ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1H7	Ubiquitin fusion degradation protein UfdB, putative	Low	8.7	1	179-199	YLLSCWKRVRRLIKGFRKSSD	nucl(14.5),cyto_nucl(12),cyto(8.5),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8I4	Uncharacterized protein	Low	8.8	1	63-82	SATTISKTPKPRKTNGKTDT	nucl(13.5),cyto_nucl(10.5),mito(7),cyto(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q925	Uncharacterized protein	Low	9.6	1	24-47	RYDEDTSRQRRLRQKLHSYLKYKA	nucl(16),cyto_nucl(10),pero(5),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QB47	Alpha-amylase, putative	Low	7.8	1	410-434	SSTSSLKNGKPKKFRHPQVPKELWT	nucl(9.5),cyto_nucl(7.5),extr(5),cyto(4.5),pero(4),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLH5	Na/K ATPase alpha 1 subunit, putative	Low	5	1	28-55	LPDERDHVTRRPRTQDRGSRSRRRSLSQ	plas(23),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTD7	Dolichyl-phosphate-mannose--protein mannosyltransferase	Low	8	1	10-53	SVRPVSRGNNRSRSRSRSRSRSPNPKSKKSTPKKTKDYSSEGVT	plas(24),E.R.(2)	RGNNRSRSRSRSRSRSPNPKSKKSTPKKT (16-44, prob:0.974)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8Z0	Uncharacterized protein	Low	5	1	165-187	ILCAYFRRRKRRTSTQFNDRERG	plas(7),mito(6),extr(5),E.R.(4),cyto_mito(4),mito_nucl(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAK1	GlcNAc kinase	Low	5.5	1	237-258	ASNQKLKQRSRNILRKVSKRCS	cyto(21),cyto_nucl(13.333),cyto_mito(12.499),nucl(2.5),mito(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFN2	Cdc48-dependent protein degradation adaptor protein (Shp1), putative	Low	8.2	1	251-270	IKQHDEKYTRPKPKYKPFAG	nucl(12.5),cyto_nucl(10.333),cyto_mito(5.999),mito(5.5),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGN8	FGGY-family carbohydrate kinase, putative	Low	5.8	1	1-21	MSSLPYRRQPSRQTSRQASTD	mito(8),cyto(6),pero(4),plas(3),nucl(2),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGW4	WD repeat protein	Low	7.8	1	848-868	PTPIREQSPPRIRKKTSRYTL	mito(14),nucl(7),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGZ7	Translocation protein SEC62	Low	8	1	326-354	SFKPVWGWQEKKKKKVKSAKKAKSSAPAD	plas(23),E.R.(3)	KKKKKVKSAKKAKS (336-349, prob:0.98)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLE5	Uncharacterized protein	Low	8	1	243-272	ALCCFCLVRHRRKIAKKRRNQMQNRWMQPA	extr(17),plas(4),mito(3),E.R.(2)	HRRKIAKKRR (252-261, prob:0.853)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQ70	50S ribosomal protein L24	Low	9.4	1	75-103	FGNKISKGRNKGKTRRSWKPNVRWKKMPS	mito(20.5),cyto_mito(11),nucl(5)	ISKGRNKGKTRRSWKPNVRWKK (79-100, prob:0.943)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QS03	Uncharacterized protein	Low	8.3	1	380-415	QTESPQTDQPTRRRKNRMGQRQRRRLREMREKYGWD	plas(17),extr(3),E.R.(3),cyto_mito(1),vacu(1),cyto_nucl(1),cyto(1),mito(1),nucl(1),mito_nucl(1)	RRRKNRMGQRQRRRLRE (391-407, prob:0.881)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QT55	Uncharacterized protein	Low	6.2	1	338-361	ASLGWLWYRRRARKQQPSTAYQAV	extr(12),mito(5),nucl(3),plas(3),cyto_mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVY1	Ribosome biogenesis protein NSA2 homolog	Low	9.8	1	488-514	MFKVVNTGKKTHKKSWKRMITKPTFVG	mito(9.5),cyto_mito(8.999),cyto_nucl(8.833),nucl(7.5),cyto(7)	RTRKREAREGHLASQKAQSLRGLRAKMYAQKRHAEKIQMKKRIR (378-421, prob:0.805)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAH7	C6 transcription factor, putative	Low	8.1	1	4-40	IAAGRRSHRKSRMGCAQCKRRKVKCDENRPSCHNCTR	plas(14),nucl(8),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAY0	DNA repair protein Dds20/Mei5, putative	Low	8.7	1	1-21	MSQPPSQQAKRRRLNNAASAL	nucl(13),mito(10),cyto_nucl(9),cyto(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEN7	Mitochondrial GTPase (YlqF), putative	Low	7	1	318-343	SRTQRLKAITRERKLKQQERMEASKS	mito(12),cyto_nucl(8.5),cyto(8),nucl(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QF37	Proton-translocating NAD(P)(+) transhydrogenase	Low	5	1	31-56	QAHSLKTTSRAWKHRQGRKRFLVASY	plas(12),E.R.(9),mito(3),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFL4	Zn(2)-C6 fungal-type domain-containing protein	Low	5	1	50-70	EVPCSRCKKRGLSCTVNRSLQ	plas(23),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QRT0	Toxin biosynthesis protein (Tri7), putative	Low	5	1	92-114	SDNRQPRLADKHEKRNRVKKTSA	plas(23),mito(1),extr(1),E.R.