	Uncharacterized protein	Medium	13.4	2	539-562, 570-597	SNPTRKLYDKYSRYDRKPRQTFTA, DCYFPGCKIKRCRYYKHTQEEKDRVKGE	nucl(23.5),cyto_nucl(13)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F757	CHY-type domain-containing protein	Medium	10.4	1	736-764	GGKGTRDKTKMSRKDKRKYRRIGGGVKKT	nucl(11),cyto_nucl(10.333),mito_nucl(9.333),cyto(8.5),mito(6.5)	EGGKGTRDKTKMSRKDKRKYRRIGGGVKKT (735-764, prob:0.988)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGK3	ORC_WH_C domain-containing protein	Medium	12.1	1	26-56	PTSAPSEDLPQRPKKRRKVGKTPKKAPELGE	nucl(15),cyto_nucl(12),cyto(7),mito(3)	RPKKRRKVGKTPKKA (37-51, prob:0.977)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJH7	Yippee domain-containing protein	Medium	11.4	2	13-32, 321-348	LPSFAFPFRRRKHSSSPTSS, DAEIAQKRRIRRVDRRKREMERERAASK	mito(17),mito_nucl(12.333),cyto_mito(9.833),nucl(6.5)	KRRIRRVDRRKREMERER (327-344, prob:0.919)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMT6	UPF0029 domain-containing protein	Medium	11.2	1	414-436	DEIGEKDRSKRKKSAKAIAEEKE	nucl(11.5),cyto_nucl(11.5),cyto(10.5),pero(3)	RSKRKKSAK (421-429, prob:0.805)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZ27	Uncharacterized protein	Medium	11.2	1	35-55	CETGGRPPKKAEKRQRGWVWA	nucl(11.5),mito_nucl(10),mito(7.5),cyto(7)	PKKAEKR (42-48, prob:0.657)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1J4	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.3	1	31-56	IVTPNACTECRKKRAKCDGETPCARC	nucl(23.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2R7	Ubiquitin-like modifier HUB1	Medium	14.3	1	1-58	MAGLKLKKRARSRSPERDTDKTYRKRSQSPRRDRKRSPVRERRREREREPERERRPSP	nucl(24),cyto_nucl(14)	KLKKRARSRSPERDTDKTYRKRSQSPRRDRKRSPVRERRREREREPERERRPSPPR (5-60, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9W7	VPS37 C-terminal domain-containing protein	Medium	10.2	1	228-256	DWVRKYRESKKVYYSRRERKDRWDEGRVG	nucl(20),cyto_nucl(13.5),cyto(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5C5	Uncharacterized protein	Medium	10.3	1	10-35	NTQQVPFPQAKDRKRKRAQEDEGGSP	nucl(19.5),cyto_nucl(11.5),mito(3),cyto(2.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7M5	J domain-containing protein	Medium	12.6	1	515-538	VSPLCFQHRHVRRWIRNHSDQDPF	nucl(19),mito(2),cyto(2),cyto_mito(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGJ3	Uncharacterized protein	Medium	11	1	82-104	EDVLEREQRKRKRGEPAQLRGSG	cyto(13),cyto_nucl(13),nucl(11)	RKRKR (90-94, prob:0.691)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIA8	SRP54 domain-containing protein	Medium	10.5	1	234-257	GDESHKKIRNAKARLKKGRKWDAE	cyto(20),cyto_nucl(11.833),cyto_mito(11.833),nucl(2.5),mito(2.5)	PGGKVSRRARK (213-223, prob:0.727),HKKIRNAKARLKKGRK (238-253, prob:0.944)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EN04	Uncharacterized protein	Medium	13.7	1	6-39	DKEERKREYNRLAQREFRRRRKEHLKNLEQAQKE	nucl(22),cyto_nucl(13.5),cyto(3)	REFRRRRK (20-27, prob:0.753)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EP95	Uncharacterized protein	Medium	13.4	1	261-286	KGEERVGKMKRKTKNAGMKDDAKKNR	nucl(22.5),cyto_nucl(15),cyto(4.5)	RVGKMKRKTKNAGMKDDAKKNR (265-286, prob:0.89)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERE9	Uncharacterized protein	Medium	11.5	1	11-36	TPNRIEKNTKKAKKGGKKVANSLRGI	nucl(13.5),cyto_nucl(11.5),mito(7),cyto(6.5)	KNTKKAKKGGKK (17-28, prob:0.916)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7I4	W2 domain-containing protein	Medium	13.1	1	137-165	SGFILKTQPKKGKKDKSEKKAARKAKADK	nucl(17.5),cyto_nucl(11),mito(6)	QPKKGKKDKSEKKAARKAKADKGE (144-167, prob:0.994)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E648	Chitinase	Medium	10	2	634-654, 1685-1707	GWGGRKKSCSGKKKYNYCCAD, EREETWRKRDQLRAGRGRGRGRG	extr(23),mito(2)	RKRDQLRAGRGRGRGRGR (1691-1708, prob:0.953)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFE9	Glycylpeptide N-tetradecanoyltransferase	Medium	10.4	1	45-72	GATDTPATGKKKKSKRKKIKAALGVGAS	cyto(13.5),cyto_nucl(13),nucl(9.5),pero(3)	GKKKKSKRKKIKA (53-65, prob:0.988)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUA1	Uncharacterized protein	Medium	11.2	1	1-28	MSRLGQSCYQKRKDKKDMTIIRRRHVRG	nucl(16),mito(8),cyto(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EY43	Uncharacterized protein	Medium	12.6	1	25-47	WKGPGFTKKAEPKPKKTEPEEEK	nucl(17.5),cyto_nucl(12),cyto(5.5),pero(3)	KDHAGRPGWKGPGFTKKAEPKPKK (17-40, prob:0.897)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F787	Uncharacterized protein	Medium	13.8	1	56-76	DDSEKRELRRQRRMKVREGME	nucl(22),mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8S9	Uncharacterized protein	Medium	11.1	1	18-40	EETSSQKSISKRKRSQDSADDNM	nucl(23),cyto_nucl(14.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E517	Uncharacterized protein	Medium	11.3	1	230-253	LPCPHPGCDKKFQRKEHLKRHEVI	nucl(24),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EC06	C2H2-type domain-containing protein	Medium	14.3	1	833-852	YDKCREPKSFKRKADWVRHE	nucl(23),cyto_nucl(13.5)	KQKTKAAIKRAK (893-904, prob:0.691)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ED04	Uncharacterized protein	Medium	10.6	1	470-490	SSGFFGGKKMQKKRNDDEDED	nucl(15),cyto(6),mito(3),plas(1),pero(1),golg(1)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEB8	60S ribosomal export protein NMD3	Medium	13.2	1	411-441	DVMLVKKLYARKKKSKNRNWRLKRMGKEEGE	nucl(14),cyto(9),pero(4)	LYARKKKSKNRNWRLKRMGK (418-437, prob:0.969)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKF8	Threonyl-tRNA synthetase	Medium	10.1	1	442-462	DSPRSLKKKISEAKRKRYGAI	mito(14.5),mito_nucl(12.333),nucl(9),cyto_nucl(6.833)	KKKISEAKRKR (448-458, prob:0.732)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQW4	Uncharacterized protein	Medium	13.1	1	462-486	LRRANEVLSKRRRAKKIQLRNGGVL	nucl(19),cyto_nucl(13),cyto(5)	KRRRAKK (471-477, prob:0.765)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETH5	Uncharacterized protein	Medium	10	1	186-211	GEQAQQPKQKKEKKEKAPKPQKAPAP	cyto(20.5),cyto_nucl(12.333),mito_nucl(3.833),mito(3.5)	KERLKKEK (131-138, prob:0.666),KQKKEKKEKAPKPQKAP (193-209, prob:0.953)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZV9	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.5	1	3-35	DSEPLKRKRARIACEPCRDRKRKCDGGQPCDSC	nucl(25.5),cyto_nucl(13.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4G9	Uncharacterized protein	Medium	13.6	1	212-233	NTKPTRPPAKKLKKSNTHTKSS	nucl(14),mito(9),cyto(2)	PAKKLK (219-224, prob:0.645)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5W3	Potassium transport protein	Medium	12	2	51-75, 504-526	GEVVGRQKEERRRERMRSGSREAVE, PSHHTSRIGRRMKKIKRSFSGRE	plas(21),mito(2),E.R.(2),vacu(2)	ERRRER (60-65, prob:0.664),RRMKKIKR (513-520, prob:0.695)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F621	Lysophospholipase NTE1	Medium	13.1	1	228-248	ASADIHPRRPRPKRLTTTSVH	nucl(19.5),cyto_nucl(13),cyto(5.5)	AGRRRR (363-368, prob:0.685)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F694	WD_REPEATS_REGION domain-containing protein	Medium	11.6	2	95-115, 432-456	KEEAARIRSKRQKKGDSSIVE, VYGATDKFRQNRKKVFKGHNNAGYA	cyto(15),cyto_nucl(11.5),nucl(6),pero(5)	RSKR (102-105, prob:0.628)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E8I0	Uncharacterized protein	Medium	12.3	1	783-802	DDAVKKEREKCEKLLRTYKE	nucl(16),cyto_nucl(12.5),cyto(7),cysk(2)	KERRKLIQEEKERKEHRRRK (528-547, prob:0.898)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBR1	Uncharacterized protein	Medium	11.5	1	2-26	AEVKGSRINAKKRANNKSQREIPEY	nucl(25.5),cyto_nucl(13.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDZ4	Uncharacterized protein	Medium	12.1	1	198-217	TQESRKFPKHQRQNRYDDTS	nucl(13),cyto(9.5),cyto_mito(6.5),mito(2.5)	AKGKKQVR (269-276, prob:0.686)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEL1	PUM-HD domain-containing protein	Medium	11.2	1	94-113	LEKKKIEYERLREQKRRFEA	nucl(24),cyto_nucl(14.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWE6	Uncharacterized protein	Medium	10.5	1	159-183	QSASPVSSQRPRRHRPPANSSYQSS	nucl(22.5),cyto_nucl(14),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1D6	Uncharacterized protein	Medium	10.8	1	116-146	QNDKADSEDKRRQRRIRRQRKKEKLMEDASH	nucl(9),cyto_nucl(8.5),cyto(6),plas(5),mito(2),golg(2)	KRRQRRIRRQRKKEK (125-139, prob:0.966)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBR0	Uncharacterized protein	Medium	13.7	1	10-40	ENEREEKGVKSEKKRKYRSPKEIKPKTESRD	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	KGVKSEKKRKYRSPKEIKPK (16-35, prob:0.943)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EG12	Uncharacterized protein	Medium	12.6	1	31-59	CSGCLGLKRKARKKQKCVRPQVKVTRCAK	mito(14),nucl(12)	KRKARKKQ (38-45, prob:0.783)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EG44	Uncharacterized protein	Medium	10.6	1	57-79	QAYRDCKKQWIEQRKEAKRKAGW	nucl(15),mito(7),cyto(2),pero(1),golg(1),vacu(1)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJV6	Eukaryotic translation initiation factor 4C	Medium	14.9	1	1-26	MPKNKGKGGKNRRRGKNENDNEKREL	nucl(18),mito(6),cyto(2)	KNKGKGGKNRRRGK (3-16, prob:0.935)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EL02	Uncharacterized protein	Medium	11.4	1	171-190	SSSSRDKTSGSREKKRRLDL	nucl(23.5),cyto_nucl(13.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENE6	Uncharacterized protein	Medium	10	1	80-104	NLWPKHAARTRKKIQKKIRASLPLY	mito(20),nucl(5)	KHAARTRKKIQKKIR (84-98, prob:0.846)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENT6	Uncharacterized protein	Medium	14.5	1	122-148	DDGPMSRKTKGKRRSARGGKGRKAGIR	nucl(17.5),cyto_nucl(11.5),pero(5),cyto(4.5)	RKTKGKRRSARGGKGRKAGIRGPRKA (128-153, prob:0.998),KKPRRK (584-589, prob:0.719)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQD4	Uncharacterized protein	Medium	10.6	1	4-27	SSSSVSPRTSKPRNYPRNSRGNED	nucl(20.5),cyto_nucl(12),mito(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUV6	J domain-containing protein	Medium	10.7	1	87-106	NYTYERKRERRYSYRRGSSA	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXE7	Mediator of RNA polymerase II transcription subunit 14	Medium	10.7	1	888-913	SFEIKMCHRKQKPWWLVRRTEKTERA	nucl(16),plas(5),cyto(3),mito(2),cyto_pero(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZ21	RRM domain-containing protein	Medium	10.3	1	111-135	ERGGGSRRSPRRRSNSPRRGRGDYT	mito(14),nucl(6),cyto(4),extr(2)	PARRDGGRDSGRERGGGSRRSPRRRSNSPRRGRGDYTPRKDDRDRRDR (99-146, prob:0.995)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1G5	RRM domain-containing protein	Medium	11.3	1	136-156	DTHQHEKPGKKVKKHRGYAFV	nucl(11.5),mito(9),cyto_nucl(9),cyto(5.5)	PGKKVKKH (143-150, prob:0.729)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E400	25S rRNA adenine-N(1) methyltransferase	Medium	10.8	1	259-280	RLQSPSMKPRQWKKEEIRAGGS	nucl(12),mito_nucl(11.833),mito(10.5),cyto_nucl(8.333)	RPPTIKKPAQRI (16-27, prob:0.681)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6L4	Uncharacterized protein	Medium	13.6	1	356-376	AAKAKKAAPPPPKPKPSRLSG	nucl(15),mito(8),cyto(4)	AKAKKAAPPPPKPKPSR (357-373, prob:0.912)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EYI4	Uncharacterized protein	Medium	10	1	297-318	IFKIGKKKGKIENEQREMRKKE	mito(13),mito_nucl(12.166),nucl(10),cyto_mito(8.666),cyto_nucl(7.166)	IGKKKGKIENEQREMRKKEKVEGREWERRF (300-329, prob:0.906)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5S1	J domain-containing protein	Medium	11.7	1	225-244	PKEQMKRKFKCLNCGQKRGM	nucl(14.5),cyto_nucl(12),cyto(8.5),mito(1),plas(1),pero(1),golg(1)	KRVAKAKVKK (169-178, prob:0.703)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5V8	Uncharacterized protein	Medium	10.1	1	14-39	STLKVTDWARHRTRRKFPERNGYCAT	nucl(19),cyto_nucl(12),mito(3),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E718	Rab-GAP TBC domain-containing protein	Medium	11.3	1	386-406	DKPIRFPPKSNKVKRFVRKGI	nucl(11),mito(11),mito_nucl(11)	PKSNKVKRFV (393-402, prob:0.664)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECA4	Non-specific serine/threonine protein kinase	Medium	12.2	2	534-553, 835-857	GILRRFSTRRRKDPPSSDKT, EAERSPQNPRTPRRARGPENSYS	cyto(9.5),cyto_nucl(9),mito(8),nucl(7.5)	GHARRESIQARRAR (691-704, prob:0.65)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIL3	N-acetyltransferase domain-containing protein	Medium	10.1	1	185-206	WTEGGKEKKRVRHREWLLPRPV	mito(15),nucl(7),cyto_nucl(7),cyto(5)	KKRVR (192-196, prob:0.647)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKY5	Vacuolar import and degradation protein 21	Medium	11.2	1	1098-1121	AAPRRRTTTSQRVEKRRNQKHLAL	nucl(24.5),cyto_nucl(15)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMK8	Uncharacterized protein	Medium	13.8	1	175-203	ETVRAKSQERRDRLRKELKERREERRPIT	nucl(16),mito(3.5),cyto_mito(3.5),cyto(2.5),plas(2)	SQERRDRLRKELKERREERR (181-200, prob:0.861)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EN51	Casein kinase II subunit beta	Medium	13.2	1	76-108	PGPPPTLLPRRGKKGKRDKRGKKRRASEVEDLE	nucl(20.5),cyto_nucl(13.5),cyto(5.5)	PRRGKKGKRDKRGKKRR (84-100, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPX4	TPR_REGION domain-containing protein	Medium	10.8	1	675-700	RITPESDTKGKRKRPKKHLITIPFVQ	nucl(9.5),cyto_nucl(9),cyto(7.5),mito(4),pero(2),golg(2)	KGKRKRPKK (683-691, prob:0.911)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVC6	Uncharacterized protein	Medium	10.6	2	32-51, 520-539	QTRSDKDSPKPTKKVDHISQ, LLNAHRRKARHDEEERQKLC	mito(16),nucl(9)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EW46	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.4	1	127-152	GRKRSKVSRACDECRRKKIRCNANEP	nucl(18),cyto(4),mito(2),plas(2),cyto_pero(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EYV3	Ribonucloprotein	Medium	13.3	1	1-43	MGKDKSEKRDKKEKKEKRSEVDGVKKSSKKDKKVKLSEDNVAA	nucl(16),cyto_nucl(13.333),cyto(9.5),mito_nucl(9.333)	KSEKRDKKEKKEKRSEVDGVKKSSKKDKKVK (5-35, prob:0.99),AKKVLKSVKKAAKNKTLKRGVKEVVKALRK (92-121, prob:0.944)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6M3	Uncharacterized protein	Medium	11.6	1	196-218	SVQGKPKDKKWVPRMPNNKRPAT	nucl(17),mito_nucl(12.333),cyto_nucl(10.833),mito(6.5)	KDKKWVPRMPNNKR (202-215, prob:0.661)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5R4	Brix domain-containing protein	Medium	14.6	1	17-62	FKTGNKFKRQDLHIKQKKARDSDRRDIRFKRKREEDRDPELRRQRL	nucl(19),mito(5.5),cyto_mito(4.5)	KFKRQDLHIKQKKARDSDRRDIRFKRKREEDRDPELRR (22-59, prob:0.952)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECI6	Uncharacterized protein	Medium	11.6	1	475-501	SSAKSNRDAPPKKKPSPHPRPTPSIHI	mito(13),nucl(11.5),cyto_nucl(7.5)	NRDAPPKKKPSPHPRP (480-495, prob:0.861)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECP7	HET domain-containing protein	Medium	13	1	394-413	GSSACRRKRKGHYQSLQCWW	nucl(20),cyto(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDU8	Uncharacterized protein	Medium	14	1	5-26	KGTKVAKPKGAKPKGAKPKDYL	nucl(22.5),cyto_nucl(12),mito(3)	RAKGTKVAKPKGAKPKGAKPK (3-23, prob:0.962)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHE0	Uncharacterized protein	Medium	12.6	2	41-60, 272-301	KGPIHPLKHLVRKQFRRNVW, KERELWKQERGLRRHNKKLAKLEKKFQDRV	mito(14),nucl(8.5),cyto_nucl(6.5),cyto(3.5)	RGLRRHNKKLAKLEKK (281-296, prob:0.812)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIV1	Uncharacterized protein	Medium	10.9	1	64-83	QKILKEKEEKERLRKEKEEE	nucl(10),cyto_nucl(10),cyto(8),pero(6)	KEKEEKERLRKEKEEEEKKA (68-87, prob:0.808)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKA8	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.6	2	2-27, 52-74	VFCGRPSKGCHACRAKKTKCDTIPTG, ETKSVIKKAKVKHEKAKQKTVGS	nucl(16),cyto_nucl(10),mito(9)	KKAKVKHEKA (58-67, prob:0.688)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERD1	Uncharacterized protein	Medium	13.2	1	7-29	MTYQAIPRPKKPKSHARGATIPG	nucl(13),mito(9),cyto(3)	PKKPK (15-19, prob:0.672)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F452	Uncharacterized protein	Medium	13.2	2	252-275, 459-483	LEWLKHFDKHTKNRRKGKYRMLVL, LRTANEALSKRRRAKKTQLRQGGVL	nucl(12),cyto_nucl(12),cyto(10),mito(3)	KRRRAK (468-473, prob:0.682)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4M4	J domain-containing protein	Medium	10.8	2	58-83, 647-670	DLIDSQRRAQRRKQRKIKRMIAMVVG, MQAMKTGAPPKKKKQAVRDSSDED	cyto(9.5),cyto_nucl(6.5),plas(5),E.R.(4),golg(3),nucl(2.5)	RRAQRRKQRKIKR (64-76, prob:0.853)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9E5	Uncharacterized protein	Medium	11.5	1	145-169	ATTLESRSKRCVRVKKSHKKGDIVV	mito(12),nucl(4),cyto(4),cyto_nucl(4),pero(3)	ARGGGRVGGGGISKRRAG (19-36, prob:0.739),GPRGHGRG (71-78, prob:0.638)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E469	Uncharacterized protein	Medium	11.9	1	582-609	KSDKSDKSDKSDKSKKSRSNRISRSGFA	nucl(16.5),cyto_nucl(12.833),cyto(8),cyto_mito(4.833)	KSDKSDKSDKSDKSKKSRS (582-600, prob:0.764)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9V8	Uncharacterized protein	Medium	14.4	3	56-75, 361-384, 419-438	LWAHRFVKRCTKLKTCFSRV, LRKANETLSKRRHVKKTQLRQGGV, STNRCCSKCGKTGHNSRTCS	nucl(16.5),cyto_nucl(11.5),cyto(5.5),pero(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHJ5	Uncharacterized protein	Medium	13.9	1	114-137	QPDPKQWLRVKRKPEKPAIRRVYN	nucl(16),mito(7),pero(2),golg(2)	KLKPKNSHKSQPDPKQWLRVKRKPEKPAIR (104-133, prob:0.916)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPD0	Uncharacterized protein	Medium	12.7	1	28-66	RGEERKEKENQKKWGKKERKREKKREVRRKAKQRKGNKK	nucl(14),mito(8),cyto_nucl(8)	KEERGEERKEKENQKKWGKKERKREKKREVRRKAKQRKGNKK (25-66, prob:1)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPQ6	UDENN domain-containing protein	Medium	10.4	1	192-216	DEAEEKVKRKRLRRAKKEARAALFE	mito(11),nucl(7.5),cyto_nucl(6.5),cyto(4.5),plas(2)	KVKRKRLRRAKKEAR (197-211, prob:0.968)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2F6	Reverse transcriptase domain-containing protein	Medium	13	1	57-82	RTAKTPVSKRSLRRTVRKAKRAFYIS	nucl(13),mito(6),cyto(5),plas(2)	SKRSLRRTVRKAKR (64-77, prob:0.762)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4I1	Uncharacterized protein	Medium	12.1	1	129-152	YISTRIPRTRKWPGRKRASTPPAT	nucl(16.5),cyto_nucl(13),cyto(6.5),mito(2),pero(2)	RKWPGRKR (138-145, prob:0.681)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6N0	Uncharacterized protein	Medium	10.6	1	616-651	VSQPERFGEEKRRKGERKKERRKERGAEYSKKRNVW	nucl(8.5),cyto_nucl(8.5),mito(8),cyto(7.5)	KERRAMRSGKRKIAAVSQPERFGEEKRRKGERKKERRKERGAEYSKKR (601-648, prob:0.999)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F851	Uncharacterized protein	Medium	11.8	1	565-586	DDNGTTRSSKKKRRSSLSDLKS	nucl(17),cyto(8)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E955	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	Medium	10.6	1	374-401	SKWSSGKRGTHFRKKRRWERIRHIISTT	mito(10.5),mito_nucl(10.5),nucl(9.5),cyto(6)	GKRGTHFRKKRRWER (379-393, prob:0.887)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECX3	Uncharacterized protein	Medium	10.5	1	322-346	SSAPQRTRDRDSRDDRDRHHQRRRN	nucl(21),cyto_nucl(13.5),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJL3	Uncharacterized protein	Medium	10.1	1	270-292	GGYLNIPKTRNRKPRQSNEEFII	nucl(18.5),cyto_nucl(11),mito(4),cyto(2.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELA9	Uds1 domain-containing protein	Medium	10.7	1	1-22	MPSRGDREPRKNRSRTSQDLGF	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENE4	Uncharacterized protein	Medium	10.1	2	38-63, 95-114	TSTSEQHISKKSKRARRDSCSLSPPP, MKEKEFKREKLEERKVKREE	nucl(13.5),cyto_nucl(9.833),mito(8.5),cyto_mito(7.333),cyto(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EX05	Uncharacterized protein	Medium	13.9	1	313-332	QPPSRASRPPPRKVIKPISP	nucl(16),mito(7),cyto(4)	NRGPKKPRR (392-400, prob:0.88)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5I1	Uncharacterized protein	Medium	14	2	213-248, 259-285	EGVAKKKKNAPGPKGPNPLAMKKKKKVEGDNMKPNA, EADGSEPVKRKRKRLHSKKKSEDVADG	mito(13),plas(8),cyto_mito(8),mito_nucl(8)	KFRQGIKSGRASGSLKRKR (175-193, prob:0.718),AKKKKNAPGPKGPNPLAMKKKKKV (216-239, prob:0.977),VKRKRKRLHSKKK (266-278, prob:0.967),EKKEREGKQRFSFFGRKKKS (1050-1069, prob:0.817)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7FA16	Uncharacterized protein	Medium	11.1	1	261-288	HQRFHERGGMKRKRLHRQRWRNNFMEGF	mito(11),nucl(8),cyto(7)	GGMKRKRLHRQR (268-279, prob:0.795)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E988	Uncharacterized protein	Medium	12	2	183-211, 239-262	ANTSSEVKKEKKKKKERKGEEGRNLQLRP, GDRWTAWRKANARKTKNAEKRGLS	mito(20.5),cyto_mito(13.5),cyto(5.5)	KKEKKKKKERKGEE (190-203, prob:0.987),RWTAWRKANARKTKNAEKRGLSGRKKK (241-267, prob:0.988)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9Y1	WD_REPEATS_REGION domain-containing protein (Fragment)	Medium	10.8	1	179-198	ARPTPNPERHPDKRNHRFFD	cyto_nucl(12.5),cyto(11.5),nucl(10.5),pero(3)	RERKGLGAKNGTGRGRK (907-923, prob:0.743)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAJ1	Uncharacterized protein	Medium	13.8	2	92-118, 225-251	IPEFSDKWKKLKNKYTRITPQDIRNKM, AYQGRDRGRNRRYSNDKQRPRSTSSNR	nucl(14.5),cyto_nucl(11),cyto(6.5),pero(6)	KKKGLPPPTSGRK (280-292, prob:0.693)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDS1	Uncharacterized protein	Medium	14.5	2	127-150, 411-432	DFLQPIRKTIKKRENKRLDWERYI, VNSAIGKKKPPPPPPKRLGSSN	mito(14),nucl(8),cyto_nucl(6.5),cyto(3)	KKR (137-139, prob:0.638),KKKPPPPPPKR (417-427, prob:0.813)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFB8	DNA polymerase	Medium	10.7	1	45-68	MAGLWKDETRRRKSKMPNAPAGSS	nucl(21.5),cyto_nucl(13),cyto(3.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFM1	Uncharacterized protein	Medium	13.7	1	463-485	TSINGERRKALSRKRNILKTGSN	nucl(21.5),cyto_nucl(13),cyto(3.5)	RKALSRKRN (470-478, prob:0.697)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ESW7	Uncharacterized protein	Medium	12.2	1	157-178	GPSGRNPLRRKKVEIGKPYRTE	nucl(18.5),cyto_nucl(13.333),cyto(7),cyto_mito(4.833)	KGKAPFEGPSGRNPLRRKKV (150-169, prob:0.817)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ET13	Uncharacterized protein	Medium	12.9	1	40-91	SKEYSRQKDKDQGRDRERRDRSRDRERNRDEGRDRERRDRSRERERDRHSSS	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	DKDQGRDRERRDRSRDRERNRDEGRDRERRDRSRERERDR (48-87, prob:0.965)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F394	Uncharacterized protein	Medium	14.1	1	23-114	TSTSPSPSPKRNKNLKSHKRNNHNNNNNNNNNNKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKNNNNNNNNNNNNNKI	nucl(14),mito(12),cyto_nucl(8.5)	KRNKNLKSHKR (32-42, prob:0.684),NNKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK (54-99, prob:1)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F482	T5orf172 domain-containing protein	Medium	11.9	2	97-118, 423-442	EVDQKKNKGKQRQTGEDNRGRR, KRVNCGKCKTCGKEHREWFE	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7C9	C2H2-type domain-containing protein	Medium	14.2	1	489-516	KVETNERRKFEWRNNKQNNSQKHFRDPL	nucl(23),cyto_nucl(14)	KRSR (485-488, prob:0.619)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EC04	Serine/threonine-protein phosphatase 2A activator	Medium	12.5	1	19-46	IPNLRDRLPKLEPRKKRNPPSNPLPVPE	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(2)	KLEPRKKR (28-35, prob:0.728)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECC5	WLM domain-containing protein	Medium	14.5	2	170-205, 351-371	GTFRSRGGGKKRKAKPKITYKEQKERRIRKKFGVNG, AELSKSQKRSQNKNTEKNTSV	nucl(15),mito(6),cyto(6),cyto_mito(6)	SRGGGKKRKAKPKITYKEQKERRIRKK (174-200, prob:0.995)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIR4	Uncharacterized protein	Medium	13.5	1	968-993	GLRGLGKKLSEKRKEQRNAKLRATIS	nucl(22.5),cyto_nucl(14),cyto(4.5)	KKLSEKRKEQRNAK (974-987, prob:0.767)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJ96	C2H2-type domain-containing protein	Medium	13.5	2	211-234, 587-611	VKTKSELKKHDLRHKKPFVCKYPG, CEKFKGRPCELKKHMKRHERPYGCT	nucl(25.5),cyto_nucl(13.