(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QT91	C6 transcription factor (Gal4), putative	Low	8.6	1	10-38	FACDECRARKSRCSKGKPKCLQCLKLGKE	nucl(10),mito(4),cyto(4),cyto_mito(4),plas(3),cyto_pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q451	Protein serine/threonine kinase (Ran1), putative	Low	6.9	1	68-87	GLDPRQRKFQQREIKLHHLA	cyto(12.5),cyto_nucl(11),nucl(6.5),mito(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q465	Zn(2)-C6 fungal-type domain-containing protein	Low	6.5	1	1-23	MRACDVCRKKKQRCVTLHGSSSC	mito(16),mito_nucl(11.833),cyto_mito(10.333),nucl(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4V6	Zn(2)-C6 fungal-type domain-containing protein	Low	9.7	1	77-103	DSCHACARSKVRCPKQKPSCSRCEERG	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9A1	mRNA-capping enzyme subunit alpha	Low	7.9	1	371-392	APAIKTAWKKRQAQGERKPGPP	cyto(14.5),cyto_nucl(13.5),nucl(11.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDT1	Polyketide synthase, putative	Low	9.6	1	933-961	RIYWHESRISRNYRKRKDARHPLLGRRAP	plas(15),nucl(4),mito(2),extr(2),E.R.(2)	RKRKDAR (946-952, prob:0.658)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEV7	Pogo transposable element, putative	Low	9.3	1	533-552	TPKASGRPKNQVSKHAKLKA	nucl(15.5),cyto_nucl(11),cyto(5.5),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFZ0	Uncharacterized protein	Low	5	1	248-267	APVDTKKQKIEDKKEKEGPN	extr(17),cyto(4),E.R.(2),golg(2),cyto_pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMV9	TPR domain protein	Low	8	1	1004-1026	ADFNDWQPKHRKRDMVTRFFRKQ	cyto_nucl(12.5),nucl(11.5),cyto(10.5),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QN95	Uncharacterized protein	Low	7.5	1	297-320	DAEVCRTRLRIKFRRKQWDVIRSI	nucl(8.5),mito(8),cyto_nucl(7.5),cyto(5.5),pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QP41	Integrase catalytic domain-containing protein	Low	9.9	1	156-178	HTSWTARKERKASAKRWHARLGH	cyto(12),pero(8),nucl(6),cyto_mito(6)	RKERKASAKRWH (162-173, prob:0.746)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQ92	G-patch domain protein (TFIP11), putative	Low	9.9	1	175-201	EDSSDEERQRRQKRKAQQRKADGRSGV	cyto(9.5),pero(9),cyto_nucl(8.5),nucl(6.5)	QRRQKRKAQQRKADG (183-197, prob:0.846)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QW84	Benzoate 4-monooxygenase cytochrome P450, putative	Low	5	1	176-201	SVNTSRDKEFHRKRRKIWDNAFKKSL	plas(18),mito(2),pero(2),E.R.(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QWE1	Protein kinase domain-containing protein	Low	6.9	1	5-28	VHFPWYLHSIRKQRRNTCNILQNL	mito(19),nucl(5),cyto(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QWP0	DNA helicase recq, putative (Fragment)	Low	9.2	1	116-144	EHGWKNPQNRGRPRSKAPSKPQPNMPWNI	plas(8),cyto(6),mito(4),cyto_pero(4),nucl(3)	RPRSK (127-131, prob:0.635)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4H8	Mitochondrial ribosomal protein L23, putative	Low	8	1	80-100	HGPLRRPKSKKKMTIEMREPF	mito(23.5),cyto_mito(13)	GHGPLRRPKSKKK (79-91, prob:0.872)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAN0	GTPase activating protein (Evi5), putative	Low	7.6	1	162-188	ATNPKSGLAKKTHRKSRPPSIQHLQKL	nucl(8.5),cyto_nucl(8),cyto(6.5),extr(3),cysk(3),mito(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QD80	Zn(2)-C6 fungal-type domain-containing protein	Low	6.4	1	4-32	QPQFGIACKTCRRRGRKCDQTLPKCMRCG	mito(14),nucl(4),plas(4),cyto(2),pero(2),cyto_pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDH6	Cell wall glucanase, putative	Low	5	1	316-338	FLLCCIRQRRLGKREWNAQNNQW	extr(22),plas(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDH7	Uncharacterized protein	Low	5	1	53-77	VYSSSRPSSRRQRRSRNYRDGPDYV	extr(10),cyto(7.5),mito(7),cyto_nucl(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJW7	HET domain-containing protein	Low	7.1	1	216-240	LQLVRKKPEWDKKTHDKCKKTECAA	cyto(12.5),cyto_nucl(10.5),nucl(7.5),pero(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNA8	Cyclin-dependent protein kinase PhoA	Low	8.6	1	46-65	SSSATYKKPPHDQPPQQALE	mito(10),nucl(9),cyto(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1R5	DNA-directed RNA polymerase III subunit	Low	8.7	1	99-121	MPSYSSRYQKRKRTVPKIAGREY	nucl(14),cyto_nucl(12.5),cyto(9),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3T9	Uncharacterized protein	Low	9.6	1	916-942	ETGGHLRRIRVWQSRKRKNIVRWVYGD	nucl(15.5),cyto_nucl(10),mito(4),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4M1	Alpha-1,6 mannosyltransferase subunit (Mnn9), putative	Low	5	1	53-74	LSPPTKPFPKKQAQGRNGKQAP	extr(8),golg(7),E.R.(4),mito(3),plas(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q543	Benzoate 4-monooxygenase cytochrome P450, putative	Low	8.8	1	124-149	ENVFNVTDKQRHKRKRRLVGQGFSEA	cyto(6.5),plas(5),extr(5),cyto_nucl(5),nucl(2.5),mito(2),pero(2),E.R.(2)	RHKRKRR (134-140, prob:0.72)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q604	Nuclear pore complex subunit Nup192, putative	Low	7.7	1	2499-2521	SLACAKYRVLTKKPKGKDVNDTD	plas(10),nucl(8.5),cyto_nucl(7.5),cyto(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAE7	Uncharacterized protein	Low	6.6	1	7-30	TLRTRAFKASRQIRSQRRNISRSS	mito(21),nucl(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDJ1	Uncharacterized protein	Low	6.6	1	352-375	ERAHEEQERRRRHRQKLTVNLGRT	mito(14.5),cyto_mito(10.5),nucl(6),cyto(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGF9	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	1	66-86	QVSKLASGKRRKLQHHQHDID	nucl(11),mito(11),mito_nucl(11)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QH60	3-phytase	Low	5	1	502-523	CPLDRFVKMVHKRRHQVGRFED	plas(20),mito(2),E.R.(2),extr(1),pero(1),golg(1),cyto_mito(1),mito_nucl(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHM3	Uncharacterized protein	Low	9.5	1	26-50	DVSHHLNSRTRKRFRDNRPDQQTVY	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJQ2	Uncharacterized protein	Low	9.6	1	98-119	GVFAHRTKRPRPFRPSSNPFVS	nucl(20),cyto_nucl(16.5),cyto(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLJ3	Uncharacterized protein	Low	9.9	1	104-129	VMSEHNRKKRLENTRRYNKSKTWKNL	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QP87	Iron-sulfur cluster assembly accessory protein Isa2, putative	Low	7.8	1	355-378	TPNRKKQADRSWKPTRQHRKFPTV	mito(12),nucl(7),cyto(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQT3	UDENN FLCN/SMCR8-type domain-containing protein	Low	9	1	55-78	SSASSHSLRSKQRRRLSSTPDNSA	nucl(13.5),cyto_nucl(9),extr(8),cyto(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QS02	C2H2 finger domain protein, putative	Low	9.9	1	37-58	AINANHRVTRRKSMSRRGTEST	nucl(17.5),cyto_nucl(9.5),mito(9)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QT64	Diadenosine tetraphosphate synthetase	Low	9.2	1	39-64	KEDDAKVDAKKQKRKAKDIKAVQLSD	plas(16),nucl(3.5),cyto_nucl(3),pero(2),cyto(1.5),mito(1),E.R.(1),golg(1),vacu(1)	KKQKRKAK (48-55, prob:0.761)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1E5	L-ornithine N(5)-monooxygenase	Low	8.5	1	153-176	VGQELSKHKRKKIRNLSRFPREAE	cyto(5.5),plas(4),extr(4),cyto_nucl(4),golg(4),pero(3),E.R.(3),nucl(1.5)	KHKRKKIRN (159-167, prob:0.789)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1U2	Integral membrane protein	Low	8.6	2	37-64, 615-637	QQQPATRPLPRLRHRNRQPSIRLRRLSS, TCEAMKKVEKRKMREVEQNRTSM	plas(17),nucl(4.5),cyto_nucl(4),cyto(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2G4	Pogo transposable element, putative	Low	9.4	1	508-527	QEKAERAQIRQEKQEQRCKS	nucl(16.5),cyto_nucl(11.5),cyto(5.5),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7I3	Phospholipid:diacylglycerol acyltransferase, putative	Low	8.2	2	28-49, 54-75	ESETKAKSKKHHGVNSHDKEDK, SPIARLKKYLANPRGKRRNSFV	plas(15),nucl(3),mito(2),cyto_nucl(2),E.R.(2),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QCC9	Uncharacterized protein	Low	9.6	1	299-320	YGSRNDKRKRWSVCGAERRQDL	nucl(19),cyto_nucl(15),cyto(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDX0	Pogo transposable element, putative	Low	9	1	561-585	LATPSAPKRAKKQVSKQVKLKAQPE	nucl(15.5),cyto_nucl(12),cyto(7.5),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QE68	Presequence translocated-associated motor subunit PAM17	Low	5	1	243-264	QGYRQWLKDQRAYNRKKSRHII	extr(19),mito(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQC8	Uncharacterized protein	Low	8.4	1	5-26	EESPAQKAARLRRERREAKIKA	plas(21),mito(3),nucl(1),E.R.(1),vacu(1)	KAARLRRERREAKIKAG (11-27, prob:0.863)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2H2	MFS multidrug transporter, putative	Low	5	1	408-431	FHYRCHSRLKLKLHVYRRRTPVKA	plas(24),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3F4	Uncharacterized protein	Low	9.3	1	199-218	EVIPQRQRLRKRHQGIFNIT	nucl(15),mito(4),cyto(4),pero(4),cyto_mito(4),cyto_pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q794	Integrase catalytic domain-containing protein	Low	7.7	1	156-175	NSWTSRKERKADANRWHARL	cyto(10),pero(9),nucl(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAW1	GPI-anchored wall transfer protein	Low	5	1	92-119	ILLSSRSARPRQKQAKPARPNQQQNATG	plas(19),mito(3),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QID3	Large-conductance mechanosensitive channel, putative	Low	6.5	1	143-166	VIKRTVKCRYCRKWISSKAVRCVN	mito(5),nucl(4),cyto(4),cyto_nucl(4),extr(3),pero(3),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIT2	Ion channel, putative	Low	5	1	143-170	GSMIKRTVKCKYCRKWINRKAIRCTNCS	plas(17),mito(3),E.R.