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETI3	Uncharacterized protein	Medium	13	2	435-454, 922-947	GDLNKKRPNRWKRYELPWGT, ELQPHLPKQPSKQRRQNLINKPPSLP	nucl(15),cyto(6),mito(2),pero(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1P1	Uncharacterized protein	Medium	10.5	1	206-229	STQAAKGKEKRGRKCKGKPEVGEE	cyto(11),cyto_nucl(11),nucl(9),cysk(5)	AKGKEKRGRKCKGK (210-223, prob:0.902)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5A7	Uncharacterized protein	Medium	14	1	274-296	HSNSTKKRKSSTPNNRSPRNESD	nucl(23),cyto_nucl(15.5)	SKVREEALRKRKESEEAAKVARASAAKAAEERRRESEREAIAAKAERMRKEKSEERKAEEEQKQAARKQK (361-430, prob:0.97)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4H3	40S ribosomal protein S1	Medium	13.4	1	1-28	MAVGKNKRLSKGKKGLKKKTLDPFTRKD	nucl(20.5),cyto_nucl(13),cyto(4.5)	KNKRLSKGKKGLKKK (5-19, prob:0.948)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4V7	Stn1 domain-containing protein	Medium	13.3	2	210-235, 258-315	SEEEIERWKRRERRRKAREVEREGQG, DSIKEEREKQQQERKRKDNPHHLPTIATKPAHPPRETSPNKRNPKPPTTKKRILPIAL	mito(14),nucl(10.5),cyto_nucl(7)	RWKRRERRRKAREVEREGQGTKRIDKREGSRLKDGSGRKENIDSIKEEREKQQQERKRKDNPHHLPTIATKPAHPPRETSPNKRNPKPPTTKKR (216-309, prob:0.993)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7K0	DNA helicase	Medium	10	1	2-21	SSPAGRRQRNSQSATPRRTS	nucl(18),mito(9),cyto_nucl(9)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFC1	40S ribosomal protein S9	Medium	12.2	1	159-186	SSPFGGGRPGRVRRKKAKASEKKDDDAE	nucl(13),mito(9),cyto_nucl(9)	GRPGRVRRKKAKASEK (165-180, prob:0.96)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPP4	Uncharacterized protein	Medium	14.9	2	28-50, 651-670	KAQAVNSRKRPIKPQPSADKDTI, LSRCINKKTQELRDKKHKVA	nucl(18.5),cyto_nucl(13),cyto(6.5)	RKKARPDPRSSAAKLRA (59-75, prob:0.775)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPR1	KIX_2 domain-containing protein	Medium	13.3	2	15-34, 125-144	MPQQQQQQQHQQQQQQQQQQ, DKASYKNRMNEKQRELHQAR	nucl(23.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZ19	Ribosomal_L18e/L15P domain-containing protein	Medium	10.3	1	151-183	GFGPHKHKKPYVESKGRKFEKARGRRRSRGFKV	cyto(11),nucl(8),mito(8),mito_nucl(8)	KHFGFGPHKHKKPYVESKGRKFEKARGRRRSRGFKV (148-183, prob:0.993)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5K5	Uncharacterized protein	Medium	13.9	1	290-314	ITKSDVKPQPEKRKSWFGRKLSKNK	nucl(22.5),cyto_nucl(13),cyto(2.5)	EKRKSWFGRKLSKNK (300-314, prob:0.781)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F659	Uncharacterized protein	Medium	13.3	2	4-24, 247-266	FSKIKGSKKAAQQHKEKTIAD, VAPPKSKKSRWSLIGKHDVS	nucl(23),cyto_nucl(13.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6K9	RPA43_OB domain-containing protein	Medium	12.1	1	8-61	QSTTAGTSPKKHKSKSEKKHKSTDSEKKRKRENGEEGHRSKKHRSEKTAPTSSS	nucl(16.5),cyto_nucl(13),cyto(6.5),mito(4)	PKKHKSKSEKKHKSTDSEKKRKRENGEEGHRSKKHRSE (16-53, prob:0.994)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EF34	KH domain-containing protein	Medium	13.4	1	2-52	DDTERRTAKRSRFDQKEPEPKRTSRFDRRSRSPPARKVESRRSRSPLARRT	nucl(21.5),cyto_nucl(13.5),cyto(4.5)	TAKRSRFDQKEPEPKRTSRFDRRSRSPPARKVESRRSRSPLARRTSRSPAPDSAKK (8-63, prob:0.988)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EK56	CCHC-type domain-containing protein	Medium	12.6	1	186-209	NQTGLSVKKKKKRKENNLCFTCGK	cyto(14.5),cyto_nucl(12.5),nucl(9.5)	KKKKKRK (193-199, prob:0.878),PFAAKGKKQVRFGTKKQVRFGTK (222-244, prob:0.795)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELV8	Uncharacterized protein	Medium	11.3	2	1187-1213, 1404-1425	NENCSRRSEKSKPTKNTSRPSPAQPRP, EDYLNGKNRHRKEKDVDENQDE	nucl(16),cyto_nucl(12.5),cyto(7),cysk(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPS4	Uncharacterized protein	Medium	10.1	1	414-439	VDQFKMVPGNKKRSRSTRREPSTSCN	nucl(20.5),cyto_nucl(14.5),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EX46	Uncharacterized protein	Medium	11	1	207-228	EAKGKMEKIKKKEKMNKSTSIE	nucl(13),mito_nucl(11.833),mito(9.5),cyto_nucl(8.333)	KAQRPKDSSSPNGEKRLRKENKRTEAKGKMEKIKKKEKM (183-221, prob:0.989)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F837	Uncharacterized protein	Medium	11.3	1	114-145	ATNKQRSKRTTDGPCRKRTRHRCKPFLFLPQT	nucl(23.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8R4	Uncharacterized protein	Medium	13.7	1	4-26	ITLNRTKKRKVGAKSPRRNATSV	nucl(21.5),cyto_nucl(12),mito(4)	KKRKVGAKSPRR (10-21, prob:0.808)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E436	ATP-dependent RNA helicase dbp8	Medium	12.9	1	51-71	SLDSQASRKRRKTSQVLEDGD	nucl(18.5),cyto_nucl(13),cyto(6.5)	GGKRKRGMKKLS (529-540, prob:0.892)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECS4	Uncharacterized protein	Medium	10.5	1	203-226	IMLASKPSFPRKKRRSQLSEGVSP	nucl(22.5),cyto_nucl(14),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJ90	60S ribosomal protein L44	Medium	10.2	1	2-31	VNVPKTRRTYCKGKDCRKHTQHKVTQYKAG	nucl(14),cyto(8),mito(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4W2	Uncharacterized protein	Medium	13.5	1	4-26	LGTSTNKKGRSRKFSINEDIRKP	nucl(23),mito(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAF0	Uncharacterized protein	Medium	10.7	1	152-173	PGSTRRPKSSDGKKRPNSVHFE	nucl(22),cyto_nucl(13.5),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHI5	Uncharacterized protein	Medium	12	1	78-105	GDKDSTSNKSKEKKAKKSKFSPNSTAVS	nucl(10),mito(5),cyto(4),plas(3),extr(3)	SKEKKAKKSK (87-96, prob:0.804)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKG0	Uncharacterized protein	Medium	11.9	1	426-448	GSEAKSKSKPGFKKHFSKPSFSN	nucl(14.5),cyto_nucl(14),cyto(8.5)	SKSKPGFKK (431-439, prob:0.667)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWD6	Uncharacterized protein	Medium	14.9	1	41-68	VWNHAKRRTGPRWRLHPKPNRRAEVKDP	nucl(18),mito(5),cyto(3)	AKRRTGPRWRLHPKPNRRAEV (45-65, prob:0.886)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F051	Uncharacterized protein	Medium	11.8	1	2-28	ASPAIPQKRTYRHKSHSEELKNKRICT	mito(14),nucl(10),cyto(2)	K (207-207, prob:0.603)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0W3	Uncharacterized protein	Medium	11.4	1	125-146	AVNYFAKAVRRKRNSSRSSENK	nucl(16),cyto(6),mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5R8	Replication termination factor 2	Medium	13.3	1	192-211	LTHSLKKAPGGKKKRKHAVE	nucl(22),cyto_nucl(14.5),cyto(5)	LKKAPGGKKKRKH (196-208, prob:0.959)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6S5	PAS domain-containing protein	Medium	10.4	1	455-478	GSVFREERNERREKRRKTGGMGGN	cyto_nucl(10.833),nucl(10),cyto(9.5),cyto_mito(6.666),extr(4)	KRRLGKRKETGRSLGSVFREERNERREKRRKT (441-472, prob:0.93)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F828	Uncharacterized protein	Medium	12.4	1	73-96	TRISKFSKAYKKGQKRRREAEEAG	mito(14),nucl(11)	KAYKKGQKRRR (80-90, prob:0.809)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E634	Uncharacterized protein	Medium	13.1	1	70-97	QSPTKSKTPKGSSKKKQKRSKSGIDSDD	nucl(21),cyto_nucl(15),cyto(5)	PKKRQSPTKSKTPKGSSKKKQKRSK (66-90, prob:0.987)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7L0	Response regulatory domain-containing protein	Medium	12.1	2	2-25, 429-451	LSSLERKRIREVRRYYKRSPDDPP, MQNNPQQRRRVRKTDRSIMKRCF	plas(16),nucl(6),cyto(2),mito(1),golg(1),vacu(1),cyto_pero(1)	KKLKKDKR (579-586, prob:0.723)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9P1	CCHC-type domain-containing protein	Medium	13.2	2	205-228, 412-436	LEWLKHFDKHTKNRRKGKYRMLVL, LRTANEALSKRRRAKKTQLRQGGVL	nucl(11.5),cyto_nucl(11.5),cyto(8.5),mito(4)	KRRRAK (421-426, prob:0.682)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBP7	Uncharacterized protein	Medium	14.3	1	139-161	ENLEHSRKKRRPSEDKKRRVSNI	nucl(23.5),cyto_nucl(14)	RKKRRPSEDKKRR (145-157, prob:0.916)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFG8	NDT80 domain-containing protein	Medium	13	1	384-405	QPPTPSQRTKRNSSHNRPPIPK	nucl(20),mito(3),cyto(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHW3	RING-type domain-containing protein	Medium	10.2	1	142-166	FNTPRPPRRNDPPPRRNHSPPRQRY	nucl(13),mito(10),cyto(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EK97	WD_REPEATS_REGION domain-containing protein	Medium	11.6	2	379-402, 404-440	AHMPEIRRIKRHRHVPKVIKKAGE, KSEELKAIKRRQENERKHTKKQFSKRRAEREKMVLAN	mito(17),mito_nucl(12.5),nucl(6),cyto(3)	RRIKRHRHVPKVIKKAGEIKSEELKAIKRRQENERKHTKKQFSKRRAERE (385-434, prob:0.986)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPY4	Uncharacterized protein	Medium	14.2	2	464-485, 519-539	RANEALSKRRHTKKIQLCNGGV, SSTSRCCSKCGKTGHNSRTCQ	nucl(18),cyto(4),mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ET97	Uncharacterized protein	Medium	14.7	3	1-24, 791-815, 990-1018	MLSSLLRPKKARRRVQEIQSPFSS, NGSPPKQSKATPRKKPHDRNLSTTT, EPSIAKWREAKGDKKKKRPGSANLSQTKS	plas(18),nucl(5),mito(3),cyto_nucl(3)	KWREAKGDKKKKRP (995-1008, prob:0.93)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETY9	Uncharacterized protein	Medium	13.2	1	311-330	LHPKSEVKKSFARPKRPGRA	nucl(20),cyto_nucl(13.5),cyto(5)	KKSFARPKRPGRA (318-330, prob:0.858)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F593	Rho-GAP domain-containing protein	Medium	12.9	1	22-46	RSPLSAKSPKSPRSPFKFNTKKSQL	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	KHSNEKGRKTSGEKNQRRSPDIEKNQR (657-683, prob:0.771)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7P9	Nuclear cap-binding protein subunit 2	Medium	14.2	1	12-39	LDKPSAYYQGRNKKRRYERDGEDDRRER	nucl(23),cyto(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F887	Glutamine--tRNA ligase	Medium	11	1	21-46	MVSKAELKKRLAKRAKKAAQAKAKSE	cyto(13.5),cyto_nucl(13),nucl(11.5)	LKKRLAKRAKKAAQAKAKSEAPSKEAAAPKPKKAE (27-61, prob:0.995)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5G0	Ribosomal protein	Medium	10.5	1	90-109	LKKLNKNKKLIKKLARKYDA	mito(13),nucl(8.5),cyto_nucl(7.5),cyto(5.5)	NKNKKLIKKL (94-103, prob:0.726)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6A2	40S ribosomal protein S25	Medium	12.2	1	1-29	MAPANTGAKKQKKKWSKGKVKDKAQHAVI	nucl(11),cyto(9),mito(6)	AKKQKKKWSKGKVKDK (8-23, prob:0.939)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9K0	Uncharacterized protein	Medium	14.2	1	5-34	VTQNPAPKPESKSAKKKKAKTEAVEVQKPT	nucl(16.5),cyto_nucl(14),cyto(8.5)	KPESKSAKKKKAK (12-24, prob:0.888),NRGRGEYRGRGGRGRGGFRGDGQHRGGRGRGGPRGAPRAPRG (414-455, prob:0.988)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAF4	Tudor domain-containing protein	Medium	10.3	1	206-232	SDGPTRPAKVPKKIKAKKELDDGKKKW	cyto(15),cyto_nucl(13.833),nucl(10.5),mito_nucl(6.166)	GPTRPAKVPKKIKAKKELDDGKKKWQDFAAKGKFGKAGKK (208-247, prob:0.984)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAI9	Uncharacterized protein	Medium	12.2	1	28-49	VKDVKRRCLSLKPKAAKKKLEA	nucl(21),cyto_nucl(12.833),mito_nucl(12.333),cyto(3.5)	PKAAKKK (40-46, prob:0.674)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EB66	BZIP domain-containing protein	Medium	10.4	1	64-83	LTPAQSRRKAQNRQAQRAFR	nucl(20.5),cyto_nucl(13),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDY1	Uncharacterized protein	Medium	12.5	1	5-45	YKLERSYWGTHEKKKKKKKKKKKKKKKKKKKLGERKSQLVS	nucl(16),mito(10),cyto_nucl(9.5)	EKKKKKKKKKKKKKKKKKKKLGERK (16-40, prob:1)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIS8	HNHc domain-containing protein	Medium	14.9	2	5-28, 64-85	HRNTVPDRTKEANNKNKRKGNMSG, ISEIYARKRAWHRRKTLYLDMI	nucl(22),mito(2),cyto(2),cyto_mito(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKG6	Integrase catalytic domain-containing protein	Medium	10.1	1	300-326	IEYFKKFWGRQSTKRRNWFVRRHEGTK	nucl(18.5),cyto_nucl(11),pero(4),cyto(2.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPW8	Uncharacterized protein	Medium	14.3	1	11-31	GSDTKNSRSRQLEKRARAPSS	nucl(25.5),cyto_nucl(15)	TRKEKAKADAPRAK (102-115, prob:0.754)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ET44	Uncharacterized protein	Medium	11.2	1	892-911	QEKAREGRGKRKETRMGDVL	plas(17),nucl(3),cyto(3),cyto_nucl(3)	KRLPLKKRDVAAPKQPKAPVPPPQ (196-219, prob:0.825),KRKLAGKAFQEKAREGRGKRKET (883-905, prob:0.926)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F430	CUE domain-containing protein	Medium	13.5	1	640-665	VARQRKEANKGSRANHNRREGRARKM	mito(15),cyto(5),nucl(4),extr(2)	GGGRPRHITKKKPNKGK (305-321, prob:0.931),RGRGGRIRGQVRGGRGGGGGGGRG (602-625, prob:0.831),RQRKEANKGSRANHNRREGRARKMARGGF (642-670, prob:0.956)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E8U4	Uncharacterized protein	Medium	10.5	1	77-104	DNKFSAKQKRGEVRQRGKRKWHLEQGSE	mito(10),cyto_nucl(9),nucl(8.5),cyto(6.5)	AKQKRGEVRQRGKRK (82-96, prob:0.826)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECR8	Uncharacterized protein	Medium	14.5	1	146-166	VFGKIFGKKRKETPNKRQGVD	nucl(24.5),cyto_nucl(13)	KPARKKSTLKGVFGKIFGKKRKETPNK (135-161, prob:0.903)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIN2	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.1	1	228-249	RTAIACKYCRRRKIRCTGFNAD	nucl(23.5),cyto_nucl(15)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F612	Uncharacterized protein	Medium	14.1	1	258-277	INKSTKKDVRPKEMDRHLRS	nucl(23),cyto_nucl(14.5)	PQKPRK (566-571, prob:0.647)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6N8	SP-RING-type domain-containing protein	Medium	11.6	1	1049-1069	ADGTWRAKPEPQPSNKRKSTT	nucl(19),cyto(4),mito(2),plas(2),cyto_pero(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7A9	Uncharacterized protein	Medium	14.7	1	589-609	AIERKKAAKKARKEAERLEKE	nucl(18),mito(5),cyto(4)	RKKAAKKARKEAERLEKEALAKKNEPNK (592-619, prob:0.976)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGU2	mRNA-capping enzyme subunit beta	Medium	10.4	1	30-49	PSPQQPPRKRTRYTEPPIWA	nucl(21.5),cyto_nucl(13.5),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMT3	Nitrogen permease regulator 3	Medium	14.3	2	4-37, 202-224	RQRSHGKQSEQSKPNNSKKTQPKHSYNLKGRVFS, REDGFWKKPKKLKKGKEVANDGD	nucl(14),mito(9.5),cyto_mito(6.5),cyto(2.5)	KKPKKLKKGK (208-217, prob:0.891)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQG5	Uncharacterized protein	Medium	10.9	1	21-41	CDRRLKKCFAFMKKRANGKHV	nucl(22.5),cyto_nucl(13),cyto(2.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETH4	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.9	1	58-81	VSTACVACRKRKSKCDGNTPSCAA	nucl(22.5),cyto_nucl(13),cyto(2.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3U5	Uncharacterized protein	Medium	10	1	59-101	MSASRAKQSKRDEAIRRKIETDLSKKSKTTGRARQTRKAPPGT	mito(9),nucl(5),plas(5),cyto(4),pero(2)	KRDEAIRRKIETDLSKKSKTTGRARQTRK (68-96, prob:0.73)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F448	Integrase catalytic domain-containing protein	Medium	13	1	228-248	IEYFKKFWGRQSTKRRNCDSD	nucl(20),pero(3),cyto(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6Z6	Uncharacterized protein	Medium	11.6	1	446-473	ANNLRAIMKKRTIRKKGKRLVLKGHFHI	nucl(12),mito(8.5),cyto_mito(7.5),cyto(5.5)	MKKRTIRKKGKRL (453-465, prob:0.924)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9T2	Uncharacterized protein	Medium	11.4	1	31-50	VTGGRRKRVKKWCANNQLGK	nucl(16),mito(7),cyto(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBW5	Uncharacterized protein	Medium	12.2	1	385-429	YYYGIRVRAEKRKKDQEEEHGRNLEKHRQEQERKRKEEEEKKNLE	nucl(15),cyto_nucl(10.5),cysk(6),cyto(4)	AEKRKKDQEEEHGRNLEKHRQEQERKRKEEEEKKNLEALLKKLRLEAAAKNAK (393-445, prob:0.91)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ED87	Protein kinase domain-containing protein	Medium	12.6	1	18-42	ITKNSNAHAMKKRKKDSLKPIITTE	nucl(18.5),cyto_nucl(12.333),cyto(5),cyto_mito(4.333)	MKKRKK (27-32, prob:0.721)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEF9	Alba domain-containing protein	Medium	13.8	1	8-28	GRKGSIGKENRDNQKRKREEA	nucl(21.5),cyto_nucl(12.5),mito(3)	KR (22-23, prob:0.614)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFR6	Uncharacterized protein	Medium	12.1	1	200-220	IKSLAPPKKGKQRRKARLVAT	mito(16),nucl(11)	PPKKGKQRRKAR (205-216, prob:0.903)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKH3	Uncharacterized protein	Medium	14.3	2	504-530, 614-639	LNPAQQKKLQHHQKKFNRSHTFYKPHE, DLTKEAIHKMEKKKEKEKERNEELEA	nucl(14.5),cyto_nucl(9.5),plas(6),cyto(3.5)	EKKKEKE (624-630, prob:0.703)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELQ8	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.4	1	81-114	KPCFYAKSRRGMRDKNAPRKRNSAKEQSRGRSVR	nucl(17.5),cyto_nucl(13.5),cyto(8.5)	SRRGMRDKNAPRKRNSAKEQSR (88-109, prob:0.889)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQC4	Elongator complex protein 3	Medium	11	1	5-28	VDTMTLSDRQRKPKDPNLPPENER	nucl(15),cyto(10)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ESW8	Uncharacterized protein	Medium	10.3	1	6-33	EKANLARIRDNQRRSRARRKEYLQELEA	nucl(21.5),cyto_nucl(14.5),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ET33	Exocyst complex component EXO84	Medium	12.1	1	2-27	SDERKGVSLRTKRKGRPAISAPKQIS	nucl(11),cyto(8),mito_nucl(8)	TKRKGRP (12-18, prob:0.71)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ET60	Adaptin_N domain-containing protein	Medium	14.2	1	242-269	LMTLYSRKSFPKRTRRVRKTTFKSNGNQ	nucl(16.5),cyto_nucl(14),cyto(8.5)	R (254-254, prob:0.6),R (256-256, prob:0.602)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EV13	Uncharacterized protein	Medium	11.5	1	25-45	AKSHAVAKRNKNRVAKRKPAI	nucl(13),cyto_nucl(10.5),mito(8),cyto(6)	AKRNKNRVAKRKP (31-43, prob:0.805)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWV5	Uncharacterized protein	Medium	14.3	1	1269-1294	QEESKRLEKREKIRRAKYGHLKDYKP	nucl(19),mito(4.5),cyto_mito(4),cyto(2.5)	RLEKREKIRRAK (1274-1285, prob:0.763)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZC1	Uncharacterized protein	Medium	11.7	1	23-46	QEVIETRKKRTKGKRIKLQDQFVF	nucl(19),cyto_nucl(12.833),mito_nucl(11.999),mito(3.5),cyto(3.5)	RKKRTKGKRI (29-38, prob:0.832)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EA89	Uncharacterized protein	Medium	12	1	329-348	DEVKQSEKRKPWKAFGLRYF	nucl(21),mito(3),cyto(3),cyto_mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDH6	Uncharacterized protein	Medium	10.3	1	68-89	LKSGYVQKRTRKTKAWKPIFLV	nucl(22),cyto_nucl(14.5),cyto(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJL4	DNA helicase	Medium	10.8	2	583-603, 827-850	LLSPLKRPTKRRDPLRELPEA, AMRPTESRFKKEGRRKKGEMDDVV	mito(12),cyto(9.5),cyto_nucl(6.5),nucl(2.5)	FKKEGRRKK (835-843, prob:0.783)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMS2	Deacetylase sirtuin-type domain-containing protein	Medium	12.1	2	53-75, 377-411	DGPPPAKRRKMTQPKSTEPKART, ATKSTKRKASTDPKVKKPRAPPKPKTSSKLKKQIL	mito(12),mito_nucl(11.333),nucl(9.5),cyto_mito(8.333),cyto(3.5)	ITKPKGPAEKTTATKSTKRKASTDPKVKKPRAPPKPKTSSKLKK (365-408, prob:0.995)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EP01	Uncharacterized protein	Medium	10.1	1	347-367	NYMDQRRKERGRPSLNRSFRN	nucl(19.5),cyto_nucl(13),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVN5	DFP domain-containing protein	Medium	10.2	1	425-447	SEDQWIRVPRSKRKRTISGVEDL	nucl(13),cyto(10),mito(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2H5	Reverse transcriptase domain-containing protein	Medium	11.4	1	126-146	TSIPRIKSTKRAKPWWSPELK	nucl(16),mito(6),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4F0	Uncharacterized protein	Medium	12.9	1	14-36	PLPDSDSKKVSKRERERDIWIPG	cyto_nucl(12.833),nucl(12.5),cyto(11),mito_nucl(7.166)	KRKAE (666-670, prob:0.639),EKKKKGKGKGRK (763-774, prob:0.993)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAJ4	Uncharacterized protein	Medium	11.1	1	9-33	ESSAYQKQGKVQNKKAPKREPVSIA	nucl(23),cyto_nucl(14.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEA8	Uncharacterized protein	Medium	10.2	2	42-62, 82-102	ICRKRSVGRTYKKRQHRHLIF, FIISCKKVKLYHKRIHLPRSK	mito(11),nucl(8),cysk(4),cyto(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFM9	Uncharacterized protein	Medium	11.4	1	126-147	TSIPRIKSTKRAKPWWSPELKA	nucl(16),mito(6),pero(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFS0	Uncharacterized protein	Medium	13.4	1	229-252	VLDARRKHREKGRKEVKKGSKAWI	nucl(16),cyto(8.5),cyto_mito(5)	RRKHREKGRKEVKKGSKAWILGKKEQMERKGKVVKNSSKYTGRKR (233-277, prob:0.995)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMD7	ABC transporter domain-containing protein	Medium	11.1	1	1054-1097	QTKEAVREQKKREKEERKSESLRKKEESIKKKAEKKLKRHGIGN	plas(10),cyto(4.5),cyto_nucl(4.5),pero(4),nucl(3.5),mito(2),E.R.(2)	NKGLKKQSAKERRK (1006-1019, prob:0.788),AVREQKKREKEERKSESLRKKEESIKKKAEKKLKRH (1058-1093, prob:0.995)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWU1	Uncharacterized protein	Medium	10.1	1	29-49	IGDTKLPTKRHPHRNPTTTTI	nucl(18.5),cyto_nucl(12.5),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EX29	WD_REPEATS_REGION domain-containing protein	Medium	10.2	1	181-203	PEWAQSSRPTKRRRRSSAGSDSS	nucl(21),cyto_nucl(14),cyto(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1X2	Mitochondrial DNA polymerase catalytic subunit	Medium	11.5	1	225-249	GMCSRQRPTWMKHRKDRELREKIAA	mito(18),mito_nucl(13.333),cyto_mito(10.333),nucl(7.5)	KRTKDGDLKPAKQKMAGK (427-444, prob:0.685),EKKKLDGKNAPGERKTR (1067-1083, prob:0.717)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F213	Uncharacterized protein	Medium	13.4	1	1-24	MDPKNPIKGKTRGKGEKRHKGEVG	nucl(14),mito(12)	PIKGKTRGKGEKRHKGEVGIEKAMMKLFKRKKFHDSAARKREGKGREGGKG (6-56, prob:0.988)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F356	HTH CENPB-type domain-containing protein	Medium	13.5	1	291-315	LRKANKALSKHRRVRKALIRKRGAF	nucl(22.5),cyto_nucl(14),cyto(4.5)	RKANKALSKHRRVRKALIRKRG (292-313, prob:0.945)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3T7	DNA polymerase epsilon catalytic subunit	Medium	11.9	1	1274-1295	LEYQKQKWKIQKQARIRRRHLF	nucl(15.5),cyto_nucl(9.833),mito(8.5),cyto_mito(6.333)	HGFRRGGKQAYHGPRKAK (8-25, prob:0.71)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EES7	Uncharacterized protein	Medium	10	2	8-32, 1313-1336	AGAPAPVRSSRRRPRPSSNENSLAQ, AESMLLSRPRHRARPKFDGRSSAS	mito(21.5),cyto_mito(12.5),cyto(2.5)	KEVPNPRREIAVRGKKSKGAERPGK (73-97, prob:0.925)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFN0	Uncharacterized protein	Medium	13	2	252-275, 460-483	LEWLKHFDKHTKNRRKGKYRMLVL, RAANEALSKRRRAKKNQLRQGGVL	cyto_nucl(11.5),nucl(11),cyto(10),mito(4)	KRRRAKK (468-474, prob:0.741)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFT5	Uncharacterized protein	Medium	12.3	1	204-227	ETVLQRQRGRKSPRSKALSRARGD	nucl(14.5),cyto_nucl(10),mito(5),cyto(4.5)	RGRKSPRSKALSRARGDGKTKT (211-232, prob:0.901)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENY1	Uncharacterized protein	Medium	11.4	1	5-28	QAEHSPTHPAKRRKSTHNSETIKS	nucl(24.5),cyto_nucl(13.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERG8	Protein kinase domain-containing protein	Medium	10.9	1	410-435	HTLSGTQAPRKKQRRYSPTSPPSPSA	nucl(17),cyto(6),mito(3),cyto_pero(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0Q9	Uncharacterized protein	Medium	10.2	1	19-49	VGMCCFQFRARRRKGRKRTAKEKEKEKGVTD	mito(15),nucl(7),cyto_nucl(6.5),cyto(4)	RARRRKGRKRTAKEKEKEK (27-45, prob:0.992)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3V6	Uncharacterized protein	Medium	13.3	2	252-275, 459-483	LEWLKHFDKHTKNRRKGKYRMLVL, LRTANEALSKRRRAKKTQLRQGGVL	nucl(12),cyto_nucl(12),cyto(10),mito(2)	KRRRAK (468-473, prob:0.682)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F514	Uncharacterized protein	Medium	13.7	1	15-41	DVSFRIMKINPKKKQRLKIRKESRVNV	nucl(22),cyto_nucl(13.5),cyto(3)	NPKKKQRLKIRKE (24-36, prob:0.882)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9D8	Uncharacterized protein	Medium	13	1	140-161	ADEKPKEKKPGGRPRKHPIEEL	nucl(18),cyto_nucl(11),mito(7)	KPKEKKPGGRPRKH (143-156, prob:0.94)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E471	Eukaryotic translation initiation factor 3 subunit C	Medium	13.9	1	174-193	LNAVKQKLKKTSKEHQKDID	nucl(22.5),cyto_nucl(13),cyto(2.5)	GRGGRGGNRGGRGGNRGGRG (824-843, prob:0.839)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9C0	Uncharacterized protein	Medium	11.7	1	236-255	TWKGHERKVLSKREKKKTAE	nucl(10),cyto(7),pero(5),cyto_mito(5)	LSKREKK (245-251, prob:0.685)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBP3	Uncharacterized protein	Medium	12.2	1	334-363	PDDKSSRKQEKEDRKRDRKDRHRRGSSSSD	nucl(11),mito(5),cyto(5),cyto_mito(5)	SRKQEKEDRKRDRKDRHRRG (339-358, prob:0.947)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXY6	DUF2293 domain-containing protein	Medium	13.1	1	38-67	ARAGKEERRAKKLERRKKEKKSYTAQDWAE	nucl(19.5),cyto_nucl(12),cyto(3.5),mito(3)	RRKKALQAKGAVHKNAQREAQEAQKTQKAQKSRSARAGKEERRAKKLERRKKEKK (4-58, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E3Y3	60S ribosomal protein L7	Medium	10.3	1	14-53	IPETLLKKRKSQAKEREARAAETEKVKKANKEKRGVIFKR	mito(11),nucl(8),cyto(8),cyto_nucl(8)	KKRKSQAKEREARAAETEKVKKANKEKRGVIFKRAEK (20-56, prob:0.973)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5U9	Uncharacterized protein	Medium	10.5	1	6-31	EYFLCKNRKDSKCCRREHRCNNEPVI	nucl(21),cyto_nucl(12),mito(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9T4	Uncharacterized protein	Medium	14.7	1	11-31	SLAPMLPKRGRQKCKERVPAR	nucl(18),mito(6),cyto(3)	KRGRQKCKERVPARASREPEQK (18-39, prob:0.718)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDE2	Uncharacterized protein	Medium	14.3	1	110-134	GGTWSSPRKPKCKKRAKEKVYTGTG	nucl(24),cyto_nucl(14)	RKPKCKKRAKEK (117-128, prob:0.837)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EG90	Uncharacterized protein	Medium	13.9	1	11-46	PPPGPKTKATKTTKATKSKLSIKKKKKTVSSTEETP	nucl(22.5),cyto_nucl(12.5),mito(3)	KRTARVPPPGPKTKATKTTKATKSKLSIKKKKK (5-37, prob:0.969)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGQ8	Uncharacterized protein	Medium	13.6	2	15-40, 282-301	TSPNAASRKTSKSKPKRQAPPPSTLL, QKSFHGYKSKSRFNNYRRKS	nucl(17.5),mito_nucl(12.666),cyto_nucl(11.333),mito(6.5)	RKTSKSKPKRQ (22-32, prob:0.752)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJ83	Uncharacterized protein	Medium	13.2	1	165-202	EESKINIPGRRRRTRRSSVEASRHTKRRRIHDDHVNGT	nucl(21),cyto_nucl(14),cyto(5)	PGRRRRTRRSSVEASRHTKRRR (172-193, prob:0.899)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERV7	Uncharacterized protein	Medium	12.1	1	1-21	MTTNSGIRRPKKFKGPLEYIF	nucl(11),cyto(7),mito(6),pero(1),golg(1),cysk(1)	RKR (543-545, prob:0.633)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1A9	Uncharacterized protein	Medium	13.5	1	19-49	SAPYCSQTSKTRKSKRKSKKATKSLNQDSKV	nucl(20.5),cyto_nucl(12),cyto(2.5),mito(2)	KTRKSKRKSKKATK (28-41, prob:0.955)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F425	1,3-beta-D-glucan-UDP glucosyltransferase	Medium	13	3	295-320, 339-358, 1832-1859	ASMKLGKGDRRTRKARKAAKAAPPDP, AEYRWKTRMNRMSQHDRVRQ, QIRPPIYSLKQSKLRKKRVWRYACVYFA	plas(25)	GKGDRRTRKARKAAKA (300-315, prob:0.937)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F488	Uncharacterized protein	Medium	13.6	1	408-434	QEELRKLDDRRAKRKGRYKCLATESKI	nucl(15),cyto(12)	RRAKRKG (417-423, prob:0.714)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F783	Uncharacterized protein	Medium	12.9	1	12-33	EEKRQAKQEREDEKRWNRKLKS	nucl(18),cyto_nucl(13),cyto(6)	RSKKR (139-143, prob:0.689)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E627	Uncharacterized protein	Medium	13.4	1	68-91	TSPKKSLPKKESSRGRKRKVHIED	nucl(21.5),cyto_nucl(13.5),cyto(4.5)	PKKSLPKKESSRGRKRK (70-86, prob:0.945)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFX4	SAP domain-containing protein	Medium	14.7	1	189-212	REAIEDRQKRKRRSQSPAPSSTDI	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(4)	KRKRR (197-201, prob:0.686),NRDRRR (656-661, prob:0.658)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKM1	Uncharacterized protein	Medium	12.6	1	288-316	KREQEQNESRDRKRRRKPRGKVTIDLTED	nucl(22.5),cyto_nucl(14.333),mito_nucl(12.166)	RDRKRRRKPRGK (297-308, prob:0.963)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMP4	Uncharacterized protein	Medium	13.5	1	174-196	SKSSRSSKSASKQQRPSSKRYSS	nucl(23),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENY2	Uncharacterized protein	Medium	12.4	1	152-171	IGENCECKRAIKRKKGDRGQ	nucl(12),cyto(11),mito(4)	AIKRKKGDR (161-169, prob:0.764)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERM5	Sterol 3-beta-glucosyltransferase	Medium	13.5	2	2-29, 265-286	APDDESKKRATRKSTKRWKEEHQVATEI, KSGYLSKSGRHNPKYNRYWFRL	nucl(10),cyto(5.5),cyto_mito(4.5),plas(4),mito(2.5),E.R.(2)	KRATRKSTKR (9-18, prob:0.674)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ES28	Uncharacterized protein	Medium	10.3	1	561-582	LAKANDKEKYRRRTRAESSGDE	mito(17),nucl(6),cyto(3)	VRRKKEKLLREEIGRGSGERGRTRLRGGIKRQ (608-639, prob:0.932)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6P1	LisH domain-containing protein	Medium	14.3	1	600-634	APPTPQQSNKANPKKKNEAKETKTKRATKKGSAAN	nucl(23.5),cyto_nucl(14)	ANPKKKNEAKETKTKRATKKG (610-630, prob:0.901)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECN2	Uncharacterized protein	Medium	12.6	1	121-141	KTVSKQTSARRPKPKVSEKVK	nucl(18),cyto_nucl(12.5),cyto(5),mito(4)	KRAPAKATVKEEK (249-261, prob:0.669)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHJ6	tRNA-dihydrouridine synthase 3	Medium	12.1	1	456-481	AQAKAEAKAAKKKRKNEEEDGGEQKK	nucl(11),cyto(7),pero(5),mito(4)	AKAEAKAAKKKRKN (458-471, prob:0.939)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIR1	Uncharacterized protein	Medium	12	1	66-92	YFPTHKEEKKLHPKKYRSRYWLRGENF	nucl(19),cyto(5),pero(1),golg(1),cysk(1)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EL37	WD_REPEATS_REGION domain-containing protein	Medium	11	1	443-468	VGSFLGPRRRKHHRRRHSGRMTQNLS	mito(11),nucl(8),cyto_mito(8)	PRRRKHHRRRHS (449-460, prob:0.928)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETA9	Zn(2)-C6 fungal-type domain-containing protein	Medium	10.2	1	2-38	EDTRFDSSRKRPRPVVSCLRCREKKLKCDRLLPCQNC	nucl(20.5),cyto_nucl(13.5),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1D9	Uncharacterized protein	Medium	11.3	1	918-937	QTAACKKCGGKDFKAKKFAV	nucl(17),cyto(7),pero(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1H3	NET domain-containing protein	Medium	13	1	143-164	GGMSRKKDSDGKKRKRTGQVDM	nucl(13),cyto(10),mito(3)	RKKDSDGKKRKR (147-158, prob:0.794)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F441	HTH CENPB-type domain-containing protein	Medium	11.7	1	413-440	ANNLRAIMKKRTIRKKGKRLVLKGHFHI	nucl(17),mito_nucl(11.833),cyto_nucl(11.333),mito(5.5)	MKKRTIRKKGKRL (420-432, prob:0.924)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7U3	Uncharacterized protein	Medium	12.1	1	481-500	CSGECRERLRGEKGKRRDMK	cyto_nucl(8.833),nucl(8.5),cyto(8),cyto_mito(7.833),mito(6.5)	ESRRRREEEERRREEIAKKAKAS (305-327, prob:0.91),RGEKGKRRDMK (490-500, prob:0.774)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F907	Uncharacterized protein	Medium	12.7	2	175-203, 235-254	NCQHPRCTKCPRYPLKKKEKEKEKGKTTV, QPLVRKKPMQRIRRTCHECS	mito_nucl(12.333),nucl(12),mito(11.5),cyto_nucl(8.333)	KKKEKEKEKG (190-199, prob:0.786)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F909	Uncharacterized protein	Medium	14.8	2	51-73, 84-109	EVIETRKKRTKGKRVKLQGQFVF, EAEEKPKEKKLRGRPRKRPIEESEEE	mito(15.5),mito_nucl(14),nucl(11.5)	RKKRTKGKRVK (56-66, prob:0.848),EKPKEKKLRGRPRKRP (87-102, prob:0.977)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9W5	Uncharacterized protein	Medium	12.9	1	126-159	EALKRRVEDGKLRRRRLRREKRKRQGIVVSPHDS	nucl(18.5),cyto_nucl(11.5),cyto(3.5),mito(2),plas(2)	LKRRVEDGKLRRRRLRREKRKR (128-149, prob:0.995)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEF7	Uncharacterized protein	Medium	12.1	2	4-49, 604-624	ARLYESPSPTKRKRSSSPNVPMPVLNTSTVPEVKRRKREMSEEGCH, SVLGRSRSQDRSKKDEKHVTF	nucl(18),cyto_nucl(11.5),mito(6)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFS2	Uncharacterized protein	Medium	12.9	1	32-56	QMMADTKKRRDAKRNKIENERAQRI	nucl(18.5),cyto_nucl(11.5),mito(4),cyto(3.5)	KKRRDAKRNKIENERAQRIKDVKKKL (38-63, prob:0.914)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGP5	Phosphoinositide 5-phosphatase	Medium	10.4	2	1089-1111, 1154-1179	TETTRSSYKKAPPLPRKPVHLAS, KSNLEPPPPPQPRRPGRKVADEGPKP	mito(9),extr(8),cyto(4),golg(3),nucl(1),pero(1),E.R.(1)	QPRRPGRKVA (1164-1173, prob:0.739)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EK82	Uncharacterized protein	Medium	10.1	1	435-454	LCMYDKVQRVKNKWKCVMKD	nucl(19.5),cyto_nucl(12.5),cyto(2.5),mito(2),plas(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EL46	Uncharacterized protein	Medium	10.3	1	88-112	VRAKMNENGKKRRVRPRWGRLGTYA	mito(15),nucl(6),cyto(5)	NGKKRRVRPRW (95-105, prob:0.85)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELH7	Uncharacterized protein	Medium	11.8	1	215-243	FAPKSRSTLVKQPKKKQKRIGGRFVSGRE	nucl(19),cyto_nucl(11.833),mito_nucl(11.833),mito(3.5),cyto(3.5)	KQPKKKQKRIGGR (225-237, prob:0.886)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUA7	PseudoU_synth_1 domain-containing protein	Medium	13.9	1	1-23	MGRKEYNRQAPKRDRNDDDQASK	nucl(24),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUP5	GAR domain-containing protein	Medium	12.6	1	1032-1052	MASAEKEKEKRKGGHRQSLGE	mito(13),nucl(8.5),cyto_nucl(7),cyto(4.5)	NPKGIRPPKT (772-781, prob:0.683),KEKRKG (1039-1044, prob:0.691)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EYF6	Uncharacterized protein	Medium	11	1	627-647	EIHSSRDRRRDERSHHRRGVE	nucl(15),cyto(4),golg(3),cyto_pero(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5H2	UBX domain-containing protein	Medium	12.1	1	360-381	LDLSKKNPVARRKPEKSKSLDV	nucl(15.5),cyto_nucl(12),cyto(7.5),mito(3)	RRK (370-372, prob:0.626)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6E4	WD_REPEATS_REGION domain-containing protein	Medium	12	2	118-137, 166-187	LWPRRRRRSMLDPNRFPKVP, GTDNQVRRRKRLTRRILDREIA	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E506	Uncharacterized protein	Medium	13.1	1	262-283	DGPSSSPTSDPKKKDKKKKIKG	nucl(18.5),cyto_nucl(12.5),cyto(5.5)	PKKKDKKKKIKG (272-283, prob:0.982)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6T9	Uncharacterized protein	Medium	13	2	252-275, 459-483	LEWLKHFDKHTKNRRKGKYRMLVL, LRTANEALSKRRRAKKTQLRQGGVL	cyto_nucl(11.5),nucl(11),cyto(10),mito(4)	KRRRAK (468-473, prob:0.682)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELJ6	Multiple RNA-binding domain-containing protein 1	Medium	14.9	2	82-101, 702-721	LPISRKVQREQERENNKIRH, AEEKRKEDRAKKLAGKRTKL	nucl(17),cyto(9),mito_nucl(9)	EEKRKEDRAKKLAGKRTK (703-720, prob:0.921)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENR5	F-box domain-containing protein	Medium	13	1	593-616	GADGAGIRRRRRRAREAQLMHADE	nucl(13),mito(6),cyto(5),pero(2)	RRRRRRAR (600-607, prob:0.832)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EV33	XPG_I_2 domain-containing protein	Medium	12.1	1	415-444	LSASISAEKSKQRKKRKRDQLTSSRTANKK	nucl(11),cyto(9),mito(4),pero(1),cysk(1),vacu(1)	KSKQRKKRKR (423-432, prob:0.921)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPH2	Uncharacterized protein	Medium	13.8	1	225-265	DKRLTTLKKQQDSKKGLRRRLMRKVTHRRQGRRLLSRSKMG	nucl(21),cyto_nucl(12.5),mito(3)	DSKKGLRRRLMRKVTHRRQGRRLLSRSK (236-263, prob:0.963)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ER90	Uncharacterized protein	Medium	11.1	1	17-44	FIIALCCIRKKRRAKKSKDMIRRGSESQ	extr(9),E.R.(5),cyto(4),nucl(3),plas(3),cyto_mito(3)	RKKRRAKKSKDMIRRGSESQRGASKERKKKD (25-55, prob:0.993),KKPKARKGK (72-80, prob:0.816)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERR5	Uncharacterized protein	Medium	14.4	1	19-39	IEEKILKKKYRKAKDDDERGG	nucl(24.5),cyto_nucl(13.833)	KKYRK (26-30, prob:0.635)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F618	RING-type domain-containing protein	Medium	14	2	317-343, 650-675	LKVQKNDKSKNVSKKKKTKESQPTFTA, YALLLLRSRIRRRRWRAPKSVVERLP	extr(14),plas(5),golg(3),mito(2),E.R.(2)	KSKNVSKKKKTK (324-335, prob:0.817),TKAARTNLKKSSKKAS (351-366, prob:0.759),RIRRRRWRAPK (658-668, prob:0.794)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6U9	Uncharacterized protein	Medium	13.4	1	419-444	NNLRAIMKKRTIHKKGKRLVLKGHFH	nucl(14),mito(8),cyto(4)	KKRTIHKKGKR (426-436, prob:0.814)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7G4	Uncharacterized protein	Medium	12.1	1	492-513	GISAREKKCKTDGRRKAGAIKK	nucl(18),cyto_nucl(13.833),cyto(7.5),cyto_mito(4.666)	RRKAG (505-509, prob:0.653)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7K0	Uncharacterized protein	Medium	10.5	1	102-125	DTVGPGIATKRRRRREQMEEEDSS	nucl(22.5),cyto_nucl(14),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7S1	Pinin_SDK_memA domain-containing protein	Medium	14.1	1	13-41	VVPKQDAPNVKSPRRKRRQSSVSEEASKR	nucl(20.5),cyto_nucl(13.333),mito_nucl(11.666),cyto(4)	SPRRKRR (24-30, prob:0.743),RQKERAAQRKVEAEVKRKE (132-150, prob:0.695)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8C8	Histone acetyltransferase	Medium	14	2	99-127, 472-493	AAPAGKKTSVGKKKNQKRPAQASKREDSV, HEAMREKYKLRPKRVIDPARIV	nucl(14.5),cyto_nucl(12.5),cyto(9.5)	EKPKDKSKAAPAGKKTSVGKKKNQKRPAQAS (91-121, prob:0.982)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E555	Uncharacterized protein	Medium	10.4	1	231-255	TTPATISSRKPRPQSRKRLVVKVGD	nucl(15),plas(9),mito(1),cyto(1),E.R.(1),cyto_mito(1)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJN4	TPR_REGION domain-containing protein	Medium	12	2	40-66, 998-1018	VVYQDLKKSKNKSKTVNKAGWRKIQFC, VANSRSLKQKIRKLGRWLNIR	nucl(13),mito(8),cyto(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENK4	RING-type domain-containing protein	Medium	10.2	1	8-36	DEFTRRLGDIRRRNRPNQRRNYNFIPSRG	nucl(21),cyto_nucl(14),cyto(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERJ8	Uncharacterized protein	Medium	13	1	7-33	QLPIHKCMPLKKKHRASRRKKFEEEAE	nucl(18),mito(9),cyto_nucl(9)	KKKHRASRRKK (17-27, prob:0.912)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ESM5	Protein kinase domain-containing protein	Medium	10.2	1	15-41	LVNYHRSLTKNPKTIRHNKWRPDATEF	nucl(13),cyto(9),mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUZ5	Uncharacterized protein	Medium	13.2	1	88-108	EYSQGNTKRSAKRRSRKVIVD	nucl(21),cyto_nucl(14),cyto(5)	KRSAKRRSRK (95-104, prob:0.776)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4I2	Uncharacterized protein	Medium	14.5	1	859-881	QRSWRSRQSLKKWRDYRRKIVIV	nucl(17),cyto(5),pero(4)	GKTARRGYKK (887-896, prob:0.691)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9Q7	Uncharacterized protein	Medium	12	1	10-33	EENLREKERERRRGKEREREKGVG	nucl(16),cyto_nucl(14),cyto(10)	EKERERRRGKEREREKGVGYLGGAKER (15-41, prob:0.962)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGB0	Uncharacterized protein	Medium	14.3	2	27-51, 1719-1744	VGQPAPPPVKPPRKLKVPKFLTDEM, SASAVGRMGKSKKRNGKPSPIWVEPV	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(3)	NGKAGGKRSRSASAVGRMGKSKKRNGKP (1709-1736, prob:0.961)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EH67	Uncharacterized protein	Medium	14	1	42-83	DLQGRQQFAYQRKRKKKKKKKKKKKKKKKKKKKKKKTKLSSL	nucl(22.5),cyto_nucl(12),mito(3)	RKRKKKKKKKKKKKKKKKKKKKKKKTK (53-79, prob:1)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWZ7	Uncharacterized protein	Medium	14.2	1	106-127	LQQNPVKKRVRVKCLNHFEHRG	nucl(23),cyto(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EX15	Uncharacterized protein	Medium	12	1	121-140	ASHSRRRYRILPPRIPNQNP	nucl(15.5),cyto_nucl(12),cyto(7.5),mito(1),pero(1),cysk(1),vacu(1)	AKHAKR (375-380, prob:0.632)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0P5	Uncharacterized protein	Medium	12.8	1	40-70	TVNTLRSRASRNKLRKEPPPRPKTANAKGTG	nucl(17.5),mito_nucl(12.5),mito(6.5)	RASRNKLRKEPPPRPKT (47-63, prob:0.856)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E896	tRNA-intron lyase	Medium	14.7	1	141-166	SEDVTRKRRADRQQTKWERARKEREA	nucl(19),cyto(5.5),cyto_mito(4)	EKKRRGVSKAIASEDVTRKRRADRQQTKWERARK (129-162, prob:0.784)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAT3	Uncharacterized protein	Medium	11.9	1	84-107	NNDRLWERKRQVEKNARKRERDGQ	nucl(20),mito(3),cyto(3),cyto_mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAY3	Kinase	Medium	14.2	1	279-303	REGLPEDKTKKRENKNRPQLKDSNS	nucl(24),cyto_nucl(14.5)	PKRPKRRFSSGGLRRR (953-968, prob:0.834)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEW2	Mcp5_PH domain-containing protein	Medium	14.4	1	1244-1270	DMMSLQRRRSRDGRRRSRNKESFGVSR	nucl(17),cyto_nucl(13.5),cyto(8)	GRAGSVRKVRSTAAVNRSRRIARR (799-822, prob:0.698),RRRSRDGRRRSRNK (1250-1263, prob:0.821)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EK17	DUF1713 domain-containing protein	Medium	14.6	1	295-350	EDPPRSYLERSRIRRRERATMWAISVKRQRKLKMKKHKYKKLMRRTRNLRRRLDRN	mito(14),nucl(12)	EKKASKAGRKKAK (80-92, prob:0.913),SRIRRRERATMWAISVKRQRKLKMKKHKYKKLMRRTRNLRRRLDRN (305-350, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENF4	Uncharacterized protein	Medium	14.8	2	18-41, 178-205	NSPSTTKPPSKTTKKTKTPIADSW, REYERVQREKEVRRRKEEREEEGRRKEE	nucl(19),cyto_nucl(12.5),mito(4),cyto(4)	QREKEVRRRKEEREEEGRRKEEEERRKR (184-211, prob:0.958)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPE7	Branchpoint-bridging protein	Medium	14	1	59-84	EEVGGDGSRRRKKRNRWGDATENKAA	nucl(15),cyto(6),mito(4)	SRRRKKRNR (66-74, prob:0.881)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPT6	Uncharacterized protein	Medium	11.3	1	1-24	MSFNLFSKTPRKAKKPEDNEEGIQ	nucl(23.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWG2	alpha-1,2-Mannosidase	Medium	10	2	68-88, 554-588	PLPTGKPKKIPQIQNTPPKED, VSVKNHEKKEKEGKDKKGKSKDKKEKEQHFAKNLG	E.R.(7),mito(6.5),golg(6),cyto_mito(4),plas(3),extr(2),vacu(2)	EKKEKEGKDKKGKSKDKKEK (560-579, prob:0.988)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F415	Uncharacterized protein	Medium	11.4	1	581-601	SKKVSWRKTRCQLVQKWRPMS	nucl(23.5),cyto_nucl(13.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7Z4	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.2	2	9-34, 70-90	KSHHGCSQCKLRRVKCDERQPVCSRC, KPPLIRSSSRRNPPQNQNPLH	nucl(13),mito(10),cyto(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7Z7	Uncharacterized protein	Medium	13.7	1	167-187	EIRIRRARKYRGKAEMEEKKN	nucl(21.5),cyto_nucl(13),cyto(3.5)	RRARKYRGK (171-179, prob:0.702)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8C7	RNA exonuclease 4	Medium	12.5	1	312-332	NPSHSGASSKSKPKKKKKGKR	nucl(11.5),cyto_nucl(11.333),cyto(8),cyto_mito(7.999),mito(6.5)	KRKAAEPSERTKDSIAKRRRLE (28-49, prob:0.8),ASSKSKPKKKKKGKR (318-332, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E486	MIF4G domain-containing protein	Medium	14.2	1	1407-1426	IVDLRKKRWASKEANKGPKT	nucl(18),mito(4.5),cyto_mito(4),cyto(2.5)	EKKRAEAEAKAK (828-839, prob:0.708)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAD9	Uncharacterized protein	Medium	10.3	1	408-429	LGFLSRKKGRGHSPKPQERGIL	mito(10.5),nucl(10),cyto_nucl(8.833),cyto_mito(8.666),cyto(5.5)	RKKGRGHSPKPQE (413-425, prob:0.782)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGB1	Uncharacterized protein	Medium	11.3	1	278-304	NSGFREKAGNRLRRRSRGITNENRVGV	nucl(23.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPF4	Protein kinase domain-containing protein	Medium	11.7	1	471-491	DQERTKKDRRRSSGSKQSKRS	nucl(14.5),cyto_nucl(12),cyto(8.5),mito(4)	KKDRRRSSGSK (476-486, prob:0.713)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETY0	Uncharacterized protein	Medium	10.1	1	21-41	TLNNPEKRVARFKREYNRLLQ	cyto_nucl(8),nucl(7.5),cyto(7.5),mito(4),golg(2),pero(2),plas(1),extr(1),E.R.(1),vacu(1)	RERDRDRDRRK (1001-1011, prob:0.734)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVW3	Uncharacterized protein	Medium	12.3	1	106-130	AVSAKIKGKAKERNRNRKRGESTGE	nucl(16.5),cyto_nucl(13.5),cyto(5.5),mito(3)	SAKIKGKAKERNRNRKRG (108-125, prob:0.959)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EY77	Uncharacterized protein	Medium	12.4	1	52-76	KLNALAKKYYEKKTKKSSNLSVGDT	cyto(11.5),cyto_nucl(11.333),nucl(10),mito_nucl(6.333),pero(2)	KKRR (359-362, prob:0.642),PKRGAKK (687-693, prob:0.671)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F395	Uncharacterized protein	Medium	12.4	1	293-318	ASPVVRARWREEKKKRIEEREAQIRE	nucl(17),cyto_nucl(12.5),cyto(6),pero(3)	REEKKKR (302-308, prob:0.689)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7W5	Clr5 domain-containing protein	Medium	10.5	1	106-133	ISDKRVLDPRRIQRLKRRYGHETQRPQD	nucl(19.5),cyto_nucl(12),cysk(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E818	Uncharacterized protein	Medium	14.2	1	190-214	GTSSSTPTRSTRRRKKNGIDRIIEE	nucl(25),cyto_nucl(15.5)	RRRKKN (201-206, prob:0.735)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDW9	Uncharacterized protein	Medium	12	1	51-77	DDGKCKSCVKKQEKAKKKEKNGDAGGC	nucl(10),mito(8),cyto(7)	QEKAKKKE (62-69, prob:0.73)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEJ0	Ribosomal protein L19	Medium	12.2	1	160-185	DAKRAKTKAARERKAERNQAKKAAQF	mito(13.5),cyto_mito(10),nucl(8),cyto(5.5)	RARARELTAARRIGRHRGFGKRKG (60-83, prob:0.915),KRALVEHIHRAKAEKARERLLKEEMDAKRAKTKAARERKAERNQAKK (135-181, prob:0.98)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKG8	Uncharacterized protein	Medium	12	1	65-90	ECARLERMKQPRRRPRQILRSTRPTF	nucl(15),cyto_nucl(10.5),mito(8),cyto(4)	PRRRP (75-79, prob:0.644)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKN0	HTH CENPB-type domain-containing protein	Medium	12.9	2	252-275, 459-483	LEWLKHFDKHTKNRRKGKYRMLIL, LRTANEALSKRRRAKKTQLRQGGVL	cyto_nucl(12.5),cyto(11.5),nucl(10.5),mito(2)	KRRRAKK (468-474, prob:0.686)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELJ5	TEA domain-containing protein	Medium	14.2	3	13-41, 79-99, 762-784	VGNTLEFRKRHNRQQRFNRHSNRNPIVDS, PYMGRRKFSFKGKPHGRNELI, HFDHHDRDSHKQNHHRSHQHDSL	nucl(16.5),mito_nucl(10.5),cyto(5),mito(3.5),cyto_pero(3.