(3),vacu(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKP7	FAD dependent oxidoreductase, putative	Low	5	1	3-24	LAAPRKQLRHLQHLQHRRQQSH	mito(27)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNG9	Amino acid permease, putative	Low	5	1	511-531	LEIARRSPFARRQPWKERLGA	plas(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QP29	DEAD/DEAH box helicase, putative	Low	9.5	1	61-80	ADTKQQQQRKPSQPWPDAFK	cyto(16.5),cyto_nucl(11.5),nucl(5.5),cysk(4)	TRGKGGGGGRSKR (46-58, prob:0.733)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPG7	Uncharacterized protein	Low	5	1	323-347	TGLVVWKCCCKRRKAKSNATGGLKS	plas(16),E.R.(5),mito(3),extr(1),pero(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTE2	Uncharacterized protein	Low	5	1	114-134	VEEQRRPRNRKDSLSSRRPNS	plas(18),mito(4),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QWB9	C6 transcription factor, putative	Low	9	1	79-104	ARTKHACEACRRRRIKCDGARPVCQG	nucl(10),mito(5),cyto(5),cyto_mito(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1B9	Endonuclease III homolog	Low	8	1	105-130	ATKAKPASSKQRRQPAKKIKREDGSV	mito(22),mito_nucl(13.833),cyto_mito(11.833)	PATKAKPASSKQRRQPAKKIKR (104-125, prob:0.932)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q218	Uncharacterized protein	Low	8.1	1	52-74	IESKLPPPTQPKRKSARQASSSS	mito(11),nucl(9.5),cyto_nucl(7),cyto(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6M6	Glutamyl-tRNA(Gln) amidotransferase, subunit A	Low	7.7	1	296-316	VTKNCPGPKQYKKKVKLVAKS	cyto_nucl(13.5),cyto(13),nucl(10)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8X4	AAA domain-containing protein	Low	9.2	1	12-34	EQSANSSRQPRKIPSRREPSSAY	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDT7	NACHT domain protein	Low	8.4	1	1257-1277	LKVEYEARRKWNKNRRTLEAM	nucl(11.5),cyto_nucl(8.5),mito(5),cyto(4.5),plas(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGH2	Multicopper oxidase, putative	Low	5.4	1	1-21	MQRRPSKRQQHAPKSPDPTIQ	plas(10),golg(5),mito(4),extr(4),nucl(1),cyto(1),cyto_nucl(1),E.R.(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHR3	Paramyosin, putative	Low	8.7	1	12-31	PASSKQSPARDPRRASRQET	nucl(13),cyto_nucl(9.5),mito(9),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLE9	Uncharacterized protein	Low	8.9	1	6-31	NSSLGIIRRHKTRRPRLHSRWGDVTI	nucl(13.5),mito(12),cyto_nucl(9)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQQ4	Zn(2)-C6 fungal-type domain-containing protein	Low	8.4	1	4-42	VPTSRGCDACRKQKKKCDAPKPPTKCPRCTRLKIPCTGY	nucl(12.5),cyto_nucl(9.5),cyto(5.5),mito(3),plas(2),pero(1),E.R.(1),golg(1),cysk(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSE0	Uncharacterized protein	Low	6.2	1	552-581	VLVVFRRFQTKRPRNRDKHRASEKSCLVRN	mito(13),nucl(3),cyto(3),cyto_nucl(3),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUE4	Non-specific serine/threonine protein kinase	Low	8.3	1	662-689	ELNLQEPKKKKRQRGQRGGKAHKRKAKP	plas(8),extr(7),E.R.(5),golg(2),vacu(2),cyto_mito(1),cyto_nucl(1),cyto(1),mito(1),nucl(1),mito_nucl(1)	PKKKKRQRGQRGGKAHKRKAKP (668-689, prob:0.995)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAV6	Uncharacterized protein	Low	9.8	1	502-521	TTNRGRSVHFRPPRRSNDGT	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAW3	cAMP-specific phosphodiesterase, putative	Low	9.9	1	367-391	QQEGQRRRGRSSKRKRKDSDTADYA	cyto(11.5),cyto_nucl(9.5),nucl(6.5),plas(2),E.R.(2),vacu(2)	RRRGRSSKRKRK (372-383, prob:0.939)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QES7	WSC domain protein, putative	Low	5	1	197-217	VFFLRRRQKQRVEAEYRRNAE	extr(25)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QG63	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	Low	6.5	1	9-29	AVRCSCKRPVVWRQVATRKFS	mito(20),nucl(4),cyto(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGF5	Conserved serine-threonine rich protein	Low	8.6	2	48-70, 84-103	WGRGWKYAWYHNRHNRVDRKEVL, IKRMVSRRPGQQRFWKNWND	mito(17),mito_nucl(12.833),cyto_mito(9.833),nucl(7.