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERV9	Uncharacterized protein	Medium	10.1	1	126-155	GQKSSKRKLNYQLNRNNKRNRNHNTRNSLD	nucl(18.5),cyto_nucl(12.5),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXG3	Uncharacterized protein	Medium	12.8	1	89-115	RVAAKRKSYKASSRRQRKRQDGTEEFG	nucl(19),cyto_nucl(14),cyto(7)	KRKSYKASSRRQRKR (93-107, prob:0.771)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZF5	Ydc2-catalyt domain-containing protein	Medium	12.9	2	75-98, 301-322	LEIPLPSKSPKNKRKSTPPIPILQ, SASAVAQKKKEKEKKEEMGKLD	mito(15.5),nucl(10),cyto_mito(9)	DRKAGRANGNKPKSKSSHRSASAVAQKKKEKEKK (282-315, prob:0.962)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1N7	Reverse transcriptase domain-containing protein	Medium	14.3	2	126-147, 970-990	TSIPRIKSTKRAKPWWSPELKA, APTVLRTRSARNQSQRNLNIE	nucl(19),cyto(5),mito(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F799	Uncharacterized protein	Medium	13.7	1	27-46	NSNLRRSTSRSRRSPSQSRT	nucl(21),cyto_nucl(13),cyto(3)	KLEGKRKKAEVRGEKAEERIRMMRR (124-148, prob:0.919)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5H1	Uncharacterized protein	Medium	10	1	36-59	RYEFRMRRKALNYAKKRKKDGGYY	mito(16),nucl(5),cyto(2),plas(2)	RMRRKALNYAKKRKK (40-54, prob:0.84)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBU9	Zn(2)-C6 fungal-type domain-containing protein	Medium	10	1	1-35	MQEPPRKRVRARNACDSCRKRKRKCDGAAPCAECV	nucl(14),cyto(4.5),plas(4),cyto_mito(3.5),pero(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKN3	Uncharacterized protein	Medium	10	1	18-42	SVASRASTSRHHRRHGRSHTGTSSY	nucl(13),mito(9),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMP9	MAP kinase kinase kinase	Medium	10.3	1	1267-1286	IDFIKKCFIRDPKKRASAPE	nucl(19.5),cyto_nucl(12.5),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENK1	Uncharacterized protein	Medium	13	1	578-606	EEALAKENESKKRKRERDRREKCIYKVLG	nucl(19.5),cyto_nucl(13),cyto(3.5),mito(3)	LKAERPRRGLPRSPERAPAPAHSPASGNLRQHRARNSHGSRQRRAARHRTAIAREEALAKENESKKRKRERDRRE (524-598, prob:0.984)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPX3	AP-1 complex subunit gamma	Medium	11.1	1	607-626	ASKKPSKASNRKSKTVKPAE	mito(11.5),nucl(11),cyto_mito(8.5),cyto(4.5)	KKPSKASNRKS (609-619, prob:0.702)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EU56	Uncharacterized protein	Medium	14.7	2	1-20, 503-533	MPRPKRTKVNRSAPAPAKRV, SAPPSKHSQKAKPTAKGKGKRTYGRKPATTT	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(4)	KASAPPSKHSQKAKPTAKGKGKRTYGRK (501-528, prob:0.96)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXT2	Developmental regulatory protein wetA	Medium	11.6	1	463-487	PSGSSKTKARREKEAMEKRRKLSQA	nucl(17),mito_nucl(12.833),cyto_nucl(10.333),mito(7.5)	KTKARREKEAMEKRRKL (468-484, prob:0.849)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F298	Uncharacterized protein	Medium	10.4	1	169-190	KCTCDARRSWYKSKKKPWSFIW	nucl(20),cyto_nucl(13),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8E8	Uncharacterized protein	Medium	10.7	1	59-79	LDRVYEKDEKKRKRGAPEEGV	nucl(11.5),mito(9.5),cyto_nucl(8.833),cyto_mito(7.833),cyto(5)	KKRKR (68-72, prob:0.691)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E428	Uncharacterized protein	Medium	11.3	2	22-47, 982-1004	IIPPNMTARREKRKLAKNPPVTKYNL, PSIPSLSNKKDKRRIPSEQSSAG	nucl(16.5),cyto_nucl(11),mito(6),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5N9	Uncharacterized protein	Medium	10.2	1	38-70	VVYPKCRQSQSKQQSRQQSRKQSHKYQDSSQEK	nucl(17.5),cyto_nucl(10),mito(6)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E977	USP domain-containing protein	Medium	14.5	2	51-75, 277-297	QYFAPSKIYRRRFSRGRKMSSPARS, ASKMGSPKKRRLNPKASKVPA	nucl(17.5),cyto_nucl(14),cyto(7.5)	GSPKKRRLNPKASKVPAQTAIPSKPGAKPSKEELEKIRSDSLKKRRYLASKVR (281-333, prob:0.935)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9V5	Uncharacterized protein	Medium	12.3	1	94-114	EPSNQKTSKSRVKREVKREMG	nucl(19),mito(4),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEQ6	BZIP domain-containing protein	Medium	13.9	1	68-88	ATDTPPTKRKAQNRAAQRAFR	nucl(16),mito(7),cyto(4)	PRPKPGRKPATDTPPTKRKAQNRAAQRAFRERRA (59-92, prob:0.909)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFU1	Uncharacterized protein	Medium	13.2	1	3-151	DMEYRKIIKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKSKTKSKTKSKSKSKSKSKSKPYKLYTKP	nucl(14),mito(13)	KIIKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKTKSKTKSKTKSKSKSKSKSKSKPYK (8-146, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGS5	WW domain-containing protein	Medium	10.4	1	89-108	QKKPNPPYPDDRRKAPQRIE	nucl(14),cyto(8),mito(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMX3	Uncharacterized protein	Medium	12.1	1	107-129	AEKPAPKKKAPAPKKPVAKKAAA	mito(12),cyto_nucl(8),nucl(7.5),cyto(7.5)	APKTKKAAPKANTGKKVASTKGAKPTGVKKTAAPKKKS (23-60, prob:0.97),KPAPKKKAPAPKKPVAKKAAAPKKPVVKA (109-137, prob:0.997)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQ09	DUF3074 domain-containing protein	Medium	13.5	2	568-588, 608-656	QKLEDKKRKLQEKLERAKQRE, EKYEREVRKREEKYRKEMEKLEKKRIREGQKQEERKRKREGKEKGEDLQ	nucl(16),cyto_nucl(12.833),mito_nucl(8.833),cyto(8.5)	KKRKLQEKLERAKQREADKKSEDGEKEKEAIRKAEEKYEREVRKREEKYRKEMEKLEKKRIREGQKQEERKRKREGKEK (573-651, prob:0.996)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQP7	PH domain-containing protein	Medium	14.2	1	43-66	STSLSRTKSMSRYRRPKLALKSED	nucl(24.5),cyto_nucl(15)	KGEGQKKATKAVKAMKARIP (510-529, prob:0.777)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EY85	Uncharacterized protein	Medium	13.7	1	41-65	EERGEERGEKRNKRKRRRGEEEKGT	nucl(21.5),cyto_nucl(12),mito(4)	RGEERGEERGEKRNKRKRRRGEEEK (39-63, prob:0.995)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0R9	HTH CENPB-type domain-containing protein	Medium	12.2	1	417-450	LRKANEALSKHRRTKKLNYSKKKYLLDKKLWIYY	nucl(13),mito(6),cyto(6),cyto_mito(6)	KHRRTKKL (426-433, prob:0.723)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2T0	Uncharacterized protein	Medium	11.8	2	12-37, 59-88	PPVVRSPESLRQRQRDRLSPRGRFAT, SAPNLRITGKRNPNRQKKLMQESSRNDNNV	nucl(19),cyto_nucl(14),cyto(7)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F340	Uncharacterized protein	Medium	12.7	1	228-249	IEDGNGRRRRKGKRGQNWGLGG	nucl(18),cyto_nucl(12.5),cyto(5),pero(3)	GRRRRKGKRG (233-242, prob:0.905)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3L6	Uncharacterized protein	Medium	11.4	2	2-27, 30-59	CDETKPTCLQCQKSRRQCPGYKDDFD, FRNETKATERRARRSLKNKKGNNNNTQTGS	plas(9),nucl(5),cyto(5),cyto_nucl(5),pero(4),cyto_mito(4),mito_nucl(4)	RRARRSLKNKK (39-49, prob:0.706)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6V0	DNA helicase	Medium	13.5	1	668-691	KEVLEDEKKSKRRKTRPLEDESSG	nucl(22.5),cyto_nucl(14),cyto(4.5)	KKSKRRKT (675-682, prob:0.749)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E554	Uncharacterized protein	Medium	10	1	206-226	VDPSKKAPTRKLRKIPRSATP	plas(21),E.R.(2),golg(2)	KKAPTRKLRKIPR (210-222, prob:0.763),RK (534-535, prob:0.612)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9M2	GTP-binding protein	Medium	11.4	1	50-72	AVASPAESKKPRKKKVLLMGKSG	nucl(12),cyto_nucl(9.5),mito(9),cyto(5)	KKPRKKKV (58-65, prob:0.876)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELQ7	Uncharacterized protein	Medium	11.7	1	282-301	ADRSSNTPERKVKRERDNGE	nucl(14.5),cyto_nucl(13.5),cyto(11.5)	RK (309-310, prob:0.615)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETU3	Uncharacterized protein	Medium	12.5	1	141-166	KPEPSWKKTTRCQPEKTPKASRPNKT	nucl(13),plas(8),mito(2),cyto(2),golg(2),cyto_mito(2)	GRGK (408-411, prob:0.625)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZM1	PH domain-containing protein	Medium	14.9	1	226-249	YHVGVLQKRRRKKGQGYARRFFSL	nucl(18),cyto_nucl(13),cyto(6)	KRRRKKG (233-239, prob:0.766),PKRRK (607-611, prob:0.663)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4D1	Uncharacterized protein	Medium	11.3	1	251-271	KDSYTNKSRRRLDSGRRPSNN	nucl(23.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9D1	Atypical serine/threonine protein kinase BUD32	Medium	12.3	1	519-543	GASTSSSGKKRKRNERLDPGSRLKK	nucl(17),cyto_nucl(12.5),cyto(6),pero(4)	SGKKRKRNERLDPGSRLKKSK (525-545, prob:0.942)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EC37	Uncharacterized protein	Medium	14.8	3	96-118, 681-700, 798-822	TSSKDPYRSRIKSQNEHRIKKTI, GTGEYKKKMHSLQKKFPEKS, RGMKMKMKMKTGMRKRKRKRKKMTS	mito(16),mito_nucl(12.833),cyto_mito(9.333),nucl(8.5)	RGMKMKMKMKTGMRKRKRKRKKM (798-820, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EI98	GATA-type domain-containing protein	Medium	11.5	1	785-810	ASTMPRSNAVPKRQRRHSKSVSAIES	nucl(25.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXM5	Fungal_trans domain-containing protein	Medium	11.1	1	51-81	QESTKTEVPQKAPKKRKRCDRQFPCSNCVNR	plas(13),nucl(8),cyto(3),golg(2)	PKKRK (63-67, prob:0.666)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F713	Uncharacterized protein	Medium	10.4	1	348-369	SSYEDFKKSRRRLRNLQDDAKE	nucl(20.5),cyto_nucl(13),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7G5	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit	Medium	12.9	2	6-30, 181-200	LSPIRKAWYRWKSLRLPWRKRFFVG, TLPREEKKYKEDPWKKARGG	mito(11.5),nucl(10),cyto_mito(8.5),cyto(4.5)	KK (195-196, prob:0.611)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQ93	ATP-dependent DNA helicase	Medium	12.2	1	26-48	RLTAAYKRSYRRSHNPYVYQFEV	nucl(18),cyto(4),pero(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERN4	Uncharacterized protein	Medium	13.1	2	15-43, 65-84	LQKFLVRRSNLQQRPKKPKLTPKDCEINI, TGICRKWKRFCEFRNEQYWR	nucl(17),mito(4),plas(2),cyto(1),pero(1),golg(1),cysk(1),cyto_pero(1)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ESX7	Uncharacterized protein	Medium	12.8	1	293-312	GTPSRAAKRKRKANDSPSAS	nucl(18),cyto_nucl(12.5),cyto(5),mito(2)	QKRQPGTPSRAAKRKRK (288-304, prob:0.924)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EW41	Uncharacterized protein	Medium	14.1	2	1155-1176, 1302-1326	LPSPSNDKARRKSRVVKNEPFS, ANAKSSTPKLSQKERKKQQAALQQA	nucl(11),cyto(6),mito(3),golg(3),plas(1),pero(1),cysk(1),vacu(1)	SRGGGKSGGGRGKGGPRGRGGRGRGGGESVRGGGGGGRGRGKSQ (1513-1556, prob:0.997)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1M1	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.9	1	1-45	MADATQTRNRERKRRISRPKVKTGCKNCKLRRVKCDETRPQCTKC	nucl(22.5),cyto_nucl(13),cyto(2.5)	RERKRRISRPKV (10-21, prob:0.857)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5X3	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.8	1	39-67	PRSKTGCSTCKQRRVKCDETKPQCIRCQN	nucl(19),mito(3),cyto(3),cyto_mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F956	MAGE domain-containing protein	Medium	14.3	1	314-334	GSSSRRASKRGRPRREADVEN	nucl(24),cyto_nucl(14)	RRASKRGRPRR (318-328, prob:0.819)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7R9	Nucleolar GTP-binding protein 1	Medium	12.3	1	575-597	DYEAKMRAKSRARSQANRRDDGV	cyto(16.5),cyto_nucl(14.5),nucl(9.5)	EKRELIKNEAKMKKSLKNRALIPRSATRKK (498-527, prob:0.864),KLGQRKM (612-618, prob:0.629)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EA22	Lysine--tRNA ligase	Medium	13	1	17-44	GEMVSKTELKKRQKQRQKEEEKAKKAAA	nucl(18),cyto(9),mito_nucl(9)	KKRQKQRQKEEEKAKKAAALPARPAAV (26-52, prob:0.933)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EW21	HTH CENPB-type domain-containing protein	Medium	10.2	1	100-122	KLWAHRFVKRHTKLKTRFNRVYD	mito(17),nucl(6),cyto(4)	KLRRARKALIRK (466-477, prob:0.752)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EX85	ECM11 domain-containing protein	Medium	10	1	17-41	SPPPQPPSPSPPRPQPQRTDRQAMA	nucl(19.5),cyto_nucl(14),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXR7	Uncharacterized protein	Medium	10	2	1-22, 100-124	MTRPSSPEKKRYQCFVHKQCIP, KNVKDIPDPRKKNQKHDKDGGCGCS	nucl(14.5),mito_nucl(13.666),mito(11.5),cyto_nucl(8.833)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EYF8	Stc1 domain-containing protein	Medium	11.9	1	17-40	VIPVDFKFKCRHCKIFKTQDCFSK	nucl(18),mito(5),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8M7	Uncharacterized protein	Medium	13.2	1	49-72	GPEWEKKSTRTRSRGERSRERERV	cyto_nucl(12.5),nucl(12),cyto(11),mito(2)	KKSTRTRSRGERSR (54-67, prob:0.704),ARGRSREREKSTERVIYVRRRSPRPKSTSGSREREKGRGIDKDK (112-155, prob:0.956)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9S6	Uncharacterized protein	Medium	14.9	2	1-23, 286-315	MSFPPRHSSPPKRPKLSLQIKTP, ESGLETPASRKRKRKDKKRKWRWTIGDGED	nucl(17.5),cyto_nucl(9.5),mito(9)	ASRKRKRKDKKRKWR (293-307, prob:0.994)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6I0	Uncharacterized protein	Medium	13.2	1	293-319	EAEAKKRERAKSKTKSRRHNTKPVEVG	nucl(14),cyto(9),pero(2),cysk(2)	RRAKPPAELEAEAKKRERAKSKTKSRRHNTK (284-314, prob:0.985)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7N0	Uncharacterized protein	Medium	11.8	1	59-90	VIRRKLQNRLNQRASRQRRKLDSRKLKTPTKI	nucl(17),mito_nucl(11.833),cyto_nucl(10.333),mito(5.5)	RASRQRRKLDSRK (71-83, prob:0.731)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAZ4	Kinesin motor domain-containing protein	Medium	14.8	1	1693-1712	EERMNALSSKKKKKGSLNCF	nucl(17),cyto_nucl(10.5),mito(8)	KRKRKEAEL (1679-1687, prob:0.735),LSSKKKKK (1699-1706, prob:0.795)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EC60	BAH domain-containing protein	Medium	12.4	1	294-324	GTGPRANGTKPKDKKKKGGKSKEKIYSKTFN	nucl(17.5),mito_nucl(10.833),cyto(6.5),cyto_mito(5.333)	NGTKPKDKKKKGGKSKEK (300-317, prob:0.987)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EF56	GRIP domain-containing protein	Medium	14.1	1	8-38	DSSDVTSPAKKKNNKKKKHAKSKSNGEIPQV	nucl(23.5),cyto_nucl(15)	AKKKNNKKKKHAKSK (16-30, prob:0.983)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELM0	HDAC_interact domain-containing protein	Medium	14	2	1257-1276, 1357-1378	RWYPKKSEAHITRKERWQYY, GETRQRLKKVEESRNQRFHEKF	nucl(15.5),cyto_nucl(12),cyto(7.5),pero(4)	RGRRPVNGKKADLRRGVLDRGRN (985-1007, prob:0.778)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EYA9	Zn(2)-C6 fungal-type domain-containing protein	Medium	12	1	32-58	WLTFRRRCELCKQRKVKCDRGQPSCGW	nucl(19),cyto(4),pero(2),cyto_mito(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EYU6	Ribosomal protein L15	Medium	14.2	2	61-80, 179-203	IYRVRVRRGGRKRPVPKGAT, GFNKTTAGRRKTWKKHNTLKLQRYR	mito(15),nucl(7.5),cyto_nucl(6.5),cyto(4.5)	RPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG (41-78, prob:0.943),SRGLTATGKKSRGLGKGHGFNKTTAGRRKTWKKHNT (161-196, prob:0.916)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2U0	Uncharacterized protein	Medium	12.4	1	470-496	LCNACGLRWAKKEKKQKPEPLNPSAGP	nucl(19.5),cyto_nucl(14.333),cyto(6),cyto_mito(4.499)	KKEKKQ (480-485, prob:0.65)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F324	Uncharacterized protein	Medium	13.2	1	6-29	GDHISRSRSKVKPVFKKLIQSEKN	nucl(21),cyto_nucl(13),mito(3),cyto(3)	RRKFQEKEKAKEEKAAREEIRAMEKKQQKEARQIERGHRR (239-278, prob:0.894)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F348	BRCT domain-containing protein	Medium	13.5	1	5-37	RPHTSKTSSKSQKIPHQTPSKSKRTKNFYSNGA	nucl(22),mito(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E650	Uncharacterized protein	Medium	13.2	1	22-41	LTQRRGQEWRHNTHRRRQDE	nucl(18.5),cyto_nucl(11.5),cyto(3.5),mito(2)	RRFREWGRAARKRK (74-87, prob:0.784)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EG22	Chitin synthase	Medium	10	2	79-99, 181-205	ATGVSRKRSLIRPERNRIDEN, RGGNKLKRERVQKMSKEEKERQKAL	plas(24),E.R.(1),golg(1),vacu(1)	KLKRERVQK (185-193, prob:0.666)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EW71	DDHD domain-containing protein	Medium	13.6	4	81-105, 180-206, 248-267, 349-377	WLGMGSKRDRKSHNRTCRPKVGIEP, GCPCKGSHLSCRKRAGRCKCASCPKAP, TTDQFKRSKHWEHNCGKGRS, NMDQIKRSKHWEHNCKRGRSERARSEKEL	nucl(17.5),cyto_nucl(13.333),mito_nucl(10.666),cyto(7)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EYA2	Uncharacterized protein	Medium	11.8	1	666-687	LSAVSNRKRKVRASRDKELGRA	nucl(13.5),cyto_nucl(9.5),mito(8),cyto(4.5)	RKRKVRASRDKELGRAARRR (672-691, prob:0.906)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZR8	Uncharacterized protein	Medium	13.4	2	476-500, 571-594	LAKVWRRRERCSKCKTKTHELSRKY, ASLPPLTKKKTRNHLPLNNTKETR	nucl(24.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0K3	Uncharacterized protein	Medium	12.9	1	658-678	EEDNRPRKKSKTLIRRFSSSP	nucl(15),cyto(7.5),cyto_mito(5.5),mito(2.5)	K (665-665, prob:0.602)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F261	Uncharacterized protein	Medium	12.8	1	248-271	ANEALSKRRRARKALIRKRRALSI	nucl(13),mito(11),cyto(3)	LSKRRRARKALIRKRR (252-267, prob:0.98)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3I5	Uncharacterized protein	Medium	11.6	1	19-57	GWGEKVLIGKKKKKKKKKKKKKKKKKKKNVPSNSSTQHS	mito(13),nucl(11.5),cyto_nucl(7.5)	GKKKKKKKKKKKKKKKKKKK (27-46, prob:1)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4N2	Uncharacterized protein	Medium	14.3	2	29-49, 214-245	PIKFLCAKSLKKNKGKGRSTL, PYQLTVNMRAKWRKKRTRRLKRKRRKTRARSK	nucl(16.5),mito_nucl(13),mito(8.5)	RAKWRKKRTRRLKRKRRKTRARSK (222-245, prob:1)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7B5	Autophagy-related protein 11	Medium	10.4	1	437-456	QEEETRRRRKWQKNIGATLW	nucl(21.5),cyto_nucl(13.5),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXC6	FK506-binding protein	Medium	12.7	1	312-335	AEEPKLSKKQQKKLKKNNGDAAPV	cyto(22.5),cyto_nucl(13),nucl(2.5)	KVAKKGKA (143-150, prob:0.706),AEKKGKNK (283-290, prob:0.716),KLSKKQQKKLKKNNGDAAPVKA (316-337, prob:0.852),KK (341-342, prob:0.61)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F059	Uncharacterized protein	Medium	12.3	1	98-122	SRGGTLKKKTSLKRSSSKRSSRAGS	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(4)	KKKTSLKRSSSKRS (104-117, prob:0.735)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0X4	Uncharacterized protein	Medium	13.6	1	15-67	EIGPAKVVAKKKEKRSHRESSSRRDRHRERSPRRERSPRKDTEQPSKNIRNKA	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	VVAKKKEKRSHRESSSRRDRHRERSPRRERSPRK (21-54, prob:0.994)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0Z6	Uncharacterized protein	Medium	14.2	1	191-216	EAWVQRNREERRRRRRSSATVQKRSL	nucl(24.5),cyto_nucl(15)	ERRRRRR (200-206, prob:0.801)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9E9	Uncharacterized protein	Medium	10.7	1	25-51	AGFSTQGKPKKPKENPNIDKRQRRIDE	cyto(14),nucl(8),cyto_pero(8)	PKKPKE (33-38, prob:0.683)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E638	Uncharacterized protein	Medium	14.3	1	123-175	EPEPEPEPEKKKKKHRRRKVKEPEPEEEEEEEAPARKPRRKRRDRPQFLEDGG	nucl(23.5),cyto_nucl(14)	PEKKKKKHRRRKVKEPEPEEEEEEEAPARKPRRKRRDR (130-167, prob:0.997)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9X0	Uncharacterized protein	Medium	13.5	1	762-788	ASINGHTRSPSRKKKRAEDDNEDIERL	nucl(22.5),cyto_nucl(14),cyto(4.5)	SRKKK (772-776, prob:0.693)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBG7	Uncharacterized protein	Medium	12.9	1	488-511	AELKKNGSGKKKKDAENGKGKEKG	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	KKNGSGKKKKDAENGKGKEKGPRGRLED (491-518, prob:0.981)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHT8	Uncharacterized protein	Medium	10	1	120-140	KADELKRLKKRMKSASRSLYL	cyto_nucl(8.5),mito(8),cyto(8),nucl(7),cysk(3)	RKWRRKLGSTKVVLKADELKRLKKRMKS (106-133, prob:0.857)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ER00	ELMO domain-containing protein	Medium	11.1	1	288-310	SENGEKKGSRKHNPEKWRRLGFE	cyto_nucl(11.5),nucl(11),cyto(10),mito(3)	KKGSRKHNPEK (293-303, prob:0.694)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVG0	Reverse transcriptase	Medium	12.9	2	94-124, 1344-1364	QNKKRGPTMPLSNQNKQPRIKNNPTTPKEAI, AISTPRRKRYKPTQLDKIKES	nucl(21.5),cyto_nucl(12.5),cyto(2.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZ86	Methionine aminopeptidase 2	Medium	10.1	1	51-82	EGAGEGGAKKKRKRKKKPKKKAGANPKVQSSP	cyto(18),cyto_nucl(15.5),nucl(9)	GAKKKRKRKKKPKKKAGANP (57-76, prob:1)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0T0	Uncharacterized protein	Medium	11.5	1	140-165	QSSNGDGSRPNKKKKTQRFFCVDFPP	nucl(25.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F571	Uncharacterized protein	Medium	11.9	1	471-499	GSRRSTRSSRSGKDHKKPKVNPNPGVKYF	nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(4)	GSRRSTRSSRSGKDHKKPK (471-489, prob:0.835)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7G2	5'-3' exoribonuclease	Medium	13.9	2	104-123, 367-386	GVAPRAKMNQQRSRRFRAAQ, AIFRRRRKAEENFQKKRKLN	nucl(12),cyto(7.5),mito(6),cyto_pero(5)	RRRRKAEENFQKKRKLNNER (370-389, prob:0.826)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EA77	FMN_red domain-containing protein	Medium	12	1	303-330	VFGDRFSERRERKEKERKEEEKEKMKMN	cysk(12),nucl(10),cyto(3)	RRERKEKERKEEEKEK (311-326, prob:0.851)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDC7	TLC domain-containing protein	Medium	10	2	44-64, 85-104	ALPVMGKRKAKRKDDSPLDII, LTHICFPKARRHTRKFFELS	plas(23),E.R.(2)	KRKAKR (50-55, prob:0.664)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPL9	Peptidase S53 domain-containing protein	Medium	10	1	187-206	VKTKRSTSYLSKRRNRLTKG	extr(18),cyto(2),E.R.(2),golg(2),vacu(2)	KKRSVKTKRST (183-193, prob:0.732),SKRRN (197-201, prob:0.654)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2Y7	Uncharacterized protein	Medium	11.6	1	463-486	RLANTGLSKRRRAKKTQLRLGGAL	nucl(10),cyto(6),pero(6),cyto_pero(6)	KRRRAKK (471-477, prob:0.687)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F447	Uncharacterized protein	Medium	13.3	1	107-126	NEVLSKRRRAKKIQLRNGGV	nucl(19.5),cyto_nucl(13),mito(4)	KRRRAKK (112-118, prob:0.688)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4L3	Poly(A) polymerase	Medium	10.6	1	537-565	FTEGEVKPTRSQKKKKRPASDDAKQAPAK	cyto(14),nucl(7),mito(3),pero(3)	RSQKKKKRPA (546-555, prob:0.887)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6N7	Uncharacterized protein	Medium	12.9	1	477-500	MAMITPKTSRKKSKKETSAYTRGL	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	KKS (487-489, prob:0.621)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBW6	Uncharacterized protein	Medium	10	1	982-1008	GFSNLWGKKAKTKRKYVRLPEEYPRIE	plas(14),nucl(5),vacu(3),mito_nucl(3)	KAKTKR (990-995, prob:0.627)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EE15	CAP10 domain-containing protein	Medium	10.9	1	72-104	KETVSKYRRKYGRHPPPKFKEWYKYARDRKIYN	nucl(9.5),cyto(8),mito_nucl(7),pero(5),mito(3.5)	RRKYGRHPPPK (79-89, prob:0.653)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJH0	Uncharacterized protein	Medium	11.6	1	260-289	GSPGARRNWFFRRRARRRLRSRSMAIRYRS	nucl(17.5),mito_nucl(11.666),cyto_nucl(11.333),mito(4.5),cyto(3)	RRPPNRRLYRGSPGARRNWFFRRRARRRLRSRS (250-282, prob:0.98)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EP05	Uncharacterized protein	Medium	14.5	1	83-114	KTPSRFPQIRSTSRTRRERSSKSPHRSQSPPH	nucl(17),mito(4),cyto(3),plas(2)	KSPPKTPSRFPQIRSTSRTRRERSSKSPHRSQSPPHLRPPLNRRRENSR (79-127, prob:0.906)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPC6	Uncharacterized protein	Medium	10.2	1	1-23	MPLSNQNKQPRIKNNPTTPKEAI	nucl(13),mito(10),cyto(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4V0	Uncharacterized protein	Medium	12	1	183-203	ELQKYKKYAERCRKKQDTIKI	nucl(19),cyto(5),mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8C4	Uncharacterized protein	Medium	10	1	103-126	VGNIYRKPRNRPQNVTKEKRKIEQ	nucl(17.5),cyto_nucl(10.5),mito(7)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAH0	Uncharacterized protein	Medium	13.2	1	9-31	SETYKPARKKRLVRSFYKPPREP	nucl(19.5),cyto_nucl(13.5),cyto(4.5)	ARKKRLVRSFYKPPR (15-29, prob:0.758)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJN8	Uncharacterized protein	Medium	10.9	1	478-498	RVEKLARTKKNIKRNRKTVES	nucl(9.5),cyto_nucl(9),cyto(7.5),plas(5),mito(2)	TKKNIKRN (485-492, prob:0.667)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJV0	Uncharacterized protein	Medium	14.1	1	48-75	QATLRKKFGLLRRKWKREPKPNQFLKLP	nucl(23),cyto_nucl(14.5)	RKKFGLLRRKWKREPK (52-67, prob:0.872)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENN0	Atypical serine/threonine protein kinase BUD32	Medium	13.6	2	17-37, 406-433	SPTFRIRDNIHRRPHRLNPEE, ALERKAHKKAKAAKRKMMREEEERKRAE	cyto(10),nucl(9),pero(6)	RKAHKKAKAAKRKMMREEEERKR (409-431, prob:0.978)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERD9	Carboxypeptidase Y receptor	Medium	10	2	995-1015, 1417-1445	GSKNYKKEKKRLKTLITHNDG, GMGLKMKMKIKRVKKRKGGKEEKKETVIV	plas(8),E.R.(6),golg(4),vacu(4),extr(3)	KMKMKIKRVKKRKGGKEEKK (1421-1440, prob:0.991)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERG3	TBPIP domain-containing protein	Medium	13.2	1	33-61	STASATPIKPKSKKPKVEKTEKSEKVKAT	nucl(12),cyto_nucl(10),mito(9),cyto(6)	KPKSKKPKVEKTEKSEKVKATSKAKTSVKEKVLAKDKEGKESKGKVGAKDGKEVKDTKEIKETKEAKLIGKDGKEK (41-116, prob:0.982),GKREKEERLRGLREGG (251-266, prob:0.71)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ES00	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.5	1	1-38	MTDSEPDHERRRRRPAVSCSFCRRRKIKCNREVPCSNC	nucl(22),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8K2	Uncharacterized protein	Medium	13.3	2	163-183, 201-225	IRKVMVRKRLRLRLRLRLRLR, KFNMRSSKGKRGKGGKGIKKRDFDS	nucl(14.5),cyto_nucl(11.333),cyto(7),cyto_mito(6.333),mito(4.5)	RKVMVRKRLRLRLRLRLRLRLRLRSVSGSKEKKDRVGKFNMRSSKGKRGKGGKGIKKR (164-221, prob:0.997)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7A8	Mitochondrial import inner membrane translocase subunit TIM54	Medium	12.5	1	67-90	AAIIYDKREKKRAQRKWCRLVEHI	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(2)	K (451-451, prob:0.604)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E825	Uncharacterized protein	Medium	10.8	1	62-85	ARAIAAEKKKEKQRKLKAARASAL	cyto(12),nucl(7),mito(6)	AEKKKEKQRKLKAAR (67-81, prob:0.921)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EA41	Uncharacterized protein	Medium	10.2	2	106-127, 253-272	AEQICSRDKNPRKRRSWDHIGA, GKRCTARKLEEEQKKKQKTT	cyto(12.5),cyto_nucl(12.5),nucl(11.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EG34	Uncharacterized protein	Medium	12.4	1	195-217	VTYTPRMSPAPKGKRRKVDHNVE	nucl(15),cyto_nucl(10),mito(9)	KGKRR (206-210, prob:0.675)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGN0	PLD phosphodiesterase domain-containing protein	Medium	10	2	1507-1529, 1723-1745	MNLFKKARARRGPSKLLKRQLKS, ESIPKQKIMKSRPRYPISRRCVE	plas(20),E.R.(3),vacu(2)	KKARARRGPSKLLKRQ (1511-1526, prob:0.876)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EH86	Uncharacterized protein	Medium	13.2	1	877-904	EEAWAEMKKKREQKRSLWKSKKDTSGLS	nucl(21),cyto_nucl(13),mito(3),cyto(3)	KKKREQKRSLWKSK (884-897, prob:0.776)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJD7	Uncharacterized protein	Medium	10.3	1	207-229	RERIYYVKTKLRQRDRKVENWLW	nucl(18.5),cyto_nucl(11.5),mito(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKV9	HTH CENPB-type domain-containing protein	Medium	12.2	1	460-487	RMLRRANEALSKRRRAKKNQLRNGGVLT	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(4)	SKRRRAKK (470-477, prob:0.824)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELW1	Uncharacterized protein	Medium	11.7	1	414-442	EAEINFKGKNGGKKRKRNSLCLTKAKSAT	nucl(18.5),cyto_nucl(13.833),mito_nucl(10.166),cyto(7)	KGKNGGKKRKR (420-430, prob:0.874)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENZ4	Uncharacterized protein	Medium	12.1	2	67-88, 99-121	RSSSPTSKTSTRKQRRQALLAQ, IPNSNSNSKNKNKNKNNDPSENP	nucl(18.5),cyto_nucl(12.5),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPJ5	BAG domain-containing protein	Medium	13.3	1	159-189	EGTASKIRKRIRKSKNKKGKKKSNHNLEAPQ	nucl(19.5),cyto_nucl(11),mito(6)	KIRKRIRKSKNKKGKKKS (164-181, prob:0.996)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERS6	Uncharacterized protein	Medium	10.9	1	57-78	YDQYQVPAKMRKRSRNSIVFDV	nucl(16),cyto(5),pero(3),cyto_mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0Q6	Flap endonuclease 1	Medium	11.7	1	348-387	DEERASLKRKNDEKNEAKKKKVKDEKKEKAKAKAKPRGTA	nucl(13.5),cyto_nucl(12.5),cyto(10.5)	ASLKRKNDEKNEAKKKKVKDEKKEKAKAKAKPRGTA (352-387, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3W5	Uncharacterized protein	Medium	11.2	1	28-51	ASNPNASKRKTRGKAKVGRKGAIK	nucl(11.5),cyto_nucl(10.5),cyto(8.5),pero(5)	SKRKTRGKAKVGRKGAIKP (34-52, prob:0.964)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4P7	Uncharacterized protein	Medium	13.8	2	168-187, 545-567	LDDIDKRRRRSSKAQMSPTS, NTGSTGRRRRTPKRRIVDLSTSE	nucl(15.5),cyto_nucl(12.333),cyto(8),cyto_mito(5.333)	RRRRTPKR (551-558, prob:0.705)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9Q9	Uncharacterized protein	Medium	13	2	1-21, 38-57	MPKTSPQKPPRTLRSRVRTLA, KEEERKEKERKSNHDNQNRW	mito(16),nucl(8),cyto(3)	RKEK (42-45, prob:0.622)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9X5	Uncharacterized protein	Medium	13	1	215-239	IEGFKKKKEEFERKKNERELRKEEI	nucl(20.5),cyto_nucl(14),cyto(6.5)	KKKKEEFERKKNERELRKE (219-237, prob:0.859)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E779	Reverse transcriptase	Medium	14.7	3	1365-1387, 1590-1613, 1617-1636	NCDLCRRSKVPRDKKPGLLKPLS, QRAQDRMAKQHNKHRRTPDFRVGD, LDSRYYKTQRPSRKLDFPNS	nucl(18),cyto_nucl(12.5),cyto(5),pero(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EN54	Ribosomal_L2_C domain-containing protein	Medium	10	1	343-372	PWGQPAKGGYKTRKVRKPNKWVVTARERNH	mito(26)	AKKGHGKGGRNNSGRVTVRHRGGGHKRRI (99-127, prob:0.914),PAKGGYKTRKVRKPNKWVVTARERNHGKRRTK (347-378, prob:0.952)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVU6	Uncharacterized protein	Medium	10.1	1	4-33	HKNSTNQPSKPVRHPIRKRHCSKGKTPMED	nucl(19.5),mito_nucl(13),mito(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1P3	Uncharacterized protein	Medium	11.4	1	177-197	VLPTGRCTRRKTSSRKHLSDE	nucl(23.5),cyto_nucl(13)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1Z2	Uncharacterized protein	Medium	11.6	1	703-743	TKLRIWRRRYGDTSSRRRRRRKSLGKLLKKKSEFRYNRDRI	nucl(13.5),mito_nucl(13),mito(11.5)	WRRRYGDTSSRRRRRRKSLGKLLKKKS (708-734, prob:0.994)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E700	Uncharacterized protein	Medium	10.6	1	62-94	KAGFASKSRRGKKLQRERVQKMFKKEKARQEAL	cyto_nucl(10),nucl(9),cyto(9),plas(3),mito(2),pero(2)	SKSRRGKKLQRERVQKMFKKEKA (67-89, prob:0.937)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9G0	Uncharacterized protein	Medium	13.9	1	25-52	NLKGRKPRRSTARSRRSHKLYNTKDRID	nucl(22.5),cyto_nucl(12.5),mito(3)	KGRKPRRSTARSRRSH (27-42, prob:0.89)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EC65	Uncharacterized protein	Medium	14.7	2	123-146, 213-239	ALVEKKTGKRQSARAHQKQKDVDA, VFSRKGSKVVKERRQQKERQKQAQEAT	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	KKVAAKGAVRRPVARRPGRG (981-1000, prob:0.876)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGG4	Pre-mRNA-splicing ATP-dependent RNA helicase prp28	Medium	14.9	2	59-84, 241-266	PSELQPPPPEPKKKKGWGAPKPGPLS, ETNQSTFSAKKKRRRTTEKKFNFEWN	cyto(14.5),cyto_nucl(13.5),nucl(11.5)	PPEPKKKKGWGAPKPGPLSIEDILKKKKEADEAAAKPKFLSKAAREKLALEKRAKEVEEQRRKR (66-129, prob:0.966),KKKRRR (250-255, prob:0.79)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EK75	DH domain-containing protein	Medium	13	1	510-534	MGNQKDKKDRKDKNKIKEKDKNAKL	nucl(15),mito(5),cyto(5),cyto_mito(5)	GNQKDKKDRKDKNKIKEKDKNAKL (511-534, prob:0.959)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQG2	Uncharacterized protein	Medium	11.6	1	301-322	QEAFRRLQQRPTKQRAMCNFTR	nucl(12),mito(7.5),cyto_mito(7.5),cyto(6.5)	GKKR (276-279, prob:0.644)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ES21	Uncharacterized protein	Medium	13.1	2	15-39, 295-314	NANISSRKRSGDRPKQGRRYSENSE, KDTSNQKRRLNEEKKKPGLS	nucl(22),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXI9	Uncharacterized protein	Medium	11	1	911-942	QDCIERKDRADRRARRKNRKRVIEKKKSFGDL	nucl(10.5),cyto_nucl(9.5),cyto(7.5),mito(2),plas(2),E.R.(2),golg(2)	RKDRADRRARRKNRKRVIEKKKS (916-938, prob:0.994)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZV6	Uncharacterized protein	Medium	10.5	1	55-80	KRNQNTKSSFKKPSPSKNNNPYPESG	nucl(22.5),cyto_nucl(14),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1F8	Uncharacterized protein	Medium	11.8	1	1-21	MWWYKRRERERVRVRARVRVR	nucl(14),cyto_nucl(10),mito(9),cyto(4)	KRRERERVRVRARVRVRMRERR (5-26, prob:0.9)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7G9	Uncharacterized protein	Medium	13.3	2	381-402, 458-478	RFETPAKLQKHKREGHRNSTSV, IHNSSKQKLRCKYCTEEKTFS	nucl(25),cyto_nucl(14.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBX4	Uncharacterized protein	Medium	10.1	1	227-246	GFGSRDKRKRWSVCGAERRG	nucl(19.5),cyto_nucl(13),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECH8	Uncharacterized protein	Medium	11.4	1	35-60	LSTSNTPDKKAQSRKHKQVQANEGMS	nucl(23.5),cyto_nucl(13)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHR3	Ubiquitin carboxyl-terminal hydrolase	Medium	12.2	1	174-202	ATPNTAAPWPARRRRKRKQSPEISTNPVE	mito(12),nucl(11),pero(3)	ARRRRKRK (184-191, prob:0.906)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJZ6	Uncharacterized protein	Medium	13.4	1	209-233	TEPVPVTKRRGRPPKNPGAPRKSTT	nucl(21.5),cyto_nucl(13.5),cyto(4.5)	KRRGRPPKNPGAPRK (216-230, prob:0.874)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EK79	Uncharacterized protein	Medium	13.6	1	96-121	RMIEGKEKGEKRKEKRERRKAERKRA	nucl(20.5),cyto_nucl(12),mito(4)	GKEKGEKRKEKRERRKAERKRA (100-121, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKP8	Uncharacterized protein	Medium	11.7	2	203-223, 227-247	CPLGPRCSKKHIRKAICEFYL, CPDGSKCKKAHPRWPSDLPKP	mito(12),nucl(5.5),cyto_nucl(5.5),cyto(4.5),pero(4)	RGFPEGRPRQRWRGGFGFRGRGGGGERGQRGRGH (277-310, prob:0.926)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EN26	GPN-loop GTPase	Medium	10.1	1	268-293	ERDYKPELERRRKQRDAEKEENREKE	nucl(19),cyto_nucl(13),cyto(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQ51	BHLH domain-containing protein	Medium	11.2	1	175-195	DEWHKVRKDNHKEVERRRRET	nucl(24),cyto_nucl(14.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQG3	Uncharacterized protein	Medium	10.8	2	59-82, 965-987	LDPGFEKELKRRHRILKYKYLEAL, WEDKSETERKKPGKTKRVLLGGA	mito(7),cyto(6.5),cyto_nucl(5),golg(3),nucl(2.5),extr(2),pero(2),E.R.(2),vacu(2)	KKPGKT (974-979, prob:0.666)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWN0	SAP30_Sin3_bdg domain-containing protein	Medium	10.7	1	116-137	MSPTMVRKKEHKRQSKEQLANT	nucl(22),cyto_nucl(13.5),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F388	Tr-type G domain-containing protein	Medium	12.4	1	534-554	ERAELKKQRKREKAAKKAAAP	cyto(13.5),cyto_nucl(12),nucl(9.5),mito(2),pero(2)	PKNAHSKVAKKAARRQ (502-517, prob:0.8),AELKKQRKREKAAKKA (536-551, prob:0.956)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8A2	Uncharacterized protein	Medium	11.5	1	1031-1064	VSTKKKAKLSSAELRKKKKDRMARRKRGEEVFTD	cyto_nucl(14),nucl(13.5),cyto(11.5)	KKKAKLSSAELRKKKKDRMARRKR (1034-1057, prob:0.995)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDI5	Uncharacterized protein	Medium	11.6	3	144-163, 274-298, 728-747	TSIKERIKRLHRNINWIQMV, NACIDKYKGCRKLPKIKDGKPAPEE, LTMPPSPRRKRDQNPTDGRR	nucl(5),cyto(5),cyto_nucl(5),plas(4),extr(4),E.R.(3),golg(3),cyto_pero(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKL8	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	Medium	12.8	1	122-148	RGDNRDNGGKKKKKEKGQNKDRQFGSW	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	NRDNGGKKKKKEKGQN (125-140, prob:0.963)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMJ8	RING-CH-type domain-containing protein	Medium	10.2	1	467-487	VVLYCKWKKARDFGKKKIIDF	plas(9),cyto(8),nucl(6),mito(2),pero(2)	KARDFGKKKIIDFAGKGK (475-492, prob:0.731)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENG4	Uncharacterized protein	Medium	11.1	1	140-182	WLVKHEPKNSRKQGKAKQSKAKQSKTRQGKSFRQERKPHGPSM	mito(14),nucl(9),cyto(2),pero(2),cyto_pero(2)	PKNSRKQGKAKQSKAKQSKTRQGKSFRQERKPH (146-178, prob:0.973)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWK8	Uncharacterized protein	Medium	11.6	1	262-282	EKENERRKILRQKLKERERIL	nucl(12.5),cyto_nucl(11),cyto(8.5),mito(3)	RRRKKA (367-372, prob:0.73)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F152	Uncharacterized protein	Medium	11.3	1	162-184	ITVPEKPLSRAERRRKIKEDLLT	cyto_nucl(11.5),mito(11),cyto(10),nucl(5)	KKTRSRK (114-120, prob:0.649),RRR (174-176, prob:0.615)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5P1	Uncharacterized protein	Medium	12.8	1	1-29	MVFDPQQRRRSNRRKKSVKTRQILECQTC	nucl(16.5),cyto_nucl(10),mito(8)	RRRSNRRKKS (8-17, prob:0.804)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAS2	Uncharacterized protein	Medium	14.4	1	539-558	QPSEPIRKITHKRRRDDDLD	nucl(24.5),cyto_nucl(13.833)	SRK (282-284, prob:0.611)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDK6	Uncharacterized protein	Medium	13.5	1	144-164	EAEERKRKKMAEKRKEVNLSP	nucl(21),cyto_nucl(13.5),cyto(4)	ERKRKKMAEKRKE (147-159, prob:0.936)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHK6	Uncharacterized protein	Medium	10.8	1	2-25	DGCIDQPRRRSRMRKFMQRGRESW	nucl(15),mito(6),cyto(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKQ4	Glyco_transf_28 domain-containing protein	Medium	11.2	2	34-53, 1220-1239	LSQHERRHSRHQEETARPSV, AGVGRCAMKRAKKMKISREL	cyto(12),cysk(10),nucl(3)	KLHEERKAKR (1050-1059, prob:0.704)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPC9	Uncharacterized protein	Medium	13	1	15-43	PTSTSSPPIQHRQNRRRERPGSRARRTIS	nucl(17.5),cyto_nucl(10.5),mito(7)	NRRRERPGSRARRTISR (28-44, prob:0.873)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETC1	CBFD_NFYB_HMF domain-containing protein	Medium	11.4	1	233-254	GFTPANKPRKQQQQQQRRTSSG	nucl(24.5),cyto_nucl(13.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F978	Uncharacterized protein	Medium	10.3	1	248-270	RDSNREHSKKDRDTRTVPRRQGT	nucl(20.5),cyto_nucl(14),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6S3	Uncharacterized protein	Medium	10.8	1	5-27	LSDAIIVKRKYKRQNRDIASVNS	nucl(21.5),cyto_nucl(12.5),mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E8I7	HTH psq-type domain-containing protein	Medium	10.5	1	106-127	ANEALSKRRRARKVLIRKEGAF	mito(17),nucl(7.5),cyto_nucl(5)	SKRRRARKVLIR (111-122, prob:0.857)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EC70	Uncharacterized protein	Medium	11.8	1	76-100	RLASKDQKKAAKDRKVRNSKTMPGP	nucl(20),cyto_nucl(13.333),mito_nucl(12.499),mito(3.5),cyto(3.5)	QKKAAKDRKVRNSKTMPGPAKVK (82-104, prob:0.865)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMA9	Uncharacterized protein	Medium	11	1	211-232	GFIGRRITRKKGKKVTEPEDDE	cyto(11.5),cyto_nucl(11.5),nucl(10.5),pero(2)	TRKKGK (218-223, prob:0.705)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EY47	AAA domain-containing protein	Medium	13.7	1	741-804	ESDDSEARRKKKSSKRKKEKKSKSSNKKSKKISEKDEKSEKKSKEKKKERKKKKEETEESEESE	nucl(21.5),cyto_nucl(13),cyto(3.5)	RRKKKSSKRKKEKKSKSSNKKSKKISEKDEKSEKKSKEKKKERKKKK (748-794, prob:1)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F392	18S rRNA aminocarboxypropyltransferase	Medium	12.4	1	8-33	NFSSRGKKYSNPPRNRGPRNNSDDES	nucl(20),mito(4),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8U4	Reverse transcriptase	Medium	14.5	2	207-227, 377-402	NRDRGKYHKNEGRPRENRQSY, EATGWFPQRKAKRPYKKGRSEKLSSH	nucl(17.5),cyto_nucl(12),cyto(5.5),pero(4)	RKAKRPYKKGRS (385-396, prob:0.842)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4J1	Enhancer of polycomb-like protein	Medium	14.9	1	2-26	RTQPAGRVVRQKKLNRSTHQQILRE	nucl(20),mito(3),cyto(3),cyto_mito(3)	RIGR (461-464, prob:0.608)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E623	Uncharacterized protein	Medium	11.4	1	112-137	PASTKKGAGKKKATGKKKKIEDEGLT	nucl(14.5),cyto_nucl(12.333),cyto(9),cyto_mito(6.333)	RETKREGSVPASTKKGAGKKKATGKKKK (103-130, prob:0.992)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6M6	40S ribosomal protein S24	Medium	10.2	1	99-129	FATKIEKASRQQRKQRKNRQKTLRGTAKVKG	mito(13),cyto(8),nucl(6)	KASRQQRKQRKNRQKTLRGTAKVKGAKKKKE (105-135, prob:0.993)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7E9	Uncharacterized protein	Medium	14.3	2	107-134, 890-951	DGSIQRPKPHSTRNKKAYKDRRTYSYYP, KEEVKVKEEKKEEKKEEKKEEKKEEKKEEKKEEKKEEKKEEKKEEKKEEKKEEKKEEKDTGE	nucl(17.5),cyto_nucl(14),cyto(9.5)	KVKEEKKEEKKEEKKEEKKEEKKEEKKEEKKEEKKEEKKEEKKEEKKEEKKE (894-945, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EM62	Uncharacterized protein	Medium	14.5	3	55-79, 363-384, 419-438	KLWAHRFVKRCTKLKTRFSRVYDFQ, KANEALSKRRHVKKTQLHQGGV, STNRCCSKCGKTGHNSRTCS	nucl(17.5),cyto_nucl(12),cyto(5.5),pero(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EV56	Uncharacterized protein	Medium	12.3	1	12-44	SLSRHAKVPKARDHKKKKEKKKENTILLRKRLV	nucl(16.5),mito_nucl(13),mito(8.5)	HAKVPKARDHKKKKEKKKENTILLRKRL (16-43, prob:0.997)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EY99	Uncharacterized protein	Medium	13.2	1	312-352	SSPPAEKDNTKKKEKKKRSEEERKARKEKKRRLAEANGTIP	nucl(21.5),cyto_nucl(14),cyto(5.5)	NTKKKEKKKRSEEERKARKEKKRR (320-343, prob:0.997)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZ04	G-patch domain-containing protein	Medium	14.5	1	78-105	FYVGEKRQRGGRKRRKKNREEQAVAQDW	nucl(16.5),cyto_nucl(11),mito(5),cyto(4.5)	KRQRGGRKRRKKNR (83-96, prob:0.982),KRKKKSDAEGGGFRDSGGRGKIIGGKK (311-337, prob:0.825)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4M5	Uncharacterized protein	Medium	10.7	1	868-890	LEATQGKRSKKGKKMQALMEYRH	nucl(9.5),mito(8),cyto_nucl(8),cyto(5.5),pero(4)	KRSKKGK (874-880, prob:0.704)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E669	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.5	1	23-58	EGQPPAKRRRVNAACRTCRKRKTRCDGKRPLCSTCT	nucl(25.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBV5	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.2	1	6-46	EADAMKVSQRKRRVHKKSRKGCRNCKLRRVKCDEARPSCLK	nucl(13),plas(10),E.R.(2)	RKRRVHKKSRKG (15-26, prob:0.911)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDI9	Uncharacterized protein	Medium	10.2	1	375-394	PPAVRYSKSQGKKNNQEEHP	nucl(20),cyto_nucl(13.5),cyto(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHC9	Uncharacterized protein	Medium	11.3	1	56-97	QITKYPNTKKATKKSNNEVKYCSDRCRNRKPGKLDKKIEQTI	mito_nucl(14),nucl(13.5),mito(13.5)	RRKNRK (149-154, prob:0.67)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELB1	Uncharacterized protein	Medium	12.4	2	636-662, 887-911	SSKNAETPKKPPRNKRQNSKEKKMQGV, RFLGLRRLLRKSKKRQHLSNLKGLG	plas(19),E.R.(4),nucl(1),mito(1),pero(1),golg(1),mito_nucl(1)	ETPKKPPRNKRQNSKEKK (641-658, prob:0.905),RRLLRKSKKR (892-901, prob:0.74)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQX9	Uncharacterized protein	Medium	10	1	95-118	MQFKVKAKEKVGKRPRPNNFQVYT	mito(10),cyto_nucl(9.333),cyto(8.5),nucl(8),cyto_pero(5.166)	KEKVGKR (102-108, prob:0.637)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ET63	HTH CENPB-type domain-containing protein	Medium	10.2	2	56-77, 204-225	LWAHRFVKRCTKLKTRFSRVYD, EWLKHFDKYTSQRRKGKYRMLV	nucl(11.5),cyto(9.5),mito_nucl(7),cyto_pero(5.5),cysk(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EX63	AAA domain-containing protein	Medium	11.1	1	54-78	SEETVSGKKKSRRPRKEDLILDQYE	nucl(11.5),cyto_nucl(11),cyto(7.5),cysk(7)	KKKSRRPRK (61-69, prob:0.842)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F058	Threonyl-tRNA synthetase	Medium	10.2	1	17-44	NVAIGEKKPKAPKAPKPKKEKGGDSGAD	cyto(13.5),cyto_nucl(11.5),nucl(8.5),pero(5)	EKKPKAPKAPKPKKEKG (22-38, prob:0.985)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F088	Uncharacterized protein	Medium	11.3	1	88-108	GPKDWNPEKRRRKAELYGNCW	nucl(9),cyto(8),mito(6),plas(2),pero(2)	VPAKKRRRTSPAAPAAAGTGGGITKPRRGRPPGGSKKKKL (143-182, prob:0.994)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F505	Uncharacterized protein	Medium	10.5	1	84-106	QFMKLKLSTRRRKDKGKEGRWVK	mito(14),nucl(8.5),cyto_nucl(7),cyto(4.5)	TRRRKDKGKEGR (92-103, prob:0.848)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F639	YL1_C domain-containing protein	Medium	10.9	1	19-48	DVHSIRKPFRNPHWRPNQRRNKNIKTILGD	nucl(21.5),cyto_nucl(12),mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F736	Uncharacterized protein	Medium	14.1	1	123-153	AEKAKKKEKAAAEKSKKRHGSSSRKSRHSSG	nucl(23),cyto_nucl(14.5)	EKAKKKEKAAAEKSKKRHGSSSRKSRH (124-150, prob:0.992)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F989	Uncharacterized protein	Medium	12.5	1	52-81	PLSSTSKKQYQNRNRRKHLKKLPNIAPQRQ	nucl(16),mito(10),cyto_nucl(9.5)	RRKH (66-69, prob:0.628)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9K0	Uncharacterized protein	Medium	11.2	1	111-140	SIEALRRKYTEKKRGRKAQKNKGRRQGLAG	mito(21),nucl(3),cyto(2)	RRKYTEKKRGRKAQKNKGRRQ (116-136, prob:0.986),KLRIRLKQKK (683-692, prob:0.753)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9Q4	Uncharacterized protein	Medium	10.4	1	241-261	GYYFVRKHRRRGGKNMPPSTE	cyto(7),nucl(6),mito(4),plas(4),cyto_pero(4)	RRR (249-251, prob:0.629)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELY5	Manganese lipoxygenase	Medium	10.1	1	30-61	PKMANSTKEKRPNIIRRPIRRLNKNQPKVPGI	nucl(6),plas(6),cyto_mito(5),mito(4.5),cyto(4.5),pero(3)	KEKRPNIIRRPIRRLN (37-52, prob:0.755)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EM87	Matrin-type domain-containing protein	Medium	10.2	1	451-473	DALKLWDKLQREKKKGKTEETGV	nucl(13),cyto(10),pero(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERV0	Uncharacterized protein	Medium	12.2	1	155-200	ESTQAAKGKEKRGRKRKGKPEVGEEDIDTAKHSRKRKNAAQDPPEP	cyto_nucl(9.833),nucl(9.5),mito_nucl(9.166),cyto(8),mito(7.5)	AKGKEKRGRKRKGKPE (160-175, prob:0.994),SRKRK (187-191, prob:0.654)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EV18	Uncharacterized protein	Medium	13.3	1	39-66	VREAEEKPKEKKPRRRPRKHPIEELEEE	nucl(19),cyto_nucl(12),mito(5)	EKPKEKKPRRRPRKH (44-58, prob:0.991)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVN0	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase	Medium	12.2	1	273-297	GEAQPRPQPPQRSRSRAKRRFSGST	nucl(16),cyto_nucl(13.5),cyto(9)	PRPQPPQRSRSRAKRR (277-292, prob:0.815)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3J1	Exonuclease 1	Medium	10.9	2	60-80, 455-477	ATEKDREKRREDSKRIGQDLL, DSPSISKVSKRKNKQKEDITIFS	nucl(18),mito_nucl(11.833),cyto_nucl(11.333),mito(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3V3	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.4	2	41-77, 81-106	PDIRPDIRPGRQRVKRACQPCKSRKKRCDGSEPCATC, GYECHYELGPRKRRRHTLKDHDTDVS	nucl(23.5),cyto_nucl(13)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6C1	MICOS complex subunit mic60	Medium	11	1	109-135	PPPSSSPPPPAPKPKRRFFRKFFTTLF	mito(13),nucl(10.5),cyto_nucl(7.5),cyto(3.5)	PPPAPKPKRR (116-125, prob:0.784)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F892	UBA domain-containing protein	Medium	12.3	2	3-29, 264-287	VSTTRLRENVKSKRRGVKLREDLNQSS, IQNHYRPCLRRIKKRNLHDHFHHD	nucl(19.5),cyto_nucl(10.5),mito(7)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E912	BZIP domain-containing protein	Medium	12.7	1	145-169	STAASARFRQKKKQREKILELNVKQ	nucl(16.5),cyto_nucl(11),cyto(4.5),mito(3)	QKKK (154-157, prob:0.652)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9W1	Ubiquitin-like domain-containing protein	Medium	10.2	1	40-59	LPKMRKPPAKRQKLAPGQER	nucl(11),cyto_nucl(9.666),mito_nucl(9.166),cyto_mito(7.166),cyto(7),mito(6)	KMRKPPAKRQK (42-52, prob:0.775)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAP8	Uncharacterized protein	Medium	13.3	1	64-90	TEESTPSTRPPKKKRGRKIPPVERAYI	nucl(20),cyto_nucl(11.5),mito(6)	RPPKKKRGRKIP (72-83, prob:0.951)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EM90	Reverse transcriptase	Medium	14.8	2	236-257, 406-432	NRDRGKYHKNEGRPRENRQSYR, EATGWFPQRKAKRPYKKGKSEKLSSHD	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	RKAKRPYKKGKS (414-425, prob:0.862)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMT8	Uncharacterized protein	Medium	11.5	1	373-398	HGISIECMKKKRKKAEKKGVDRKIVI	plas(10),nucl(9),mito(3),E.R.(2),cyto_mito(2)	KKKRKKAEKKGV (381-392, prob:0.963)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPK7	Uncharacterized protein	Medium	14.8	2	7-30, 288-314	TDPTRETVGQRKHRKDQASTRGSS, VASLKSSGSRRRRKARGRNRSPSNSEQ	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	GSRRRRKARGRNR (295-307, prob:0.953)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERW3	Uncharacterized protein	Medium	13.7	1	387-411	RVQPARLRAKGKRVRWEPKEHETIL	nucl(22),cyto_nucl(13.5),cyto(3)	LRAKGKRVR (393-401, prob:0.718)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETR6	Uncharacterized protein	Medium	10	1	82-103	VCQGAKSIKNQKRKARAQPITT	nucl(19),cyto_nucl(12),mito(4),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F786	Uncharacterized protein	Medium	11.2	1	49-70	GGTPDEKKKQAEKEQKEREKAA	nucl(13.5),cyto_nucl(11.333),cyto(8),cyto_mito(5.333),pero(4)	KKKQAEKEQKEREKA (55-69, prob:0.689)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEH4	Uncharacterized protein	Medium	13.2	2	23-42, 592-615	TSRARSAIRRHPLRGNQSRP, QGLEWFRRPRTNRTHGRRAMNASS	nucl(24),cyto_nucl(14.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQK8	Uncharacterized protein	Medium	11.7	1	127-153	QKFSRYGREGNKRPKGKRIKSNEEGAW	nucl(13),cyto_nucl(10),mito(7),cyto(5)	REGNKRPKGKRIK (134-146, prob:0.903)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ER87	Uncharacterized protein	Medium	14	1	24-53	LIASKVRGRTNKDCRKRWSKVGKEVNKGLW	nucl(18),mito(4),cyto(4),cyto_mito(4)	RKGRLKRRK (148-156, prob:0.777)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZW2	Uncharacterized protein	Medium	14.7	2	595-615, 1069-1088	AKTPVSKRSLRRTVRKAKRAF, SETWWPGRTRLKKNASNKSI	nucl(14),mito(7),cyto(3),pero(3),cyto_pero(3)	HRTAKTPVSKRSLRRTVRKAKR (592-613, prob:0.861)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1D7	Uncharacterized protein	Medium	11.4	1	29-51	IAFVSRKAENRHHYKNKSRGGHS	nucl(23.5),cyto_nucl(13.