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHL7	Zn(2)-C6 fungal-type domain-containing protein	Low	8.9	1	57-93	GTAAYPRKRANRACQVCRARRTKCDNKKPSCSFCEKV	nucl(13.5),cyto_nucl(9.5),cyto(4.5),mito(4),plas(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQJ2	Histone deacetylase SIR2, putative	Low	8.5	1	333-353	QALKRKRSSNGLQNSRKKRSF	cyto_nucl(14.5),nucl(14),cyto(11)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QV60	HTH CENPB-type domain-containing protein	Low	8.7	1	122-143	SRNPDLKCKFARRLSRKRALCE	nucl(14.5),cyto_nucl(9.833),mito(8.5),cyto_mito(6.833)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	H9CNU4	Intron-encoded GIY-YIG endonuclease	Low	6.9	1	38-59	FFKNVKQDKKNIYRELRKKSGV	mito(17),nucl(6),cyto_nucl(5.5),cyto(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2L3	DUF803 domain protein	Low	5.4	1	42-67	DEKAPYEIRRPPYKRRRWQLGMLMFV	plas(23),nucl(1),mito(1),E.R.(1),vacu(1),mito_nucl(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9V6	Longevity assurance factor, putative	Low	8	1	31-60	EPANEKSNIKKTKHKHRPVWRRLARFSIKH	plas(18),mito(5),pero(2)	IKKTKHKHRPVWRRLAR (39-55, prob:0.882)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QC92	General transcription and DNA repair factor IIH helicase subunit XPD	Low	8.1	1	678-698	LADKRFARKRSQLPKWISQNI	cyto_nucl(12),nucl(11.5),cyto(11.5),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJP3	Mitochondrial import inner membrane translocase TIM40	Low	5	1	46-68	FVPNPPSQKRRSWRNRLVRLGLA	mito(22),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QRZ0	Nitrogen permease regulator 3	Low	9.9	1	190-221	VFVRDDGHWRKKSRRRKRKKTKSGGEGKQHGS	mito(11),nucl(5),cyto(4),extr(4),plas(1),pero(1),E.R.(1)	WRKKSRRRKRKKTKSGGEGK (198-217, prob:0.998)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QWH8	Monooxygenase, putative	Low	5.8	1	96-120	APSSLPLKYRSKRVRRSRLQAALVS	cyto(11.5),cyto_nucl(7.5),extr(6),nucl(2.5),plas(2),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1B2	54S ribosomal protein L31, mitochondrial	Low	7	2	12-40, 79-100	LLWKIPWRLSSRQKFRQRKRLRSVDNVVD, YDRKEKTYRKGIHKLPKWTRVS	mito(25.5),cyto_mito(13.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8V1	Palmitoyltransferase	Low	5	1	461-490	IHCMVRKPVRSKHCRRCSRCVAKHDHHCPW	plas(23),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFM7	Mitochondrial large ribosomal subunit protein L1, putative	Low	8.6	1	42-72	RTAMSNSKGKKNKKEPTKKKAKGSRDYQQKD	mito(22.5),cyto_mito(12.833),cyto_nucl(2.833),nucl(2.5)	KGKKNKKEPTKKKAKGS (49-65, prob:0.978)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIK9	FAD binding domain protein	Low	9.2	1	20-41	ILVLRRKKAAKEQQPPAPPKPH	mito(15),cyto(5.5),cyto_nucl(5),nucl(3.5)	KKA (26-28, prob:0.623)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QK13	Isopenicillin N synthetase, putative	Low	9	1	331-352	GEYYLWRTRKQKWSWKVGENGD	nucl(10),cyto(8),mito(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNG1	Cell morphogenesis protein (PAG1), putative	Low	5.7	1	215-238	SSSSVHKKMPSNSKLRREHSHSRT	plas(19),mito(3),nucl(2),cyto(2),cyto_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3N0	WD-repeat protein, putative	Low	8.7	1	1125-1147	DVKTFKKRLVLRENKLSRRRSKA	nucl(10),cysk(10),cyto(4),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5C5	Uncharacterized protein	Low	9.3	1	19-41	SASSRLSHSSRRHRHGQSHHGGF	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QA38	DNA-directed RNA polymerase subunit beta	Low	7.6	1	74-97	IETPEQRKLRKARGQPPPQRNSLN	cyto(13),nucl(7),cyto_mito(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEJ2	Fungal specific transcription factor, putative	Low	9.8	2	3-27, 42-64	RTTIACARCRRYKVKCMHSGSPPCR, LSLPTLSSKKRHRPVRGVPTDTP	mito(16),nucl(7),cyto(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEV2	Ankyrin repeat-containing protein, putative	Low	7.5	1	92-118	DKGTLGKKTRRVWKRLQWDQSKINDFR	cyto(9.5),cyto_nucl(9.5),nucl(8.5),pero(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QF59	Glycogen [starch] synthase	Low	8.2	1	564-587	MFEFTSKSRRQRINQRNRTERLSD	cyto(9),nucl(8),mito(6),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJ88	Helicase C-terminal domain-containing protein	Low	9.4	1	528-551	RQLIRHFQWRFRRRSEKRSGLIKS	mito(12),nucl(11),cyto(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKY2	Mitochondrial dihydroxy acid dehydratase, putative	Low	5	1	558-578	EELERRLKSWQPPKPQVTRGV	cyto(15.5),cyto_nucl(10.5),pero(4),cysk(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPK9	C6 transcription factor, putative	Low	9.9	1	7-33	KRPRAGSCATCRARKRRCIPSFKWDGC	nucl(16.5),cyto_nucl(9.5),mito(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QS35	Uncharacterized protein	Low	9.2	1	73-99	HDNCITRRGWFKRRREQKNKGKSQYLS	plas(9),E.R.