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2G3	Uncharacterized protein	Medium	11.7	2	1091-1111, 1405-1431	AISTPRRKRYKPTQLDKIKES, LLISCPIYKTKRKEIFKKIPLSKNTIQ	nucl(15.5),cyto_nucl(9.5),mito(8)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F740	Uncharacterized protein	Medium	14.2	1	1037-1057	SATYHKRQQRSRQASRDRSGR	mito(13),nucl(11),cyto(2)	QRSRQASRDRSGRGRSSSRKPKAREASEERG (1045-1075, prob:0.958),QASRVRRQSPESRKASSRQASRNASRRPPSPDTRLGGRDARGRSAGRG (1132-1179, prob:0.892)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F755	Uncharacterized protein	Medium	10.5	1	133-152	QNALQRQDRKKYMKVRRDTE	mito(11),nucl(8.5),cyto_nucl(6.5),cyto(3.5),plas(2),pero(2)	KKKRKR (33-38, prob:0.761)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7L4	AAA domain-containing protein	Medium	10.8	1	90-113	IWFPTIYGKKKGKKEKEDENVISS	cyto(11.5),cyto_nucl(11.5),nucl(10.5),pero(4)	KKKGKK (98-103, prob:0.682)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E738	Uncharacterized protein	Medium	13.7	1	267-312	IEMEKASNEKHKKRAEKREKEAKEKKDAEWRRKERAQRLDEKAEKE	nucl(21.5),cyto_nucl(13.5),mito(3)	EKHKKRAEKREKEAKEKKDAEWRRKERAQRLDEKAEKE (275-312, prob:0.996)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBG8	Uncharacterized protein	Medium	10.8	1	540-561	AEHDLKHRKKDEKRLRLDLSKH	nucl(21.5),cyto_nucl(12.5),mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDF1	YjeF N-terminal domain-containing protein	Medium	10.8	1	183-211	VEPALAKSGRRTRKRNNRGKKPVERAFQE	mito(16),cyto(8),nucl(2)	KSGRRTRKRNNRGKKP (189-204, prob:0.956),TRRPESK (331-337, prob:0.637)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EM08	Uncharacterized protein	Medium	10.7	1	37-61	VAPRSKPAKKFMYRVKNKRTRDTAI	mito(15),nucl(9),cyto_mito(9)	APRSKPAKKFMYRVKNKR (38-55, prob:0.784)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EN40	FAM192A_Fyv6_N domain-containing protein	Medium	13.7	1	135-159	EDEWGTTSRKRKRTKDKEVLKGVKV	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	RKRKRTKDKEVLKGVKVRR (143-161, prob:0.898)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQT2	Uncharacterized protein	Medium	13.2	1	13-34	EDERKLSKKGKKHNAREGKIFR	nucl(20.5),cyto_nucl(13.5),cyto(5.5)	RKLSKKGKKHNAREGK (16-31, prob:0.899)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E488	Uncharacterized protein	Medium	13.1	1	127-151	AGNIVPKTKKRKILKTERERETKHY	nucl(19),cyto_nucl(12.5),cyto(4),mito(2)	PKTKKRKILKT (132-142, prob:0.829)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFU9	Uncharacterized protein	Medium	13.6	1	1-22	MAKKKSSKKAASKARECCHEKK	nucl(21.5),cyto_nucl(13),mito(4)	KKSSKKA (4-10, prob:0.671)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGK0	G-patch domain-containing protein	Medium	13.3	1	32-58	EPSKPREKETYTQRRHRIQRESEARSR	nucl(22),cyto_nucl(14.5),cyto(5)	RKRRFREEVEREGKRV (137-152, prob:0.714)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGU0	WD repeat-containing protein jip5	Medium	11.3	1	399-428	DSSDEEDGGRKKRKKKKRGKKGQVGNGILG	cyto_nucl(14.5),nucl(13.5),cyto(12.5)	GRKKRKKKKRGKKG (407-420, prob:0.999)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMM7	C2H2-type domain-containing protein	Medium	14.7	1	287-306	QAEMRKKKAKRIGQMRQIFG	cyto_nucl(12.5),cyto(11.5),nucl(10.5),cysk(5)	ERQKKMNRVNQFKGAKRKKLLDKMLPRKK (155-183, prob:0.943),TKGRKKKL (251-258, prob:0.784),RKKKAKR (291-297, prob:0.719)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EU28	Uncharacterized protein	Medium	13.4	2	121-143, 214-233	RHQLHSRRAKFKRSLKGFKQYVR, IAHYHRKTWKRREKLGLPEL	nucl(11.5),cyto_nucl(8),plas(7),mito(4),cyto(3.5)	KRR (439-441, prob:0.631)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EX79	Uncharacterized protein	Medium	11.6	1	39-62	GRSKSMWWKKIVRKSKQLKKTEDS	nucl(18),mito_nucl(12.999),cyto_nucl(11.833),mito(6.5)	KKVKPSNRERAPAGGQISGVKLHTRGRSKSMWWKKIVRKSKQLKK (14-58, prob:0.887)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4L4	DUF2183 domain-containing protein	Medium	14.6	1	767-794	GAPGNKKLDLWKRRWKRAKDILETQDVT	nucl(19),cyto_nucl(14.5),cyto(8)	RGGK (15-18, prob:0.616),KRRWKR (778-783, prob:0.672)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6R7	Uncharacterized protein	Medium	14.6	2	36-58, 829-852	DCDTEHKVAKYKKTNNFENHLKS, NGLMMKRRLRDRGLRRDRGRVGRG	nucl(15.5),cyto_nucl(10),mito(8)	KRRLRDRGLRRDRGRVGRGGTGGKGGKGGRL (834-864, prob:0.979)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7E4	Glyco_transf_28 domain-containing protein	Medium	12.6	2	115-136, 675-698	EDIPAEKKKRTQMPGRKNTDTG, PFKVRKTIKRRSMHEERKKRKSEE	cyto(13),nucl(7),pero(4),mito(3)	KVRKTIKRRSMHEERKKRKSEEIRKSGS (677-704, prob:0.982)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8P1	Uncharacterized protein	Medium	11.2	1	1-23	MRERVVVRRRRRRVERGVMGRFG	mito(16),nucl(9),cyto(1.5),cyto_pero(1.5)	RRRRRR (8-13, prob:0.698)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F992	Uncharacterized protein	Medium	13.6	1	609-641	TPSRKDIKGKKEGGKGKGKGKGKGKKDENDDEE	plas(11),nucl(4),E.R.(4),pero(3),mito_nucl(3)	KKEEGKEKGKNEEGKEEGKNIKGGEKEKEEKK (497-528, prob:0.874),RKDIKGKKEGGKGKGKGKGKGKK (612-634, prob:0.997),PKSKARDGIDAKKMIERKVEGK (657-678, prob:0.68)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E406	Uncharacterized protein	Medium	13.4	2	4-28, 31-58	SDQPTTPPRTPRRAQQNQPASQNKP, ALPDHSSRKSTNKRRPKNVQTSPATTRN	nucl(26),cyto_nucl(14.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELL2	Uncharacterized protein	Medium	11.9	1	345-384	EKKANKVQKAEDKRRQDEQKAADKKKKNDERMERDVKKDS	nucl(18),cyto_nucl(12.333),mito_nucl(10.333),cyto(5.5)	KKISTEAEKKANKVQKAEDKRRQDEQKAADKKKKNDER (338-375, prob:0.915)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMV8	Ribonuclease H2 subunit B	Medium	14.7	1	412-434	EIETRAEKKRKQDEEDRRRKAGE	nucl(17.5),cyto_nucl(11),mito(5),cyto(3.5)	EKKRKQDEEDRRRKAGESRGVKNLKKVNTSGMKKMS (418-453, prob:0.95),FKKK (456-459, prob:0.659)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EW95	DNA-directed RNA polymerase subunit	Medium	10.6	1	95-118	LRLLRSKCKYCHQFKMSRKEVNRY	cyto(12),nucl(7),cysk(5),pero(3)	KALGKKKVEKAGK (1338-1350, prob:0.756)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWU6	Uncharacterized protein	Medium	10.6	1	1097-1119	NCDLCRRSKVPRDKKPGLLKPLS	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4L1	DUF2235 domain-containing protein	Medium	10.6	1	539-570	QRVKYQESLMHRRRKKKKRRSHRTSTRSTGEK	cyto_nucl(10),nucl(9.5),cyto(9.5),cysk(8)	HRRRKKKKRRSHR (549-561, prob:0.994)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFY2	F-box domain-containing protein	Medium	13.4	1	1134-1162	AQNVKNAKRKGWRKSMTTKKAKHKSDAAS	nucl(14),mito(7),cyto(5)	KNAKRKGWRKSMTTKKAKHK (1138-1157, prob:0.932)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGU6	Uncharacterized protein	Medium	13.9	3	615-634, 1430-1454, 1522-1550	YILERLRKVHRHRRNSTFPD, EPEIIRKTPSKPKSSRPQPILPVSP, PEPEPKAKPVSRRPSTRTPRNISQSKPNF	nucl(14.5),cyto_nucl(12),cyto(8.5),pero(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERJ7	Uncharacterized protein	Medium	14.2	1	172-201	RSSAPKYVDEFRKRRKKRGTRIRDICHIGS	nucl(24),cyto_nucl(14.5)	RKRRKKRGTR (183-192, prob:0.928)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUU4	Uncharacterized protein	Medium	14.3	1	45-79	ADKKRGCGKRLPSKYKVKRFSTKRRTLKSNENSKL	nucl(25),cyto_nucl(14.5)	KRGCGKRLPSKYKVKRFSTKRR (48-69, prob:0.818)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXM2	Uncharacterized protein	Medium	10	2	926-971, 1013-1032	IMKSMKQPYKSSRKPTPKSDKPKKATKSKSKTKKSKKTGTATAEEA, LEAIKKSKENSEKGKKEDIK	E.R.(9),cyto_mito(3.333),mito(3),extr(3),golg(3),mito_nucl(2.833),cyto(2.5),plas(2),vacu(2)	KSSRKPTPKSDKPKKATKSKSKTKKSKK (935-962, prob:0.995)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EYL3	Mediator of RNA polymerase II transcription subunit 1	Medium	12.5	2	302-321, 578-603	QEKRRIPTKGREKNRKTWSL, TPTLTSIPKQEKEKKDKSKHLDVSLT	cyto_nucl(9),nucl(8.5),cyto(8.5),mito(8)	RRIPTKGREKN (305-315, prob:0.666)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZL5	RNase H domain-containing protein	Medium	11.9	1	581-606	LISCPIYKTKRKEIFKKIPLSKNTIQ	nucl(20),mito(3),cyto(2),pero(2),cyto_pero(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1X5	Uncharacterized protein	Medium	14.4	2	52-74, 127-147	GSNERIERPKNDRRKTTYTFPIK, REAKPRSKSVSKPRVPFKPKT	nucl(14),mito(9),cyto_nucl(9)	KPRSKSVSKPRVPFKP (130-145, prob:0.723)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2B6	Fungal_trans domain-containing protein	Medium	10.4	1	226-250	QTWQNGPEARRRMRKKRYSDIVAMA	extr(7),nucl(6),mito(4),cyto(4),cyto_mito(4)	RRRMRKK (235-241, prob:0.708)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3T9	Uncharacterized protein	Medium	13.7	1	1-24	MIPSFMDSPKRKRNNLQAPTPPDS	nucl(21.5),cyto_nucl(13),cyto(3.5)	REAREARARRSERRRG (259-274, prob:0.835)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5P8	60S ribosomal protein L36	Medium	12.4	1	63-86	ELLRNSKDKRARKLAKKRLGTFGR	nucl(12),mito(10),cyto(5)	SKDKRARKLAKKRLGTFGRAKA (68-89, prob:0.965)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7G9	Uncharacterized protein	Medium	10.1	1	64-91	SVEQSPHATRRPRRKTIKKILRRFSLHS	mito(12.5),mito_nucl(11.666),nucl(9.5),cyto_nucl(7.833),cyto(4)	RRPRRKTIKKILRR (73-86, prob:0.886)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHE4	U1-type domain-containing protein	Medium	13.6	1	6-27	KSTPSYWCKHCKQYVKDTKLEK	nucl(21),cyto_nucl(12.5),mito(2),cyto(2)	KKRKTKNIRQK (270-280, prob:0.74)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJE7	Uncharacterized protein	Medium	11.9	1	58-89	DSTSTQSVSKKSKEKRRRKKDEKKEVDVEKGT	nucl(14),cyto_nucl(10.5),mito(6),cyto(5)	KKSKEKRRRKKDEKK (67-81, prob:0.987)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERE6	Uncharacterized protein	Medium	10.1	2	111-130, 1035-1056	VLVKNESKWNNQKRSFRVCI, SVNRSKPNTVVHQKQRKVRDLP	nucl(11),cysk(9),cyto_nucl(8),cyto(3),mito(2),pero(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUY2	FAD-binding FR-type domain-containing protein	Medium	10.3	2	13-37, 678-703	KAAKAAAKILRWKRNRNSVKYFAAA, IDPASVPKKRQEAKVRRRIRRGKKED	plas(21),nucl(1),cyto(1),cyto_nucl(1),pero(1),E.R.(1),golg(1),vacu(1),cyto_pero(1)	PKKRQEAKVRRRIRRGKKED (684-703, prob:0.987)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3C9	Uncharacterized protein	Medium	10.4	1	404-435	SGGHLGRTAKKERRRERKGLPKDENPKPQRMG	mito(17),nucl(6),cyto(2)	RTAKKERRRERKGLPKDENPKPQRMGILRTAKRK (410-443, prob:0.985)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6D2	RNA-dependent RNA polymerase	Medium	11.2	1	101-120	QDMNSRRERKVPSPFRKNVF	nucl(16),cyto(6),mito(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7P8	54S ribosomal protein L31, mitochondrial	Medium	10	2	16-41, 76-105	LWKIPWRLSKFQKARQRKRLRAVDAV, DKYTIFDRKEKKYRKGIHKLPKWTRLSQRL	mito(23.5),cyto_mito(13)	KEKKYRKGIHKLPK (84-97, prob:0.785)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A0A0K0PT03	DNA-directed RNA polymerase	Medium	10.7	1	618-637	SITDKIKKDKNKQLLAFRPN	nucl(21.5),cyto_nucl(13),cyto(3.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBR5	Uncharacterized protein	Medium	10.4	1	46-73	DDDPSVEKYTQKRRKQRFRGPWFDQQLA	nucl(21.5),cyto_nucl(13.5),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EI89	Uncharacterized protein	Medium	10.2	1	1-49	MPSLSSLLKRRRESQNDNRTSLSLSVTPEKVQRKSKRNFLRKLFKISSA	nucl(13),mito(7),cyto(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERC5	Uncharacterized protein	Medium	12.7	1	93-119	GAQRQRAKARRQKLMAKYQRKINAQRR	nucl(18.5),cyto_nucl(14),cyto(6.5)	RAKARRQKLMAKYQRKINAQR (98-118, prob:0.781)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ESX2	Uncharacterized protein	Medium	14.3	1	28-51	REQEVRSKNVRKERKKEERKEGKK	nucl(23.5),cyto_nucl(14)	SKNVRKERKKEERKEGKK (34-51, prob:0.986)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6E7	UBX domain-containing protein	Medium	11	1	226-246	ESDKVRRRKDAERKANRNNEL	nucl(8),extr(6),cyto_nucl(6),cyto(4),mito(3)	RRRKDAER (231-238, prob:0.694)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E906	WW domain-containing protein	Medium	12.2	1	273-304	RSGKKLSKAELKQFKEKRKQKKEEKRRAWLRD	nucl(16),cyto_nucl(12),cyto(6),mito(2),pero(2)	KEERSGKKLSKAELKQFKEKRKQKKEEKRRAWL (270-302, prob:0.995)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ED49	Uncharacterized protein	Medium	11.3	1	226-256	LPPKNQRQKSTNPNHQRRSSDIKRKLQKYQR	nucl(23.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGV2	Uncharacterized protein	Medium	13.7	2	10-38, 335-355	LNNTSKVSRPREFKKSNRPQKQAQFNDLL, ISSQPRWNSRRSPKPVSAFTE	nucl(18),mito(6),cyto(1),golg(1),cysk(1)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIP3	C2H2-type domain-containing protein	Medium	13.9	1	207-226	GNKHGFPVSRKTRNRRSSVP	nucl(22.5),cyto_nucl(13),cyto(2.5)	RKTRNRRSSVPGIINKPKAGRRTTKA (216-241, prob:0.839)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0B8	Ubiquitin fusion protein	Medium	12.2	1	73-108	LRGGGKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKV	nucl(16.5),cyto_nucl(15.5),cyto(7.5)	LRGGGKKRKKKVYTTPKKIKHKRKKTK (73-99, prob:0.995)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1J3	Uncharacterized protein	Medium	12.7	2	252-275, 461-483	LEWLKHFDKHTKNRRKGKYRMLVL, AANEALSKRRRAKKTQLRQGGVL	cyto_nucl(11.5),cyto(11),nucl(10),mito(4)	KRRRAKK (468-474, prob:0.708)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7Z3	Uncharacterized protein	Medium	12.1	2	11-35, 219-238	LEKDTNKAPSRKNSQSKPRTGRSAA, DTKEEKKQAKKDAKKFRFLI	nucl(17.5),cyto_nucl(10.5),mito(6)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4V1	Cyclin N-terminal domain-containing protein	Medium	12.7	1	360-380	MAEEKRRTAKKSKGNFLTRYF	nucl(20),cyto(6)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5D2	Uncharacterized protein	Medium	10.4	2	1-23, 1232-1254	MPLSNQNKQPRIKNNPTTPKEAI, DAISTPRRKRYKPTQLDKIKESI	nucl(15),mito_nucl(12.333),cyto_nucl(8.833),mito(8.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E961	Uncharacterized protein	Medium	13.6	1	368-393	PTMCSLKDTLQRKRKARRGNANVKQY	nucl(14),cyto(7),mito(4)	KRKARR (380-385, prob:0.712)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFF2	Telomerase reverse transcriptase	Medium	13.6	1	69-91	SKLPVSSKVRRKKLSSVGRKASA	nucl(21),cyto_nucl(12.5),mito(4)	KGIKIPKRLRGKAKDLNR (256-273, prob:0.886)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPK0	Uncharacterized protein	Medium	14.2	1	19-46	GTNIRLQKRKTRSSRRRKVPNQSVEQAR	nucl(24),cyto_nucl(15)	KRKTRSSRRRK (26-36, prob:0.834)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERR3	Uncharacterized protein	Medium	13.7	1	333-378	LNVVAMEPKKRKRKHPDTSISSLGTKLSPRQSKRVKKVQDYLPQEN	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	KKRKRKH (341-347, prob:0.865)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EY33	Uncharacterized protein	Medium	13.7	1	12-42	KLAAAKKRVEEMKKKKAKKAGVKKEEKTETA	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	AKAEKLAAAKKRVEEMKKKKAKKAGVKKEE (8-37, prob:0.997)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F209	Uncharacterized protein	Medium	13.2	1	53-79	EGLARRPRTTRSKKAKQRTNNTPPPSV	nucl(19.5),cyto_nucl(13.5),cyto(4.5)	RRPRTTRSKKAK (57-68, prob:0.753)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDG3	Uncharacterized protein	Medium	12.1	1	14-48	HPSEWKKIFTERKTWKKCHTFRERKKSAKEKTFVE	nucl(11),cyto(10),mito(6)	RRRKNGEAFKMGKLPKH (178-194, prob:0.748)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EW01	Uncharacterized protein	Medium	13.7	1	153-178	LEHPHHYPPHRHRRHHHKRSSLISRQ	nucl(21),cyto_nucl(13),cyto(3)	RR (165-166, prob:0.609)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EW48	Uncharacterized protein	Medium	11.8	2	18-40, 595-615	QTFITHFFKRGPRKEKPTAHISY, DTKFAKDKRRVQEKRAKERER	cyto(9),mito(7),cyto_nucl(7),nucl(5)	AKDKRRVQEKRAKERER (599-615, prob:0.857)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1W6	CCHC-type domain-containing protein	Medium	13.5	1	454-474	SSTSRCCSKCGKTGHNSRTCQ	nucl(23),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5Z2	Uncharacterized protein	Medium	10.4	1	84-105	NHWSPTKKTSPNSKRFTRRLSS	nucl(22.5),cyto_nucl(15),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E925	Integrase catalytic domain-containing protein	Medium	12.3	1	300-326	IEYFKKFWGRQSTKRRNWFVRRHEGTK	nucl(19),cyto(4),pero(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAG1	Transcription activator of gluconeogenesis SS1G_02293	Medium	14.3	1	61-92	TATKPKFDPKDPLRPRRKKARRACFACQRAHL	nucl(23.5),cyto_nucl(14)	DPKDPLRPRRKKARR (68-82, prob:0.942)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENL5	Origin recognition complex subunit 1	Medium	13.4	2	265-290, 308-330	KIENSIPNKKRKKPIFSRKKHEDDDD, TTPRKRQKTTKAITPRKPRTPSK	cyto(11.5),cyto_mito(10.833),cyto_nucl(9.666),mito(8),nucl(6.5)	NKKRKKPIFSRKK (272-284, prob:0.906),RKRQKTTKAITPRKPRTPSKLL (311-332, prob:0.834)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EY65	Uncharacterized protein	Medium	11.1	1	1926-1950	TLVQVEKKLKEKRKHVVESVRRSLS	plas(20),nucl(3),mito(1),cyto(1),E.R.(1),vacu(1),cyto_mito(1)	KNRALKPRNRDRNSSAVPAKKDTPRRRGS (799-827, prob:0.847),ARTHKRKPI (1323-1331, prob:0.722)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7M6	Uncharacterized protein	Medium	12	2	557-585, 795-822	ISCILRQLLRPRRRGRRPVADRRHNKIDD, RHRANVRFLRIKRWRMKRYARWRLTGRL	mito(24),cyto(1),plas(1),pero(1),cyto_pero(1)	RPRRRGRRPVADRR (566-579, prob:0.874),LRIKRWRMKRYARW (803-816, prob:0.772)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9U3	Uncharacterized protein	Medium	11.1	1	1-20	MKKKRKKAEKKGVDRKIVIE	nucl(11),cyto_nucl(10.5),mito(8),cyto(6)	KKKRKKAEKKGV (2-13, prob:0.96)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIS3	SHNi-TPR domain-containing protein	Medium	11.6	1	76-97	LAGGEKQKPKKKNGGKKVDTIE	nucl(14),cyto_nucl(13.5),cyto(11)	KQKPKKKNGGKK (81-92, prob:0.869)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETN0	HTH CENPB-type domain-containing protein	Medium	10.6	1	457-480	LRKANEALSKRRRARKALIRKGGA	mito(17),nucl(7),cyto(3)	LSKRRRARKALIRKG (464-478, prob:0.931)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZS6	Uncharacterized protein	Medium	12.8	1	44-93	YSSDRAGPSHRRRRHSHEREHYHAHDRDKGRERGRERSKEHRHRGRYSSE	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	PSHRRRRHSHEREHYHAHDRDKGRERGRERSKEHRHRGRYSSESKYKHDNRERDDRRDERRDDKRESRDDKRRSR (51-125, prob:0.99)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F082	U3 small nucleolar RNA-associated protein 22	Medium	12.2	1	46-69	GDAIQSKPKHPPAKRRHDDQDSAL	nucl(18),cyto(4),pero(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F547	Uncharacterized protein	Medium	13	1	132-152	MDIQIKRDRQQNRRNSNREAS	nucl(20),mito(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBU3	Uncharacterized protein	Medium	14.2	1	771-801	GKIGEKRKVGWPKGRPRPKASKKAKVHEYGV	nucl(23),cyto_nucl(14)	KSGDGKGKTKGNKGTSNESSEKKSAKNGKIGEKRKVGWPKGRPRPKASKKAK (744-795, prob:0.997)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDV1	Uncharacterized protein	Medium	14.1	2	35-60, 246-269	SRLDGVPSKKKTQRRRKAIPAGISEK, PEQGRRSDRSQRTRQPDPEQQRHS	cyto(10),mito(7),nucl(6),cyto_pero(6)	SKKKTQRRRKAIPAGISEKDAKILTKVKR (42-70, prob:0.936),RPKKVQKSGRR (298-308, prob:0.765)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELQ3	Uncharacterized protein	Medium	12.5	1	154-179	ESLEKGKGKGRRERERREWIRCWRKR	nucl(16.5),cyto_nucl(12.5),cyto(7.5)	KGKGKGRRERERREWIRCWRKR (158-179, prob:0.97)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EP28	Uncharacterized protein	Medium	13.8	1	8-60	KSSSAPTREKGRDRRRDRKRDRKRDRKRDRKRDRKRDRKRDRKRDRKRDRKRE	nucl(21.5),cyto_nucl(12.5),mito(3)	PTREKGRDRRRDRKRDRKRDRKRDRKRDRKRDRKRDRKRDRKRDRKRE (13-60, prob:1)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ER75	Telo_bind domain-containing protein	Medium	14.7	2	226-248, 1369-1394	EGDRSVRGRGRKRTRLSTTWRFT, GTTRDFSGSSRNRNRKRKSSGIESTE	nucl(24),cyto_nucl(13.833),mito_nucl(12.833)	RNRKRK (1381-1386, prob:0.701)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERM2	Cytosine-specific methyltransferase	Medium	10.9	1	1308-1327	LKSPSTKSSHHKKSPFVINL	nucl(16),mito(4),cyto(3),plas(2),golg(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F409	Uncharacterized protein	Medium	14.2	1	405-431	GNEDWADKERKRRPRKERGKVLGMMRW	nucl(16),mito(6),cyto(4)	KERKRRPRKERGK (412-424, prob:0.957)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5L6	Protein kinase domain-containing protein	Medium	13	1	97-123	FAVKEFSKSRLRKRARSNILRRPHYVR	nucl(20.5),cyto_nucl(14),cyto(6.5)	KSRLRKRARSNILRRPH (104-120, prob:0.832)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7R4	Uncharacterized protein	Medium	11.5	2	567-597, 2265-2293	TTGARQTERKRTSNRGRRRKDDKGSNGPEVQ, IDFTREKQYFKKFRKSKPRITVNDEPKDY	plas(16),nucl(4),E.R.(4),extr(1),pero(1),vacu(1)	RKRTSNRGRRRKD (575-587, prob:0.861)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9Q3	Uncharacterized protein	Medium	13.2	2	26-49, 169-188	SVPMWQRCLRYRPRSKDLRAFNPL, SEYHNRPKRKPAVQKRAADG	nucl(24),cyto_nucl(14.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ED84	Endoplasmic reticulum junction formation protein lunapark	Medium	13.8	2	146-166, 366-387	KPTAPKRTPSAKKTPKNKDAH, SEEEKVEVKPKRERPKSTRRKV	nucl(5.5),cyto_nucl(5.5),mito(5),cyto(4.5),plas(3),pero(3),extr(2),E.R.(2)	PKPTAPKRTPSAKKTPKNKDAH (145-166, prob:0.885),KPKRERPKSTRRKV (374-387, prob:0.928)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIN4	Ubiquitin carboxyl-terminal hydrolase	Medium	10.2	1	390-409	ERARKRQKRLHDKEEADKKA	cyto(15.5),cyto_nucl(13.333),nucl(10),mito_nucl(5.833)	RARKRQKRLH (391-400, prob:0.792)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EN23	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.5	1	160-197	MSGGRHKKEIKRRTKTGCLTCRKRRIKCDEQHPACRNC	nucl(26.5),cyto_nucl(14)	RHKKEIKRR (164-172, prob:0.719)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2L8	Uncharacterized protein	Medium	14.5	1	262-292	SKLLCSYLRHHKRKRSTKPRKVHFNKRDDAY	nucl(24.5),cyto_nucl(13)	HHKRKRSTKPRKV (271-283, prob:0.912)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3L3	EVE domain-containing protein	Medium	10.5	2	13-37, 47-68	IPVRVEPRRSSRQKTNNNNNNNESL, SQASSRNKENKKKVANGNPTRV	nucl(17),mito_nucl(12.999),cyto_nucl(10.833),mito(7.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4W7	tRNA-dihydrouridine synthase 3	Medium	12	1	370-392	EEEGPPKKKQKGEKKERTTSPSL	nucl(10),cyto(8),cysk(7)	PKKKQKGEKKE (375-385, prob:0.834)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A0A0K0PSX7	GIY endonuclease	Medium	11.5	1	1-26	MEPEKPKPEKKDSKKKNNSWPVILGR	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(5)	KPKPEKKDSKKK (5-16, prob:0.81)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5N4	PH domain-containing protein	Medium	14	3	31-55, 75-95, 1248-1322	NGSTGDKEQKDKKKFGKRSSIFSGL, AHSPKLRPRTLQKGRPNSIFG, GEGEKDKDKDKDKDKDKDKDKDKDKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYK	mito(14),cyto_mito(10.666),mito_nucl(10.166),cyto_nucl(6.166),cyto(6),nucl(5)	KDKDKDKDKDKDKDKDKDKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYKYK (1254-1312, prob:0.884)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENQ8	Uncharacterized protein	Medium	13	1	24-49	VEEWEGKKRGRRKKRRREESTVPGTY	nucl(15),cyto(7),cysk(4),cyto_mito(4)	GKKRGRRKKRRR (29-40, prob:0.992)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERY4	Uncharacterized protein	Medium	11.9	2	65-92, 304-332	TGLRVSQHPSIRRRRRSQNQSRPEINTN, QDETKRKASQTKQNTRALKKKKNELMQGE	nucl(17.5),cyto_nucl(10.5),mito(3),cyto(2.5),golg(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ESE2	Uncharacterized protein	Medium	12.6	1	639-665	SSGKLEKKKGEDGKEKKKKMHFFRSKK	nucl(12),cyto(10),pero(4)	KLEKKKGEDGKEKKKKMHFFRSKK (642-665, prob:0.99)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EX60	SH3 domain-containing protein	Medium	11.9	1	192-211	LFFFRKKKQAAKRERLDDEK	nucl(11),mito(10),extr(2),cyto(1),pero(1),golg(1),vacu(1),cyto_pero(1)	KK (198-199, prob:0.603)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4P3	Eukaryotic translation initiation factor 3 subunit A	Medium	14.7	1	816-847	EKQVAQRRKEFKERKIREKREREEQERKLREE	cyto_nucl(12),nucl(10),cyto(10),mito(5)	KRKETIQKRKEEASEIQSRKEKEEATRKRIKA (606-637, prob:0.79),KRRRDAEKELEKQVAQRRKEFKERKIREKREREEQERKLREEEERAQKEKAEKDEREEKRKAEFAQLKAIREK (806-878, prob:0.994),RRAEEASKRRAEEKARGPVRGAPI (892-915, prob:0.855),KP (1020-1021, prob:0.601),GGK (1024-1026, prob:0.603)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5Z1	Uncharacterized protein	Medium	13.1	1	33-55	KGPRDETKRTRDGKKNKSTTITN	nucl(18.5),cyto_nucl(10),mito(8)	GTKGPRDGTKGPRDGTKGPRGGTKGPRDETKRTRDGKKNK (10-49, prob:0.965)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9G8	Uncharacterized protein	Medium	10.3	1	60-84	LVRERGEGGKRKKKKAGKESWRMGA	cyto_nucl(8),nucl(7.5),cyto(7.5),mito(6),pero(2),E.R.(2)	RGEGGKRKKKKAGKESWR (64-81, prob:0.99)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFQ6	Uncharacterized protein	Medium	12.7	1	489-518	HDVVEKVKLKVNKKERRRRELKKQIMVVGV	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(4)	KLKVNKKERRRRELKK (496-511, prob:0.929)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F214	Homeobox domain-containing protein	Medium	14.5	1	26-58	SSSASRRPPRKSTLTQQQKNQKRQRATQDQLVT	nucl(25.5),cyto_nucl(14)	RRRAKIK (111-117, prob:0.676)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F934	Uncharacterized protein	Medium	10.9	1	16-36	VEEIVKARKRRKDRREMEDCG	cysk(13),nucl(9.5),cyto_nucl(7),cyto(3.5)	KARKRRKDR (21-29, prob:0.822)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E813	Uncharacterized protein	Medium	12	2	6-33, 1312-1334	NNTMASFAQSKKRKRRRQDKASISARLI, TSSGSSRSSRKGKGKGRVDVKGK	mito(21.5),cyto_mito(13.5),cyto(4.5)	KKRKRRRQ (16-23, prob:0.902),GSSRSSRKGKGKGRVDVKGKGKA (1315-1337, prob:0.968)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECQ6	WD_REPEATS_REGION domain-containing protein	Medium	10	2	312-338, 906-925	SEEEVKKSLARKRRRRREKMAATDKSA, IRENLRKSLRRQKNEMGFNL	cyto(10),cyto_mito(9.833),mito(8.5),cyto_nucl(6.333),E.R.(3),plas(2)	KKSLARKRRRRREK (317-330, prob:0.978)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EII2	EAF domain-containing protein	Medium	12.1	1	162-185	KPAPRAKAEKAKKKPPPREPSPEP	nucl(19.5),mito_nucl(12.166),cyto_nucl(11.833),mito(3.5)	APQKKASKPKATTTAKAKPAPRAKAEKAKKKPPPRE (145-180, prob:0.997)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJ71	Glyco_hydro_63 domain-containing protein	Medium	13.4	2	11-41, 934-953	SEEEKRLKEDRERKKYWKKWGPYVAERQWAT, GANGKSQKSPRPYHLRRTST	nucl(12.5),cyto_nucl(11.5),cyto(9.5),pero(3)	ERKK (22-25, prob:0.638)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPZ2	Heat shock protein 90	Medium	11.1	1	241-261	DEEEKKPKTKKVKETKIEEEE	cyto_nucl(13.5),cyto(13),nucl(12)	KPKTKK (246-251, prob:0.638)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUV8	Zn(2)-C6 fungal-type domain-containing protein	Medium	14.2	1	78-98	DSDFKRVAKRHKHAEMQKEIE	nucl(24),pero(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVF3	Uncharacterized protein	Medium	13.7	1	41-68	RGYDRERSSSPRRDKRGRYTDRDREGYR	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	RRDKRGR (52-58, prob:0.673)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVF9	Uncharacterized protein	Medium	12.6	2	134-160, 840-861	LESLGPFKYTFKKKKNSKSKYSASMLN, EETPEQARTRKQKEKDEWFYAG	nucl(20.5),cyto_nucl(12.5),cyto(3.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXN5	Uncharacterized protein	Medium	12.6	1	396-416	QYSKSRTPTRFKKNREESPLV	nucl(17),cyto_nucl(13),cyto(7)	EKRKRAIAR (112-120, prob:0.754)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2M5	Uncharacterized protein	Medium	14.9	1	478-503	LEAYVKTRKRAKKIMGKVVRRKDKMM	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	RRKRRVEEKAARQK (166-179, prob:0.776),TRKRAKKIMGKVVRRKDK (484-501, prob:0.925)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F734	Uncharacterized protein	Medium	11.3	1	5-39	ADQGPDRKRKQFQGGRGPKRQKVFKPKPVREGSSE	nucl(15),cyto_nucl(12.833),mito_nucl(10.499),cyto(7.5)	RKRKQFQGGRGPKRQKVFKPKP (11-32, prob:0.932)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5R3	Diadenosine tetraphosphate synthetase	Medium	11.2	1	131-156	VEEEEDPSKKKKKKKTKGIEAVKLDD	nucl(12.5),cyto_nucl(12),cyto(10.5),mito(2),pero(2)	SKKKKKKKTKG (138-148, prob:0.978)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6F5	Autophagy-related protein 2	Medium	14.8	2	101-125, 1737-1764	NSSRTNHDRLRKKSTSRSPGPDPAL, ITPSRQGTGRKPKKLRLNRSKHHKITFE	nucl(13),cyto(11),mito(3)	GRKPKKLRLNRSKHH (1745-1759, prob:0.877)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECZ8	Uncharacterized protein	Medium	10.7	1	1-20	MTGTQKWKRREVQYEKNAAK	nucl(20.5),cyto_nucl(11.5),mito(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENK9	Casein kinase II subunit beta	Medium	10.4	1	309-334	GGASASARLKPRRRHPKVMAHNGGSP	cysk(10),cyto_nucl(9),nucl(8.5),cyto(8.5)	LKPRRRHP (317-324, prob:0.736)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EV65	Uncharacterized protein	Medium	14.7	2	51-73, 84-108	EVIETRKKRTKGKRVKLQGQFVF, EAEEKPKEKKLRGRPRKRPIEESEE	mito_nucl(13.833),mito(13.5),nucl(13),cyto_nucl(7.333)	RKKRTKGKRVK (56-66, prob:0.845),EKPKEKKLRGRPRKRP (87-102, prob:0.977)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXT5	Uncharacterized protein	Medium	14.8	1	3-22	SAELKKRNRSHAKGAKSAKS	nucl(20),cyto_nucl(14.5),cyto(7)	KKRNRSHAKGAKSAKSAKGVKGA (7-29, prob:0.943),KKRK (569-572, prob:0.676)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6M5	Uncharacterized protein	Medium	13.9	1	484-525	GPLLRRSTPPPEPRRVRRLAKFAPREKARKQLRPVCPQWNTP	nucl(21.5),cyto_nucl(12.5),cyto(2.5)	TPPPEPRRVRRLAKFAPREKARKQ (491-514, prob:0.934)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E633	Uncharacterized protein	Medium	11.1	1	95-118	GIANGRKKAGSKKRKLIKDEDEDE	nucl(14),cyto_nucl(13.333),cyto(9.5),mito_nucl(7.999)	KKTGKVAGIANGRKKAGSKKRKL (88-110, prob:0.972)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EA34	Uncharacterized protein	Medium	10	2	507-526, 955-978	RRSRQGWGRRHRRMKSQPSS, DDPETLKKLKEKERSARDKEKVGA	plas(20),E.R.(3),vacu(2)	RRSRQGWGRRHRRM (507-520, prob:0.761)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHR7	DUF3694 domain-containing protein	Medium	13.5	1	172-193	MRDNVPQLKKKRKGARIAESQF	nucl(22.5),cyto_nucl(14),cyto(4.5)	KKKRKG (180-185, prob:0.721)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EI52	Uncharacterized protein	Medium	14.6	2	257-279, 377-409	VMEKSSSCSKRKRRLPDSDDPNH, NYMCRIPGCKKVYKRAERGRRDKHEERKAAHNS	nucl(22),cyto_nucl(13.333),mito_nucl(12.333)	KRAERGRRDKHEERKA (390-405, prob:0.835)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1L3	Uncharacterized protein	Medium	12.8	1	81-101	LDEFESAKKKRKERRVHFAGV	nucl(19.5),cyto_nucl(14),cyto(7.5)	KKKRKERR (88-95, prob:0.855)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1N5	Uncharacterized protein	Medium	12.9	2	15-43, 65-84	LQKFLVRRSNLQQRPKKPKLTPKDCEINI, TGICRKWKRFCEFRNEQYWR	nucl(16),mito(4),cyto(2),plas(2),pero(1),golg(1),cysk(1)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F540	Uncharacterized protein	Medium	14.3	1	72-94	NRPTLQFNKKRRRQPSHSEPHIN	nucl(23.5),cyto_nucl(14)	KRR (81-83, prob:0.616)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9D7	Uncharacterized protein	Medium	11.9	1	54-82	GKSGVTPRRNISKPRKRGKRRSWEEILDD	nucl(14.5),cyto_nucl(11.5),cyto(7.5),mito(2),pero(2)	PRRNISKPRKRGKRR (60-74, prob:0.969)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E8B4	CCHC-type domain-containing protein	Medium	12.6	1	158-177	SSSRCCSKCGKPGHNSRTCQ	nucl(15.5),cyto_nucl(10),mito(8)	NKALSKHRHAK (104-114, prob:0.668)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9V4	Uncharacterized protein	Medium	13.5	1	72-97	PPKTPSPTKKSSPKKKVGPNNTPIKA	nucl(22),cyto_nucl(14),cyto(4)	TPSPTKKSSPKKKVGPNNTPIKATPKSRGKKAAA (75-108, prob:0.96)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBZ2	DDE-1 domain-containing protein	Medium	10	1	380-402	RAIMKKCTICKKGKRLVLKGHFY	nucl(13),mito(9),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIX9	Uncharacterized protein	Medium	12.4	1	1-25	MPSLKVSSRRRKKEAEEHYWRRNAR	nucl(14.5),cyto_nucl(9.5),mito(9)	SRRRKKEAEEHYWRRNARGKRAR (8-30, prob:0.863)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUA2	Uncharacterized protein	Medium	13	1	25-47	SSEKNTDKKAHHVRRKSGKDYAV	nucl(17.5),cyto_nucl(9.5),mito(8)	HVRRK (36-40, prob:0.649)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVU2	Ribonuclease P	Medium	11.6	1	5-33	QQPLSSKDDKKPKLPRLEKNQRIQKRPLL	nucl(18),cyto_nucl(11.833),mito_nucl(11.833),mito(4.5),cyto(4.5)	KPKLPRLEK (15-23, prob:0.657)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0F2	HTH CENPB-type domain-containing protein	Medium	10.2	1	457-480	LRKANEALSKRRRARKALIRKGGA	mito(18),nucl(6),cyto(3)	LSKRRRARKALIRKG (464-478, prob:0.931)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F255	Uncharacterized protein	Medium	11.2	1	35-57	VFSNSDKEPKQRKPPAQGQDGSD	nucl(16),cyto(4),plas(3),cyto_mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2H4	Uncharacterized protein	Medium	13.1	1	77-104	KSPINRPTLQFNNKRRRPPSHSEPHINS	nucl(22),cyto(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F606	Uncharacterized protein	Medium	10	2	305-327, 1156-1180	EKMNAKKSNRKLTKEEKAQKIKE, DEPIIRPTITRKRRHKDIEAQQKIA	plas(18),E.R.(3),vacu(3),mito(1),extr(1),pero(1)	AKKAQRKMVEKQEKMNAKKSNRKLTKEEKAQ (293-323, prob:0.894)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7R3	Integrase catalytic domain-containing protein	Medium	13.1	1	300-326	IEYFKKFWGRQSTKRRNWFVRRHEGTK	nucl(21),pero(3),cyto(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8G5	Uncharacterized protein	Medium	12.4	1	1-25	MEPRKDKNKSKKKPTPQLCAQKDLA	nucl(17.5),cyto_nucl(13.5),cyto(8.5)	KDKNKSKKK (5-13, prob:0.754)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9B2	DUF4210 domain-containing protein	Medium	13.5	2	85-104, 121-145	LPSPEKAKDSQKRRRNATLD, VSERELRRAEKQKRRSTSPRAPPGG	nucl(15),cyto_nucl(12.333),cyto(7.5),cyto_mito(5.666),mito(2.5)	RRAEKQKRRSTSPR (127-140, prob:0.753)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EA72	Uncharacterized protein	Medium	12.1	1	53-80	QSLESIQKKKKEEKKKKNFWTCDQRIDL	nucl(16.5),cyto_nucl(13),cyto(6.5),mito(2),golg(2)	KKKKEEKKKK (60-69, prob:0.897)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EB42	J domain-containing protein	Medium	10.9	1	461-489	VAEAAAKKENKKKGKDKREHGHHHSHHSD	cyto(15),cyto_nucl(10),cysk(5),nucl(3),pero(2)	LRKREKKKGGLSKAQR (228-243, prob:0.931),AKKENKKKGKDKREH (466-480, prob:0.944)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EG04	Uncharacterized protein	Medium	10.6	1	167-196	DDEPHCQKRSINRSQKRQKRDPEQRISLEA	nucl(17),cyto(8),cyto_mito(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EL81	Uncharacterized protein	Medium	11.5	1	339-358	RTLRRESKYRRPKSPLIQFS	nucl(16.5),cyto_nucl(13.333),mito_nucl(9.166),cyto(8)	KSKKG (1183-1187, prob:0.648)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EL99	Uncharacterized protein	Medium	10.5	1	100-126	FLSRIKTRKGRATLQRRKSKKRSTLSH	mito(13.5),nucl(10),cyto_mito(8.666),cyto_nucl(7.333)	RKRRHGFLSRIKTRKGRATLQRRKSKKRS (94-122, prob:0.983)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ER25	Uncharacterized protein	Medium	12.9	2	102-123, 708-730	EDSSVRRSTRSRRTTPRYADSG, HQLQNHYQPHHHRQQQQQLHSNM	nucl(21.5),cyto_nucl(12.5),cyto(2.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWU5	Uncharacterized protein	Medium	12.3	1	22-42	QKSSSSHQAHHRNKRVKYIHE	nucl(19),mito(4),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5T5	Uncharacterized protein	Medium	11.2	1	25-44	APQHKFPRTLPPPRRPPASG	nucl(24),cyto_nucl(14.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EA08	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.4	1	16-45	SAKLRSCVVCRSRKVRCDKLSPCSNCRRAN	nucl(18),mito(6),cyto(1),pero(1),cysk(1),cyto_pero(1)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETB5	Protein BCP1	Medium	12.3	1	216-235	EQGPKSKKSKGKTRASGELF	nucl(16.5),cyto_nucl(13),cyto(8.5)	KSKKSKGK (220-227, prob:0.745)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETP3	Uncharacterized protein	Medium	12.8	1	85-104	PPTPQEKPLRTKRGHRKPSF	nucl(19),cyto_nucl(14.5),cyto(6)	R (97-97, prob:0.601)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9B2	Uncharacterized protein	Medium	11.3	1	51-73	IEPRGWRGERLKPRRNKEDCERK	cyto_nucl(14),nucl(13.5),cyto(13.5)	GERLKPRR (58-65, prob:0.683)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E7W5	Chromo domain-containing protein	Medium	14	1	9-54	AVQPNDPKVTRQRRLKRKNLAESPVRQPSPSEKRLKQKEDSPPLYN	nucl(23),cyto_nucl(15.5)	RRLKRKN (21-27, prob:0.714)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9S4	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.3	1	4-48	VSKKSFIKKEVPKRSRAFSTRAKTGCKTCKVRHVKCDEGRPGCKK	nucl(19),mito(7)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9X7	Uncharacterized protein	Medium	12.4	1	62-99	PTGPRKIATPRRSRVEKKKPAKRELKFKNRKDSRQDVK	nucl(18),cyto_nucl(12.833),cyto(5.5),cyto_mito(4.666)	PRKIATPRRSRVEKKKPAKRELKFKNRKD (65-93, prob:0.995)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ED58	Uncharacterized protein	Medium	10.4	1	392-412	LEFKRTRIPALKPKQKARGWE	mito(15),nucl(6),cyto(4)	RTRIPALKPKQKARGWEARHASDKYKPLRR (396-425, prob:0.893)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQ61	HTH CENPB-type domain-containing protein	Medium	11.7	1	336-355	NEALGKRRRARKALIRKGGV	nucl(14),cyto_nucl(11.5),cyto(7),mito(5)	ALGKRRRARKALIRK (338-352, prob:0.941)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ER09	Uncharacterized protein	Medium	12.7	2	16-35, 228-255	QYWSNIVRRKRKDTDGTTKE, DLAPESNPQKRNQRKREKIKAIGKTIWG	mito_nucl(11.833),mito(11.5),nucl(11),cyto_nucl(6.833)	KRNQRKREKIKAIGKTIWGSIKRKI (237-261, prob:0.922)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERP6	Uncharacterized protein	Medium	13.5	1	203-222	KEVHRRRSTLRSRKGWAHRS	nucl(23),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERR8	ATPase_AAA_core domain-containing protein	Medium	13.1	1	248-270	DQQNTGENHGKRRKRKKRKGRRN	nucl(19.5),cyto_nucl(13),cyto(5.5)	GKRRKRKKRKGRRN (257-270, prob:0.999)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8W2	Uncharacterized protein	Medium	11.1	1	439-459	YPAASRRKSAVRNNLNGRRIT	nucl(23),cyto_nucl(14.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F912	Uncharacterized protein	Medium	11.2	2	78-102, 269-290	ISYNIPPAKRQMRDRKPNTPSNTTG, LIPHATRKRKHHASQDSLRRDP	nucl(15.5),cyto_nucl(10.5),cyto(4.5),mito(3),pero(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECA5	Uncharacterized protein	Medium	14.8	2	43-67, 472-509	TGSSAFWRTPRRDKVKEKNKVGGKD, GWREREREREREKEKEKEKEKEKEKEKERKEKMEYVVR	nucl(17.5),mito_nucl(11.5),mito(4.5),cyto(3)	GWREREREREREKEKEKEKEKEKEKEKERKEK (472-503, prob:0.994)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EG37	BTB domain-containing protein	Medium	10.1	1	23-47	SDETESQPWDRRNRRNRIANSEEQA	nucl(18.5),cyto_nucl(12.5),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELD1	DUF3591 domain-containing protein	Medium	10.1	1	994-1019	LERLERNQDRRHAREKQKSKQSMAGQ	nucl(18.5),cyto_nucl(12.5),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMK9	USP domain-containing protein	Medium	13.4	1	568-592	FGTETVRAKRKKKAVERWWRISDEK	nucl(20),cyto_nucl(13),cyto(4)	RAKRKKKAV (574-582, prob:0.839)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EMW8	Protein acetyllysine N-acetyltransferase	Medium	12	1	364-386	QTLKRKRSSNGGSKKRGRSKNDD	nucl(15),cyto_nucl(12.5),cyto(8),mito(2)	PAPPPPKQTLKRKRSSNGGSKKRGRSK (357-383, prob:0.968)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EV40	Uncharacterized protein	Medium	11.8	1	1-30	MHETNARTKRDARKDRCKKRQPLLLPGRKF	nucl(14.5),cyto_nucl(11.5),cyto(7.5),mito(5)	RDARKDRCKKRQP (10-22, prob:0.701)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVT1	Uncharacterized protein	Medium	13.9	2	184-206, 209-230	KLTKERREAKMKVRNSRRIRYLA, RKIVRKGWSSRTHAGRKRKLDE	nucl(19),cyto_nucl(12.833),mito_nucl(12.499),mito(4.5)	TKERREAKMKVRNSRRIRYLAAMRKIVRKGWSSRTHAGRKRK (186-227, prob:0.946)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3P8	Uncharacterized protein	Medium	13.3	2	86-109, 794-819	ATITRASVKPARKRRKVDYGGADG, TSDTHDTFKCKRCKPDGKQFLKAQAM	nucl(12.5),cyto_nucl(11.5),cyto(9.5),pero(4)	PARKRR (95-100, prob:0.71)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9P9	Uncharacterized protein	Medium	11.4	1	414-445	EGEENSEKRRRKSKKTEKKGAGKNLQDNKRRN	nucl(17),cyto_nucl(14.333),mito_nucl(9.999),cyto(8.5)	KRRRKSKKTEKKGAGKN (421-437, prob:0.987)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4R1	Uncharacterized protein	Medium	14.4	1	267-287	RPILPLPRKRQKARKNAPSTA	cyto(14),nucl(11)	PRKRQKARK (273-281, prob:0.762),RGKRK (432-436, prob:0.673)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIG3	Uncharacterized protein	Medium	11.5	1	34-59	VTLSYKQPSKHPRAHRLPSDRKNNIV	nucl(17),cyto(9)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETD0	F-box domain-containing protein	Medium	11.1	1	815-838	SAADQFQTKKRRLRRGERGSNGAS	mito(10),nucl(8),cyto_mito(8)	KRRLRRG (824-830, prob:0.713)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUX3	RNB domain-containing protein	Medium	14.2	2	481-504, 531-550	DEVWGQKREKEEKKKRKDITDTRT, GGLRRRGSLRQRPTQKKNDD	nucl(15),cyto_nucl(11.5),cyto(6),mito(3)	KREKEEKKKRK (487-497, prob:0.827)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EYJ5	Uncharacterized protein	Medium	12.5	1	1028-1052	KYQEMKVKKARKPAKPSKKTNQDDE	cyto(11),cyto_nucl(11),nucl(9),mito(3),E.R.(2)	KPSKASKVEKPAPKSKKEAASDNKKPGSNAKKGTKKGG (390-427, prob:0.981),KVKKARKPAKPSKK (1033-1046, prob:0.927)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F012	Uncharacterized protein	Medium	10.8	1	375-403	IPYQRGAGSKKRKGKGKTSEEKIKKDLKV	nucl(14),mito_nucl(11.499),cyto_nucl(11.333),mito(7.5),cyto(5.5)	AGSKKRKGKGKTSEEKIKK (381-399, prob:0.973)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F111	Uncharacterized protein	Medium	11.4	1	10-30	QTQNSTTKTKKRKRDSESSST	nucl(23),cyto_nucl(13)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F197	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.7	2	35-61, 75-96	GGNHKRIYQACIPCRRRKVRCDLGSVD, SKECYFSATRRKRKADGSRENS	nucl(18.5),cyto_nucl(12),cyto(4.5),pero(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F294	HTH CENPB-type domain-containing protein	Medium	11.4	1	408-434	RTLRKANEALSKRRRAKKIQLRQGGVL	nucl(12.5),cyto_nucl(11.5),cyto(7.5),pero(3),mito(2)	SKRRRAKK (418-425, prob:0.825)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3N0	Uncharacterized protein	Medium	10.5	1	2-30	SKIIFEVQVRSKKRKRQQREKDLVQITKT	mito(18),nucl(8),cyto_nucl(5.5)	KKRKR (13-17, prob:0.724)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6F8	Uncharacterized protein	Medium	10.4	1	15-38	VDKPSAKGASKKKRDKQLSKIVHF	cyto(12.5),cyto_nucl(12.333),nucl(10),cyto_pero(7.666)	KGASKKKRD (21-29, prob:0.764)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4K2	Uncharacterized protein	Medium	13.2	2	256-277, 413-438	CIIFNGRRRRRRVLRQHQLDTG, MAEKLKAREKERARRKKEEEAMNERD	extr(19),nucl(3),mito(2),golg(2)	RR (264-265, prob:0.612),KLKAREKERARRKK (416-429, prob:0.919)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9H5	Uncharacterized protein	Medium	11.8	1	130-150	EEELDKDRRRKIRKELQTDSL	nucl(15),cyto_nucl(14.5),cyto(10)	KAKRGIIRSRRLFVKKRARSITPEEELDKDRRRKIRK (107-143, prob:0.908)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9V3	Uncharacterized protein	Medium	13.5	1	111-143	PSKNRVTKTKAIPKPRVKKTPAKKPTKKVAAEE	nucl(22.5),cyto_nucl(14),cyto(4.5)	RVTKTKAIPKPRVKKTPAKKPTKK (115-138, prob:0.979)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBB9	Uncharacterized protein	Medium	13.2	1	30-49	KRKSELASRKRRRSISLKRV	nucl(21),cyto_nucl(13),mito(3),cyto(3)	KRKSELASRKRRRSISLKR (30-48, prob:0.902)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHK8	Uncharacterized protein	Medium	10.2	1	23-48	ASSSPFSSLPKRKHIQRSKSKAESDE	mito(19),nucl(6.5),cyto_nucl(4.5)	KRKH (33-36, prob:0.63)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKD5	Uncharacterized protein	Medium	10.1	1	774-805	GSESDDSERRRRRRHHRRHHSRRRSCSSNGDS	cyto(8.5),cyto_nucl(8.5),nucl(7.5),extr(3),E.R.(3),golg(1),pero(1),plas(1),mito(1),vacu(1)	RRRRRRHHRRHHSRRR (782-797, prob:0.984)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EL85	Uncharacterized protein	Medium	13.8	1	1-30	MPKPTTEGPKRKASKPRKRPLPNDRDINGN	nucl(22.5),cyto_nucl(12),mito(4)	GPKRKASKPRKRP (8-20, prob:0.95)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENU7	Uncharacterized protein	Medium	14.3	1	421-444	VCPFCPEREHRYPRPDNLQRHVRV	nucl(25),cyto_nucl(14.5)	GPSRGRRRRGGSR (466-478, prob:0.925)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ESG5	Uncharacterized protein	Medium	10.1	1	484-506	GSNKSPTEERKKHSPLRYEERRV	nucl(19.5),cyto_nucl(12),cyto(3.5),plas(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EU15	CP-type G domain-containing protein	Medium	12.2	1	630-660	DPNDVKKLTSKKHFKGNKPGGKGKRRANYFA	nucl(14),cyto(12.5),cyto_mito(7)	KLTSKKHFKGNKPGGKGKRR (636-655, prob:0.955)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F495	Uncharacterized protein	Medium	12.7	1	13-40	VSEAKETTKINPRPKKLKCFRIQGIPIG	nucl(20),cyto(6)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EC69	DNA mismatch repair protein msh3	Medium	12.5	1	194-214	APAPVKTKKKGAKTGKLTPME	nucl(15),mito(9),cyto_nucl(9)	KKKG (201-204, prob:0.636)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENV0	60S ribosomal protein L29	Medium	14.2	1	2-28	AKSKNSSQHNQSKKAHRNGIKKPKTSR	nucl(23),cyto_nucl(14)	KKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALKELKEGKR (14-62, prob:0.944)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ESL4	Uncharacterized protein	Medium	10.9	2	1-22, 622-647	MGKASRNKTKHRADPTAKTVKP, EETLPKCKKMAKTIDKRKSPELRSRV	nucl(14),mito(9),cyto_nucl(9),cyto(2),pero(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EYH7	AKAP7_NLS domain-containing protein	Medium	13.2	1	107-129	LNTNPKNQKQTQKPHQHQRLKFD	nucl(18.5),mito_nucl(11),cyto(6)	KKKKK (159-163, prob:0.683)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EYW6	Uncharacterized protein	Medium	11.5	1	47-69	LDDTKGKPSNNHRRSNRVSKPSS	nucl(26.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6M9	Uncharacterized protein	Medium	11.3	1	4-31	TTSGRIIKTRKGKKGTAHQKNHRWESFT	nucl(11),mito(11),mito_nucl(11)	TRKGKKG (12-18, prob:0.716)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E532	Uncharacterized protein	Medium	11.6	1	107-129	NDVKWGGKARKKQRQTIRKILDQ	nucl(14),cyto_nucl(12.5),cyto(9),pero(3)	KARKKQ (114-119, prob:0.696)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5A7	Uncharacterized protein	Medium	13.6	1	371-390	AASRGKRGVKRRREELPPDN	nucl(17),cyto(8.5),cyto_mito(5)	RGKRGVKRRR (374-383, prob:0.776)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E9B8	Myb-like domain-containing protein	Medium	13.9	1	424-443	AHLKKRGLRRPPPGEKVGKR	nucl(22.5),cyto_nucl(13),cyto(2.5)	KKRGLRRPPPGEKVGKR (427-443, prob:0.866)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EB45	Uncharacterized protein	Medium	13.2	1	510-535	RHKSGVQVEKTPKRRKRPIEELSSDA	nucl(21.5),cyto_nucl(14),cyto(5.5)	PKRRKR (521-526, prob:0.712)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EF82	Uncharacterized protein	Medium	13.8	1	86-108	LFKERREEIKKRRRQKLQDSYDI	nucl(22),cyto_nucl(13),mito(3)	ERREEIKKRRRQ (89-100, prob:0.829)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ELJ0	Uncharacterized protein	Medium	11.3	1	37-58	EPSSSHSPRKRSHCEVEKNSYF	nucl(25),cyto_nucl(14.