(6),mito(4),nucl(3),cyto_mito(3)	FKRRREQKNK (83-92, prob:0.748)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSE1	C6 finger domain protein, putative	Low	8.5	1	23-53	KSRRTLSCLSCQKRKVKCDRVKPCRACCIRG	nucl(13),cyto_nucl(11),cyto(7),pero(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTT1	MFS transporter, putative	Low	8	1	297-320	VASIRAARRKKRQNKLKNIDKVLG	plas(21),E.R.(2),vacu(2)	AARRKKRQNKL (302-312, prob:0.846)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUW0	Arrestin_N domain-containing protein	Low	9.9	1	43-63	GESRTRLLTPRNDRDKKKAEI	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q556	C2H2 finger domain protein, putative	Low	9.6	1	418-439	LAIERRERTRAQREERKFNAKV	nucl(17),cyto_nucl(11),mito(6),cyto(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q571	Cytomegalovirus gH-receptor family protein, putative	Low	8.3	1	474-496	RQSNTRRRKTSAQPKHRRQKSTP	plas(22),cyto(2),nucl(1),E.R.(1),vacu(1),cyto_mito(1),cyto_pero(1)	KPRQSNTRRRKTSAQPKHRRQK (472-493, prob:0.852)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8M6	Cell division control protein	Low	8.2	1	18-40	DSLPLRSGSKRRARLPRIHEEDS	nucl(12.5),cyto_nucl(11.5),cyto(7.5),mito(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAT4	Hsp70 family chaperone Lhs1/Orp150, putative	Low	9.3	1	947-982	GDSSSKKSEGKKKDSSKTKPKSKTEKTSTKAKPSAK	mito(13),cyto_mito(9.833),mito_nucl(9.833),nucl(5.5),cyto(5.5)	SKKSEGKKKDSSKTKPKSKTEKTSTKAKPS (951-980, prob:0.972)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHT7	Arginine transporter, putative	Low	5	1	49-68	SLPLPDLKRKLKSRHLQMIA	plas(27)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QL66	Uncharacterized protein	Low	6.9	1	565-589	RNTIMFVKHNNKKWLRKNQISDAKL	plas(10),nucl(5),E.R.(4),mito_nucl(4),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QL72	Mitochondrial intermediate peptidase	Low	7.4	1	16-39	DNARNSKTRKRLFLAFKNKCKGNV	cyto(9.5),nucl(8),cyto_pero(7.5),pero(4.5),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNJ8	Exocyst complex component EXO84	Low	7.9	1	4-30	QLDKLSSLTLRNKSRRRPQISAPQPIT	mito(11),nucl(9.5),cyto_nucl(7.5),cyto(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QU79	ATP-dependent 6-phosphofructokinase	Low	5	1	11-30	SSPSAIKPPVKPSQKRRIAV	mito(22),cyto(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q550	Polysaccharide deacetylase family protein	Low	5.7	1	281-300	QMCDEFKKKNQPPPGAKLPV	cyto(10),cysk(10),cyto_nucl(6.833),cyto_pero(6.333),nucl(2.5),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5U3	Dynactin Arp1 p62 subunit RO2, putative	Low	7	2	10-52, 285-308	ISCPCAQQTRSSKLPKRNSHELSPKKQSSPRKPTPKLQPTEDS, PLPVLLRTKRSKRCKSCKHILVKP	mito(25)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHS7	Uncharacterized protein	Low	8	1	152-178	NINPSKARHQHNSRKRRSRTPLEREED	extr(9),plas(6),cyto(5),mito(3),cyto_pero(3)	HQHNSRKRRS (160-169, prob:0.718)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIH0	Uncharacterized protein	Low	9.5	1	105-129	MATAIQHQRKMRRRRGSLRKTALLG	plas(17),cyto(6),nucl(4)	RKMRRRRGSLRK (113-124, prob:0.837)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKE1	Integrase catalytic domain-containing protein	Low	9.9	1	1416-1445	GGPIDWSAKKQKQCQRRPLRPNYLLYPRQR	nucl(18.5),cyto_nucl(12),cyto(4.5),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLM0	C6 transcription factor, putative	Low	9.4	1	2-41	EPSAQQSGPIKHKRNRTAQSCVQCRQRKVRCDRGYPCAPC	nucl(12),plas(5),cyto(4),mito(3),pero(1),E.R.(1),golg(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QRA7	Rhomboid family protein, putative	Low	8	1	537-565	FVWALLYKSKREKERQRKRNERGFLDRIG	mito(13),plas(7),mito_nucl(7)	SKREKERQRKRN (545-556, prob:0.802)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QU91	Integrase catalytic domain-containing protein	Low	5	1	156-175	NSWTSRKERKADANRWHARL	cyto(9),pero(9),cyto_pero(9)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1Y8	Dolichyldiphosphatase	Low	5	1	212-234	GWQRWEAQRKLKRREHSDMHKSD	plas(20),E.R.