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENE1	HMG box domain-containing protein	Medium	14.3	2	64-84, 86-138	QTKTTTAKKPATKKEPAKKST, KEPAAKKTAAKKPVKKAAKKPAAKKLAKKPAKKTLKAKPKKAKKAKTPLTDSQ	nucl(14.5),mito(11),cyto_nucl(8.5)	KKPATKKEPAKKSTAKEPAAKKTAAKKPVKKAAKKPAAKKLAKKPAKKTLKAKPKKAKKAKT (71-132, prob:0.999)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENW4	CNH domain-containing protein	Medium	12.3	1	3-29	STDPEDILSPRKRKRRVPENGPYVLRS	nucl(16),cyto_nucl(12.5),cyto(7),pero(2)	RKRKRR (13-18, prob:0.725)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVN7	Uncharacterized protein	Medium	10.7	1	213-232	FSLDKKSSRKGKEKEREIAD	cyto(14.5),cyto_nucl(14),nucl(10.5)	IKHLRKGFSLDKKSSRKGKEKE (206-227, prob:0.885)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4K4	Uncharacterized protein	Medium	11.2	1	426-457	PSPRTTSHENKPKEKHAPRHRRPDPLVNPFSR	mito(12),nucl(8),cyto(5)	KPKEKHAPRHRR (436-447, prob:0.743)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7D2	Uncharacterized protein	Medium	10.1	1	337-357	TVSIRHPKTRKSRKLWVAMHI	nucl(21),cyto_nucl(14.5),cyto(6)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9R4	Uncharacterized protein	Medium	13.5	1	112-135	QQQIRDDIKPRSRRKDTNNTREVM	nucl(22.5),cyto_nucl(14),cyto(4.5)	KRKAKPWVPAGMGPPIEKRRGR (56-77, prob:0.786)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1Y1	Uncharacterized protein	Medium	14.7	2	419-440, 474-495	KANEALSKHRRAKKTQLRQGGV, ASSSRCCSKCGKPGHNSRTCQI	nucl(14),cyto(8),mito_nucl(8)	R (429-429, prob:0.602)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5T0	DUF5672 domain-containing protein	Medium	13.1	1	76-126	VKKQEDEKKKKEEIRKKKEEGQKKKEEEQRKKEEKAKKKKLEDEKKKLENE	nucl(19.5),cyto_nucl(12),cyto(3.5),mito(3)	EKKKKEEIRKKKEEGQKKKEEEQRKKEEKAKKKKLEDEKKKLENERKKMKGKGQNDSKKVGRGKQDGKKKQEKENGKKSENRERK (82-166, prob:0.999)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EES5	U3 small nucleolar ribonucleoprotein protein MPP10	Medium	14.3	2	83-110, 666-694	LGDEQAKRLKEQRKKRKRGERDEAAGDV, REEMSREEKLRRRRREKERIKKMGEGEKV	nucl(10),mito(9.5),cyto_nucl(9.333),cyto_mito(8.666),cyto(6.5)	AKRLKEQRKKRKRGER (88-103, prob:0.976),SREEKLRRRRREKERIKKMGEGEKVLSKKAKEKKDVVGELKRGGVKVIGKRG (670-721, prob:0.997)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFP6	Uncharacterized protein	Medium	14.2	1	432-463	DEYDKHQSHKTDRSKRRRANAKKPHLPQRARE	nucl(23),cyto_nucl(14)	DRSKRRRANAKKPHLP (443-458, prob:0.929)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPF8	PH domain-containing protein	Medium	14.4	2	246-273, 341-362	RQIPKDQSIPRSRRRRRREAREIQVNDE, IGGRPRRHRMLHRRTPNPIPSH	nucl(14.5),cyto_nucl(9.5),cysk(9)	PRSRRRRRRE (255-264, prob:0.888)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPQ4	Uncharacterized protein	Medium	11.2	1	380-399	GWWYIWEKKRERRYNLEDID	nucl(16),cyto(7),pero(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EX67	Origin recognition complex subunit 4	Medium	14.6	2	1-23, 117-136	MAPSEPPSTRKRIRSRISDEVDE, ILSAKRGRGRPRKNEDGLGK	nucl(18),cyto_nucl(12.5),cyto(5),mito(4)	AKPMAKNIKAAKSTAKGVILSAKRGRGRPRKNE (99-131, prob:0.963)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZB7	Uncharacterized protein	Medium	11.2	1	206-229	GDIKQKIKGGRRAIRRPRKDIEKD	nucl(9),mito(7),cyto_nucl(7),cyto(5)	KQKIKGGRRAIRRPRKD (209-225, prob:0.94)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E814	Abhydro_lipase domain-containing protein	Medium	14	1	198-227	RVFYDEEKTRKRRRKEDEMRWKRLNRRKFS	plas(11),nucl(6.5),cyto_nucl(6),mito(5),cyto(4.5)	KTRKRRRKEDEMRWKRLNRRKF (205-226, prob:0.967),KRKEKLKAKGKK (584-595, prob:0.904),KKRRR (616-620, prob:0.68)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EG72	Uncharacterized protein	Medium	13.4	1	302-322	RKGPVGKKGKRGPGRGRKKIV	nucl(20.5),cyto_nucl(12.5),mito(5)	RRKGPVGKKGKRGPGRGRKK (301-320, prob:0.996)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EGW9	Cep57_MT_bd domain-containing protein	Medium	14.2	1	75-100	MSTDLEIQRRKRKQAQRPEINIRDTA	nucl(24),cyto_nucl(14.5)	R (86-86, prob:0.601)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIS5	Rab-GAP TBC domain-containing protein	Medium	11.7	1	94-116	FGLPSISSKKRKNQSRLKSASAG	nucl(18),mito(6),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EM74	Serine/threonine-protein kinase RIO1	Medium	12	1	523-573	KGTPRGKRFEDKDAKKEHKKAVKEEKREKRKDKIPKHLKKKLVSSTAKHKH	nucl(20),cyto_nucl(13.333),mito_nucl(11.333),cyto(5.5)	EKGTPRGKRFEDKDAKKEHKKAVKEEKREKRKDKIPKHLKKKLVSSTAKHKH (522-573, prob:0.999)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUL8	Uncharacterized protein	Medium	13.4	1	91-115	SKVGSKSKNRISKRKVSSRKSQMTF	nucl(14),mito(12)	KSKNRISKRKVSSRK (96-110, prob:0.8)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0N1	Uncharacterized protein	Medium	12.9	1	38-64	NLQISNQQPAPRKKKKDRHAYHVVEAQ	nucl(18),cyto_nucl(13),cyto(6)	RKKKK (49-53, prob:0.754)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDV7	Uncharacterized protein	Medium	13.2	1	403-422	DIDPPRKKHGRARQEGQGQD	nucl(11),mito(9),cyto_nucl(9),cyto(5)	RKKHGRA (408-414, prob:0.677),GEGGKRRK (429-436, prob:0.72)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EH63	BZIP domain-containing protein	Medium	14.5	1	43-74	AERRRIQNRIAQRNYRKKLKRRLEDLERRAGS	nucl(26.5),cyto_nucl(14)	QRNYRKKLKRR (54-64, prob:0.81)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EHZ7	Reverse transcriptase domain-containing protein	Medium	10.7	2	1-29, 220-239	MRAKADNSPRNRNRNQESREPRNNPRSSP, CSDARSRYRHQQIDKKTFRR	nucl(12.5),cyto_nucl(10),cyto(6.5),mito(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIW0	Non-specific serine/threonine protein kinase	Medium	14.1	1	1086-1106	ADSRQHRLSRTQQNTRARQIE	nucl(22.5),cyto_nucl(12.5),mito(2)	PMQPPKKKGFNLGRLFKKKL (1043-1062, prob:0.828)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJI1	Uncharacterized protein	Medium	13.7	2	94-113, 598-625	QMPIKQKTSSRKEQGKQANA, NAYFRKPVNPHRHVGRQRRARPSDYREL	nucl(13.5),cyto_nucl(11.5),cyto(8.5),mito(3)	KASKPTGKAKSPTPKPSPKPKSPEVSKVLKR (390-420, prob:0.949)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ETU8	Uncharacterized protein	Medium	10.5	1	280-303	NTPPTVPNPPPKKKRNPWQRFLDW	nucl(21),cyto_nucl(13.5),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZY1	J domain-containing protein	Medium	10.8	1	1111-1136	GDQNERHCHSRYKRPKFCKYTSGSIH	nucl(21.5),cyto_nucl(12.5),mito(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F520	Uncharacterized protein	Medium	11.3	1	21-42	VGGDKLKKGKKDKLKKGQGKES	nucl(12),cyto_nucl(11.5),cyto(9),pero(4)	KLKKGKKDKLKKGQGKE (25-41, prob:0.963)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7U7	Uncharacterized protein	Medium	11.7	1	121-145	LYAHAKFAKRKAKPLRIKRKDMAMQ	nucl(13.5),cyto_nucl(11.5),cyto(8.5),pero(3)	KFAKRKAKPLRIKRK (126-140, prob:0.929)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECT0	WD_REPEATS_REGION domain-containing protein	Medium	10.1	1	6-36	PQLPKLPSMIRTPRKERRQASITPRRFKRFF	nucl(17.5),cyto_nucl(11),mito(6)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJQ1	Uncharacterized protein	Medium	10	2	1-23, 729-748	MPLSNQNKQPRIKNNPTTPKEAI, NPFTCKKTARCSRCGKQNAE	mito(16),nucl(9.5),cyto_nucl(6)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ESJ1	Uncharacterized protein	Medium	14.6	1	350-377	EPITTSNGRRRGRRRIMKKKTVKDEDGY	nucl(17.5),mito_nucl(13),mito(7.5)	GRRRGRRRIMKKK (357-369, prob:0.947),KKDAPK (411-416, prob:0.633)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6E9	Dual-specificity kinase	Medium	13.3	1	1245-1272	LGKPRLTVSSKGRRRRPSSRSLQQTIKC	nucl(22),cyto_nucl(14.5),cyto(5)	SKGRRRRP (1254-1261, prob:0.76)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E8W5	Uncharacterized protein	Medium	10.5	1	75-95	SSPLKPTKSIKQRNILQPRSQ	nucl(20.5),cyto_nucl(11.5),mito(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ECR2	Uncharacterized protein	Medium	12.3	1	31-50	EERKGKKRIIWKSKVGREMK	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(5)	GEGGIGKRGEERKGKKRIIWKSKVGR (22-47, prob:0.979)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ED91	Uncharacterized protein	Medium	13.1	1	186-205	STPSSYRRIRKSKSMFSPLS	nucl(19),cyto_nucl(13),cyto(5)	GLRAKARKVSQGLKSRLRK (324-342, prob:0.798)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EER2	Intu_longin_1 domain-containing protein	Medium	12	2	332-360, 404-426	IDNPSSTRRAKKPPKPKPRVEPKLKDAKN, KGDRAKSKFKSPRPPPHRNPASH	mito(10.5),cyto_mito(10.333),cyto(9),cyto_nucl(6.333),extr(5)	RRAKKPPKPKPRVEPKLKDAKN (339-360, prob:0.988),RAKSKFKSPRPPP (407-419, prob:0.72)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKK7	WD_REPEATS_REGION domain-containing protein	Medium	14.3	1	85-106	VDSQAKRGLKPKKEIWEKKIPQ	nucl(18),pero(4),cyto(3.5),cyto_mito(3)	KRGLKPKKEIWEKKIPQAPK (90-109, prob:0.828)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7END6	60S ribosomal protein L35	Medium	14.7	1	84-125	DLRSKQTRAIRRRLSKHEKELQLEKTKKRSMHFPQRKFAVKA	nucl(18),mito(5),cyto(4)	KQTRAIRRRLSKHEKELQLEKTKKRSM (88-114, prob:0.829)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EQY9	Ribosome production factor 2 homolog	Medium	11.8	1	1-29	MLRQIKPRNARSKRALTKKAPKPVENPKT	nucl(19),mito_nucl(13.333),cyto_nucl(10.833),mito(6.5)	KPRNARSKRALTKKAPKP (6-23, prob:0.859)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERU2	Uncharacterized protein	Medium	10.3	2	57-87, 188-207	KSPINRPTFQLNNKRRRQPSHSEPHINSPKE, NLVTKGKPTKQKTTEQKEEA	nucl(13),cyto_nucl(11.333),cyto(7.5),cyto_mito(5.666),mito(2.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3R2	Uncharacterized protein	Medium	14	2	418-439, 473-494	KANEALSKHRRAKKTQLRQGGV, ASSSRCCSKCGKPGHNSRTCQI	nucl(14.5),cyto_nucl(11),cyto(6.5),pero(4)	R (428-428, prob:0.602)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EA87	Smr domain-containing protein	Medium	12.1	1	207-235	SESSASYKTHKQKRKKKDRRTNPSESNTV	nucl(15),cyto_nucl(13),cyto(9)	HKQKRKKKDRR (216-226, prob:0.923)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENF0	Uncharacterized protein	Medium	10	2	1415-1442, 1764-1785	TSEEWYARYHRKKVKFQKRRNHRTFAND, ADDPRQVRNYRKDRNGEKSCDH	extr(14),plas(9),mito(1),pero(1),E.R.(1),vacu(1)	RKKVKFQKRR (1425-1434, prob:0.739)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUC8	Signal recognition particle receptor subunit beta	Medium	11.2	2	822-848, 866-889	QSPSQPSRSQTKPPKIKNPNIHRRVDI, GTTFQRDLRKYFKEKKNWRFDSSG	cyto(7),E.R.(6),extr(5),cyto_nucl(5),nucl(3)	GKKRKAGGGNKKQARK (359-374, prob:0.921)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EX12	RRM domain-containing protein	Medium	13.2	1	320-347	IKAVTPKDNKHGKNNKNKGKGGNRHDGG	nucl(21),cyto_nucl(13),mito(3),cyto(3)	NKHGKNNKNKGKGGNRHD (328-345, prob:0.851)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZD7	Uncharacterized protein	Medium	11	2	139-163, 1930-1951	DGANGQPAKKKRKSKVFTNGNVNRY, ATFPERESRPLKKDNRKSFFSG	plas(11),cyto(4),nucl(3),cyto_pero(3),extr(2),pero(2),E.R.(2),mito_nucl(2)	AKKKRKS (146-152, prob:0.792)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2U3	Casein kinase II	Medium	14.8	1	54-82	NYQKCVIKVLKPVKKKKIKREIKILQNLS	nucl(17),cyto(8)	KPVKKKKIKRE (64-74, prob:0.894)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4B9	Uncharacterized protein	Medium	13.7	1	15-41	QQLDSLPKRQKQKPDRAKREAKRAEQA	nucl(21),cyto_nucl(13),cyto(3)	KRQKQKPDRAKREAKRAEQARTGLKIKLSLGSRQKKAASPAPKISS (22-67, prob:0.983)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6F1	Pex24p domain-containing protein	Medium	10.4	1	473-501	VDGVGRRGEWRRRRWIRMVKRRWENQEGG	plas(20),vacu(3),nucl(1),mito(1),E.R.(1),golg(1),mito_nucl(1)	KEGAREGSKKHKSGLKENLKKAHSK (39-63, prob:0.909),RGEWRRRRWIRMVKR (479-493, prob:0.795)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVJ3	MADS-box domain-containing protein	Medium	10.5	1	13-32	GDERRRRRACHDRTQTVMKK	nucl(20),cyto_nucl(12.5),mito(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZG3	Uncharacterized protein	Medium	10.7	1	40-67	SQKHQFRLERRYKRRAKLKWARPRWTKA	mito_nucl(10),nucl(9.5),mito(9.5),cyto(6)	RLERRYKRRAKLKWARPRWTK (46-66, prob:0.959)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2Z8	Uncharacterized protein	Medium	12.4	1	643-663	QGIGREKSGRNSKRKGRKKLG	nucl(11),mito(5),cyto(4),pero(3),plas(2)	REKSGRNSKRKGRKKLG (647-663, prob:0.984)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3V7	Uncharacterized protein	Medium	13.7	1	861-887	ELAMLINAKKKRKRRKLPGNVQRDCAN	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	KKKRKRRKL (869-877, prob:0.969)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5V0	Uncharacterized protein	Medium	14.7	1	182-204	RVLCLVVKRKDKKGKASPANGGQ	nucl(16.5),cyto_nucl(9.5),mito(9)	ERSKSKGKKK (79-88, prob:0.845),KDKKG (191-195, prob:0.639)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E662	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.2	1	11-60	STSSDPPTVAQRKRRRRAPASGASDDCFACTKRNVKCDRRRPYCSQCLEV	nucl(13),mito(8),cyto(4)	RKRRRR (22-27, prob:0.731)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E747	Uncharacterized protein	Medium	12.3	1	71-95	PVPETTIRKKRLGRPPKNKPPGWDL	mito(17),nucl(6),cyto(3)	RKKRLGRPPKNKP (78-90, prob:0.874),RGRGRGRGFRGGGRWARRG (108-126, prob:0.903)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAD7	Exonuclease domain-containing protein	Medium	11.4	1	832-851	GFNARKEREREREREREGKD	nucl(11.5),cyto_nucl(10),cyto(7.5),pero(5)	KERERERERE (837-846, prob:0.661)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EC98	Uncharacterized protein	Medium	13.7	1	81-101	TPSGPKNSKKAEKKPAVKRGL	nucl(21),cyto_nucl(13),cyto(3)	KGAKSNSKAEAAAAKKAEADRKKAEKDALLKAEEADTPSGPKNSKKAEKKPAVKR (45-99, prob:0.904)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENY3	Uncharacterized protein	Medium	12.6	1	21-46	REREEVKKKKTAPKKERAKKNWREME	nucl(16),cyto_nucl(10),mito(9)	REREEVKKKKTAPKKERAKKNWR (21-43, prob:0.989)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERC9	Exonuclease domain-containing protein	Medium	12.1	1	68-96	SAQEWQTVERRPKKKAKKIPKAGNGNYPA	nucl(15.5),mito_nucl(9.333),cyto(7.5),cyto_mito(5.333)	RRPKKKAKKIPKA (77-89, prob:0.969)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EUD7	Uncharacterized protein	Medium	14.5	2	203-245, 269-295	KQEAIKRAKEERKAKKKAEKAELLELSKKRKKKHVSLNGLTSL, GGNHIARDCPRPKRKHQGDGGPPRKSQ	mito(13),mito_nucl(12.833),nucl(11.5),cyto_mito(8.333)	SKQEAIKRAKEERKAKKKAEKAELLELSKKRKKKH (202-236, prob:0.996),RPKRKHQGDGGPPRKSQRTK (279-298, prob:0.852)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2A6	Uncharacterized protein	Medium	11.7	2	180-199, 1619-1641	ISPTRSPTRRPPVVRPNSML, IAVDIRTKSRRRVQRQRELEGVR	nucl(16.5),cyto_nucl(9.5),mito(9)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2H8	Uncharacterized protein	Medium	11.6	1	390-416	IRRSIERRKTYIRKHGLRKVRENHFEN	nucl(12.5),cyto_nucl(9.5),mito(7),cyto(5.5)	RKRLKRELRDLPSQKESTRAKLAIIRRSIERRKTYIRKHGLRK (366-408, prob:0.889)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4Q8	Uncharacterized protein	Medium	12.4	3	386-405, 596-621, 749-774	TAITTRKKRKQSAQVRIQQP, ETKLLEERTRQKRERKDQRTKLSTLR, TKGLNEVQRKEKQRKDKDEERKMVEA	plas(17),nucl(6),mito(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F927	Uncharacterized protein	Medium	10	1	123-142	EKARRRFLSRWTKKDREQVD	plas(27)	KARRRFLSRWTKKDR (124-138, prob:0.707),EEKKKGGI (144-151, prob:0.703)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5Q5	Uncharacterized protein	Medium	14.5	1	199-220	SSTPSKRGRGRIKGSKTRQRSL	nucl(25.5),cyto_nucl(14)	KRGRGRIKGSKT (204-215, prob:0.797)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EKD0	Uncharacterized protein	Medium	14.8	1	1-28	MVKPLSFKGDKKTKKRKRVDTAEKFGDS	nucl(16),cyto(6.5),cyto_mito(6),mito(4.5)	GDKKTKKRKR (9-18, prob:0.877),RFKPKLKASKEEKASQKISR (209-228, prob:0.767)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERV4	Uncharacterized protein	Medium	11.9	1	53-74	EENAHKRGKRRKPDTISRPRQE	nucl(14),cyto_nucl(12),cyto(8),mito(2)	HKRGKRRKP (57-65, prob:0.851)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWV6	Uncharacterized protein	Medium	12.8	1	317-339	HLLQVLHKRQHNKSNKPRKKLCR	nucl(13),pero(7),mito_nucl(7)	NKSNKPRKK (328-336, prob:0.721)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXU7	Type 1 phosphatases regulator ypi1	Medium	12	1	143-169	GHAHGKGKGKGKERKRSPNAYERQPNY	nucl(15.5),cyto_nucl(12.5),cyto(6.5),mito(4)	HGKGKGKGKERKRSPNAYERQPNYKGKDKGKGGG (146-179, prob:0.986)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F299	Uncharacterized protein	Medium	10.2	1	120-140	QEVHLRRPRRQIKAPERPGFR	nucl(20),cyto_nucl(13.5),cyto(5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F3L4	Uncharacterized protein	Medium	11.5	1	1-34	MTRTAKREIGRKALPKKKNKRREGVKQFNRIILI	nucl(11.5),mito(11),cyto_nucl(7.5),cyto(2.5)	KREIGRKALPKKKNKRREG (6-24, prob:0.986)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F5H9	PH domain-containing protein	Medium	13.7	1	309-329	EVQRVQKQSQKKRSAYDRSRP	nucl(22.5),cyto_nucl(13.5),cyto(3.5)	KKTKK (342-346, prob:0.649)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E4Y4	Uncharacterized protein	Medium	12.3	1	29-48	NETKAGKRRRIREIKSNTTS	nucl(16),cyto_nucl(13),cyto(8)	KRRR (35-38, prob:0.638)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E668	Uncharacterized protein	Medium	10	2	1-28, 57-89	MVFNKNSKSFHKSKKPTKLPKSAVADAH, EISTIPARVKRNRKGKSKIPKSARLKRCRDETL	plas(23),E.R.(2)	RVKRNRKGKSKIPKSARLKR (64-83, prob:0.973)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EAH2	Uncharacterized protein	Medium	14.3	1	283-306	KPSHQLDGGKKKKNKNNTTRDILN	nucl(23.5),cyto_nucl(14)	GGKKKKN (290-296, prob:0.763)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EC14	Zn(2)-C6 fungal-type domain-containing protein	Medium	11.4	1	132-151	SVACGHCRRRKIRCIPAPAD	nucl(25),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EEI3	Uncharacterized protein	Medium	14.8	1	532-562	HQRYPDLPKKDPKDSRKKKGRNYPKEFPSAL	nucl(17),cyto(5),pero(3)	PKKDPKDSRKKKGRN (539-553, prob:0.922)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPF3	Uncharacterized protein	Medium	14.8	2	130-157, 621-643	SGLSARQLNQLKRKRKREAMSAGNKSRL, TPSGPEPPTKKRRKTAKVVEPTP	plas(11),nucl(8.5),cyto_nucl(6),mito(5)	KRKRKR (141-146, prob:0.764),TKKRRK (629-634, prob:0.738)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXC7	Uncharacterized protein	Medium	11.4	1	665-695	KEYLKRFVKTFGKKERKRPRDRLLRDKDIAP	mito(15.5),mito_nucl(11.333),nucl(6),cyto_nucl(5.833),cyto(4.5)	KTFGKKERKRPRDRLLRDKDIAPKIL (673-698, prob:0.963),R (701-701, prob:0.605)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F0A7	ELYS domain-containing protein	Medium	11.3	1	46-65	FEIRRPAKYYPPKTNNELRN	nucl(23.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2K7	FeS_assembly_P domain-containing protein	Medium	12.5	1	16-40	DVSEISRRREKRKVRDYSAKKHGIQ	nucl(19),cyto_nucl(15.5),cyto(8)	RRREKRKVR (22-30, prob:0.743)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EET4	Uncharacterized protein	Medium	13.4	1	222-253	GEEDEEQKKKKKSRKERKLKEKERRRFRIVIV	nucl(14),cyto(10),cysk(2)	KKKKKSRKERKLKEKERRRF (229-248, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EIF7	Bms1-type G domain-containing protein	Medium	14.2	2	8-34, 50-81	HSHRSTTKTTHKAFKSRKASKGALKEL, QQLMSKFDRRNQARQKQNTKHKEHQRDLNVFQ	nucl(15.5),cyto_nucl(10.5),mito(6),cyto(4.5)	FKSRKASKGALKEL (21-34, prob:0.755)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E526	Zn(2)-C6 fungal-type domain-containing protein	Medium	13.4	2	32-86, 101-124	ASNPQSPGAKSKKRKSSDGNGESTNPEKKKRSSIACTNCRSRKVRCDVERSERVN, IQCLVPGSKRRRTKRGSTDNVEAA	nucl(11.5),cyto_nucl(9),cyto(5.5),mito(4),plas(2),golg(2)	KSKKRKS (41-47, prob:0.748)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E6A3	Cytochrome b5 heme-binding domain-containing protein	Medium	13.4	1	252-275	ETKGEKPKLCERAQKGRKKRTIPE	nucl(12),cyto_nucl(10.5),cyto(7),mito(4),pero(2)	KKLR (208-211, prob:0.638),QREKGWETKGEKPKLCERAQKGRKKRT (246-272, prob:0.898)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EDW8	Uncharacterized protein	Medium	13.4	1	450-469	DENTGGKRRKTTNQGKNLGN	nucl(21),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ENQ1	Protein-tyrosine-phosphatase	Medium	10.4	1	145-170	TVERPMTSPSPRKKNPKSLALNLRPS	nucl(20.5),cyto_nucl(13),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ER99	AMP deaminase	Medium	10.1	1	947-969	RIFPGLVSRKQRRESTRKNSVTE	nucl(21),cyto_nucl(14.5),cyto(6)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERV2	Uncharacterized protein	Medium	11.4	1	180-200	VLPTGRCTRRKTSSRKHLSDE	nucl(23.5),cyto_nucl(13.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EW72	Uncharacterized protein	Medium	14.8	2	101-122, 1109-1129	ASVFQRWKHEHLRRKTSPPGSA, LLPMSPKKRSRSPMKKMFGEH	nucl(19.5),cyto_nucl(14),cyto(7.5)	SKKE (396-399, prob:0.623)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F311	Clr5 domain-containing protein	Medium	14.3	2	44-63, 190-213	QTQFKKWEFPSKQNPAHRNE, ESAERWAARKRRRRTRGWAGLPAD	nucl(16),cyto_nucl(12),cyto(6),pero(3)	RWAARKRRRRTRG (194-206, prob:0.933)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F4R9	Phosphodiesterase	Medium	14	1	899-923	AETGRNLKKKPSRFRMNGLHFWKRK	nucl(15),cyto(10)	KKKPSR (906-911, prob:0.673)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F8L9	Uncharacterized protein	Medium	10.2	1	29-50	SDYEKKDKKFDFKKKSLPDGES	nucl(21),cyto_nucl(13),mito(3),cyto(3)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E607	Zn(2)-C6 fungal-type domain-containing protein	Medium	12.1	1	12-57	TSSTSASPEPPPRQRPRQKRSQVAKACDWCRVHRIKCDNDHPCNNC	nucl(20),mito(2),cyto(2),plas(2),cyto_mito(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EPH1	Uncharacterized protein	Medium	14.7	1	1365-1389	STNLQLKRTRTLRRPEKRRALSSGS	nucl(17.5),cyto_nucl(13.5),cyto(6.5)	AKKGEKKAR (710-718, prob:0.748),RRPEKR (1377-1382, prob:0.628)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZ08	ENDO3c domain-containing protein	Medium	12.8	1	63-82	APPASTKLPKPKKTKAISPE	mito(19.5),cyto_mito(12.666),mito_nucl(12.499),cyto_nucl(4.499),nucl(4)	SKVKMSRKRKTELPEATAPPASTKLPKPKKTK (46-77, prob:0.835),KKRK (96-99, prob:0.656),KLKKAGKGAKGGGKW (384-398, prob:0.86)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EZJ6	Uncharacterized protein	Medium	10.7	1	215-235	NSTNNHPRRRRQEVPQRPLAE	nucl(21.5),cyto_nucl(12),mito(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F7Y8	HTH CENPB-type domain-containing protein	Medium	11.7	1	403-426	LRKANEALSKRRRARKALIRKGGV	cyto(11),nucl(10),pero(6)	LSKRRRARKALIRK (410-423, prob:0.921)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E5U5	Uncharacterized protein	Medium	13.6	1	24-51	LKTPVAKKAKGQKKKKKQKEEEVVEEEE	nucl(21),cyto_nucl(12.5),mito(4)	KKNPKLILKTPVAKKAKGQKKKKKQKEEEVVEEEEKHKHKKSIKKSEETKNPARRALDIKTSPDSISKKIQRRAKDK (17-93, prob:0.998)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJ98	Uncharacterized protein	Medium	10.2	1	331-353	PEPHLSRPRRTAKAKRRRQQTSA	plas(15),nucl(6),E.R.(3),mito_nucl(3)	PEPHLSRPRRTAKAKRRR (331-348, prob:0.934)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EJV7	Uncharacterized protein	Medium	12.6	1	213-237	GENGIPVKSPQKKPLKKNKVFGGMG	nucl(12),mito(9),cyto(5)	KSPQKKPLKKNKVFGGMGNHKNEKK (220-244, prob:0.865)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EV75	HTH CENPB-type domain-containing protein	Medium	11.9	1	443-469	NNLRAIMKKHTIRKKGKRLVLKGHFHI	nucl(14.5),cyto_nucl(11.5),mito(6),cyto(5.5)	KKHTIRKKGKR (450-460, prob:0.83)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXY4	Uncharacterized protein	Medium	12.9	2	47-68, 158-181	SIKNSNSSLKRRSKKLLEDSID, RQANGEPKSKRRKAEREVRKDADR	nucl(10.5),cyto_nucl(9.5),mito(9),cyto(7.5)	PKSKRRKAEREVRK (164-177, prob:0.894)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F2A3	Uncharacterized protein	Medium	14.5	1	2-42	DRKDIKVVGRRSRKSQRHNLSKLKRCQKTSKKEWCTKERCM	nucl(25.5),cyto_nucl(13.5)	RRSRKSQR (11-18, prob:0.677)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F821	Uncharacterized protein	Medium	10.1	1	92-115	GSPLGVKERKTRQKLNERDHNAVE	nucl(19.5),cyto_nucl(13),cyto(5.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7E8Y4	Uncharacterized protein	Medium	12.4	1	84-109	LKARGKGAPKKKRTAEDSKKFKGKKR	nucl(17),cyto_nucl(11.5),mito(6),cyto(4)	KARGKGAPKKKRTAEDSKKFKGKKR (85-109, prob:0.994)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EBN1	ATP-dependent DNA helicase II subunit 1	Medium	10	1	574-593	VEVPKKKKVLVKSSAKKLGE	nucl(16),cyto(8),mito_nucl(8)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EFB5	HMG box domain-containing protein	Medium	11.1	1	252-279	PTYKYAPRKPSEKKRRASKKTLTKPTTN	nucl(14),mito_nucl(11.333),cyto_nucl(9.333),mito(7.5),cyto(3.5)	KEAHKKAYPTYKYAPRKPSEKKRRASKK (244-271, prob:0.975)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERB4	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit	Medium	10.3	1	9-34	HEQLSRTKDPNKSKSKKGDSKDGTSS	nucl(19.5),cyto_nucl(12.5),cyto(4.5)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7ERQ6	Uncharacterized protein	Medium	12.2	2	4-24, 29-51	FCDVCHRRRSWRYHLQHPITS, TSSICTRCSKNRSREPPFHKLKA	nucl(13),plas(6),mito(4),cyto(2)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVB1	Uncharacterized protein	Medium	10.9	1	5-27	EGSERDKHRKEIRWLKKVRCDNE	nucl(17),mito(4),cyto(4),cyto_mito(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EVJ0	Uncharacterized protein	Medium	11.3	1	93-117	PINRPMFQFNKKRRRQPSHLEPHIN	nucl(23.5),cyto_nucl(14)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWH8	Ubiquitinyl hydrolase 1	Medium	11.4	2	1099-1118, 1135-1159	DPELVSKRKARDTRKKQGVT, MDTWYCPRCKEHRRASKKFEIWRTP	nucl(17),cyto_nucl(13.5),cyto(8)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EXE0	Uncharacterized protein	Medium	13.4	1	1044-1067	DEDIGSPWRRDRKAKRNASGYAED	nucl(14),cyto(8),pero(2),cysk(2)	RPGK (967-970, prob:0.608)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1U1	Uncharacterized protein	Medium	11.7	1	35-68	THAIRGRHRRISACKDCKRKERRRLEEESRNIVV	nucl(18),mito(5),cyto(4)	
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F6L3	Uncharacterized protein	Medium	11.6	1	2-26	PWLSCVTAKGRRKRKFEQQSFKEDA	nucl(12.5),mito(9),cyto_nucl(9),cyto(4.5)	RK (13-14, prob:0.616)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F9D6	Uncharacterized protein	Medium	13.1	1	267-295	EEKNYTRLPKESKKDRSKKNRAGGRQDAG	cyto(6.5),cyto_nucl(5.5),extr(4),E.R.(4),nucl(3.5),mito(3),pero(2),golg(2)	RRSKSEKEKKED (249-260, prob:0.727),TRLPKESKKDRSKKNRAGGR (272-291, prob:0.928),RK (333-334, prob:0.606),GGRKDRGTGRK (361-371, prob:0.719)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7EWT5	Uncharacterized protein	Medium	10	2	547-566, 691-713	EWLSRKTKEREAKQRIRHGF, ESLNRYTRRQGRASRQEQKEMKR	plas(23),mito(2)	AKLQKRADNKSPRVKHAKRREK (379-400, prob:0.936)
UP000001312	Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)	A7F1K5	Aspartate--tRNA ligase	Medium	11.7	1	80-100	RKSMDKERSKAENKKRQSLAR	mito(13),nucl(10),cyto(4)	RKSMDKERSKAENKKR (80-95, prob:0.727)