(3),mito(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2Y7	C6 transcription factor, putative	Low	9.6	1	4-36	QDPPSKRQRINQACDQCRKRKSKCDGAQPSCST	nucl(16.5),plas(10),cyto_nucl(9)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q368	Zinc knuckle domain protein	Low	7.9	1	617-645	DSPYFRQPVNPQRHQARQRRVRPSDYREL	nucl(12.5),cyto_nucl(11.833),cyto(8),cyto_mito(6.999),mito(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QB30	Hsp70 family protein	Low	5	1	2-24	TSRLKNFTFSSKRKNSNNSTISQ	mito(23.5),cyto_mito(13)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFE1	Uncharacterized protein	Low	5	1	3-23	ADVSRPRRYNNHLRGRQIRLP	plas(11),mito(10),E.R.(3),cyto(1),extr(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QG55	Sad1/UNC domain protein	Low	5	1	782-805	PPSVIPPMKKTHRRQCSNALGHKS	mito(5),cyto(5),plas(5),E.R.(5),cyto_mito(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKS2	Signal recognition particle subunit SRP68	Low	9.3	1	22-50	TYRAQTSRRLHTIRKKLGHTTPKGRKFNA	nucl(16),cyto_nucl(12.5),cyto(7),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QM63	Pogo transposable element, putative	Low	9.2	1	570-594	LATPSAPKRAKKQVSKQVKVKAQPE	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPW1	YagE family protein	Low	8.6	1	51-73	IPSMQQRRPMQQRPQMRPRSRLS	cyto(10),nucl(9),plas(3),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QT61	Fungal_trans domain-containing protein	Low	9.2	1	3-30	DCTYTAPCRKSTPRKRRSSTKSDDDTSN	nucl(11),plas(6),mito(5),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2X5	Palmitoyltransferase	Low	9.1	1	125-148	HGGARFCKKCQCQKPDRAHHCSSC	plas(12),mito(6),nucl(3),cyto(2),extr(2),E.R.(2)	RKPKRGRV (517-524, prob:0.738)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4E7	Chromatin remodeling complex subunit (Rsc9), putative	Low	9.2	1	765-788	ILERKILQQRQVRRRTFRNTPVNA	nucl(16.5),cyto_nucl(10.833),cyto_mito(4.333),cyto(4),mito(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q803	Uncharacterized protein	Low	5	1	1-20	MAAVIKRIFRRKNKAPLACS	mito(18),cyto(6),extr(3),cyto_nucl(3),cyto_pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q932	O-acyltransferase	Low	5	1	41-60	SSTPSEKKRASKYRHVAAYH	plas(25)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q983	Chloride channel protein	Low	5	1	71-94	TTGGTLRRSRHHSRRPSARFVPGQ	plas(27)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q990	DNA helicase recq, putative (Fragment)	Low	9.1	1	116-144	EHGWKNPQNRGRPRSKAPSKPQPNMPWNI	plas(8),cyto(6),mito(5),nucl(3),pero(2),extr(1),E.R.(1),cysk(1)	RPRSK (127-131, prob:0.635)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QK56	Retrotrans_gag domain-containing protein	Low	9.7	1	557-576	NPGCLPEPARRKCPSRKRLL	nucl(18),cyto_nucl(13.5),cyto(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMC2	Uncharacterized protein	Low	8	1	245-277	PPELKAPPLSFKKKDKKKKRKHSSQDSGENILK	plas(16),mito(5),E.R.(4)	SFKKKDKKKKRKH (254-266, prob:0.988)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVT0	Integrase catalytic domain-containing protein	Low	8	1	436-456	TDRRYNTRQPSRSPHRNRSSY	nucl(10.5),cyto_nucl(9.5),cyto(7.5),pero(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q282	DUF803 domain membrane protein	Low	5.7	1	596-615	LTSRRRSTPRTPQSNTRNSV	plas(12),cyto(3),extr(3),E.R.(3),nucl(2),mito(2),vacu(2),mito_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2R9	Ubiquitin carboxyl-terminal hydrolase	Low	9.6	2	67-91, 807-828	VLALNIRRTRKKIQRDEPPQKISKL, HFNTSKMPPIRKKDPLKSAQIE	nucl(10.5),cyto_nucl(9.833),cyto(8),cyto_mito(6.333),pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6N2	PT repeat family protein	Low	5	1	40-60	HVTPSKKQKDSVKHAGKPVKS	cyto(14.5),cyto_nucl(8.5),vacu(4),mito(2),plas(2),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNP5	Mitochondrial thiamine pyrophosphate carrier 1	Low	5	1	306-325	AFLRKLKQEKLKKYAEKAAA	extr(9),mito(7),cyto(7),cyto_mito(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUD3	Uncharacterized protein	Low	5	1	40-65	LDVVKGHSRRRQRHHRHRQDHQGPTT	mito(12),cyto(3),plas(3),extr(3),pero(3),cyto_pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUU1	Integral membrane protein	Low	7	2	1-22, 973-997	MDVDANRRHHRRNSGSPRCFDG, STLSNRPSLPRKSSKRHGPQDSVDE	plas(24),cyto(1),extr(1),E.R.(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QWM6	NACHT domain-containing protein	Low	7.7	1	215-241	DTCEKCDKERLVKRKPRETRTPYIHYG	cyto(10.5),cyto_nucl(10.5),nucl(9.5),plas(3),extr(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5B9	Sensor histidine kinase/response regulator, putative	Low	9.5	2	71-90, 2279-2303	TRDSPRTDSRPPFRHHWRSS, QYLAPAKPSKLRRRPITRQSCEGLR	cyto_nucl(9),nucl(8.5),cyto(8.5),mito(3),plas(3),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QB54	N-alkane-inducible cytochrome P450, putative	Low	5	1	16-40	GFLALRRRIRQARFIKKHGCKEAPS	extr(11),mito(8),E.R.(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIB7	C6 transcription factor, putative	Low	9.6	1	13-35	QDYPYTPRRKRVGQACAKRPNVP	nucl(12),mito(8),cyto(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJC7	DUF1275 domain protein	Low	5	1	211-232	MIDPKVWKIRNRPRNRRSFFLL	plas(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QW69	Integrase catalytic domain-containing protein	Low	9.2	1	433-465	AYYTNRRYHHKQSSSPHRGRSPHRNRQQYDDRS	nucl(14.5),cyto_nucl(10.5),cyto(5.5),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2Q7	NADH-ubiquinone oxidoreductase subunit B, putative	Low	5.7	1	206-225	IFQLQKKMRHTKITRMWYRR	mito(21),cyto(3),nucl(2),cyto_pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6D8	Ceramide synthase membrane component (LAG1), putative	Low	8	1	44-71	GAASTKSGKSHHKRRKSRSLLGRFKDVA	plas(21),mito(4)	SGKSHHKRRKSRS (50-62, prob:0.872)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6U5	Retrovirus polyprotein, putative	Low	6.6	1	145-164	GLMTLRRRQQRNPDNRIKIF	cyto(12.5),cyto_nucl(9.5),nucl(5.5),pero(4),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QD85	ABC multidrug transporter, putative	Low	5	1	76-100	QFNIPKKVTESRHRKPLRRILSDSH	plas(24),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGG9	Uncharacterized protein	Low	5	1	29-49	FETLKTFRSRKYRQHMESYYN	cyto(6.5),cyto_nucl(4.5),extr(4),golg(4),plas(3),pero(3),mito(2),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QM82	Uncharacterized protein	Low	5	1	49-68	TEYMLKRRTRWIRISRGTDE	extr(10),plas(9),mito(4),golg(2),cyto_mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQ99	Intermembrane space AAA protease IAP-1	Low	5.9	1	22-45	LMNSQWRRVNRVYRAPQIRRQHTE	cyto(11),mito(10),cyto_nucl(8),nucl(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVY0	C6 transcription factor (OTam), putative	Low	6.5	1	26-47	STLSAFHTRHQHHQHQHPRMSS	mito(11),cyto(5.5),cyto_nucl(5.5),nucl(4.5),plas(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4B7	Uncharacterized protein	Low	8.4	1	4-25	RDYFKGVRKKDQGQTRLNKGDT	nucl(10.5),cyto_nucl(7),mito(5),plas(3),pero(3),cyto(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAE9	Mitochondrial DNA polymerase catalytic subunit	Low	9.4	1	279-303	MCSQQRPTWMRHKKNRDLRDKVAND	mito(19.5),cyto_mito(11.5),nucl(5)	VKGKKKGDPPRPAARQKKPGMP (477-498, prob:0.965)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAH1	G-patch domain protein, putative	Low	8.4	1	233-255	ALAARKGLRKQQQEQRQKLNAKQ	nucl(15),cyto_nucl(12.333),cyto(8.5),mito_nucl(8.333)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVS0	Uncharacterized protein	Low	8.8	1	91-110	KLSQTRPTGHRPRKPQGTKA	mito(16),nucl(10)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2T5	Dihydroxy acid dehydratase, putative	Low	6.7	1	51-71	GPSKEKSSSPRELRSRKWFGP	cysk(9),cyto(7.5),cyto_nucl(7),nucl(5.5),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3C0	Vacuolar transporter chaperone (Vtc4), putative	Low	6.9	1	739-765	ILYVWRVDKIRKRRDVKRIYYEKWGPT	plas(14),nucl(5.5),cyto_nucl(4.5),cyto(2.5),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q416	Flavoprotein domain-containing protein	Low	8.2	1	47-68	KTSTIPKPPLERTQRRKRVLLS	cyto(12.5),cyto_nucl(12.5),nucl(11.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q742	Uncharacterized protein	Low	7.5	1	385-405	LNENKVARIRRLRKDGFRTVG	cysk(14),nucl(7),cyto(3),mito(2),cyto_pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7S6	N-alkane-inducible cytochrome P450, putative	Low	5	1	1-22	MPYTTKRCCFWKPRSPCVNATN	mito(21),cyto(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7W8	Zn(2)-C6 fungal-type domain-containing protein	Low	7.8	1	5-34	TSPAGTRPYRSKLKRPCDRCRSRKIACILP	nucl(7),plas(7),cyto(5),mito(4),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAR7	Fe-S cluster assembly protein dre2	Low	9.1	1	201-224	QPAECKPDIAKKRRRACKDCTCGL	nucl(15.5),cyto_nucl(13),cyto(9.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAV7	Senescence domain-containing protein	Low	7.9	1	482-506	RSSSRNRLPGPPRRHARTPSPPPAY	cyto_nucl(11),nucl(10.5),mito(8),cyto(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QE85	DUF221 domain protein, putative	Low	7	2	58-80, 331-350	LLRPKWKELYAARRKRRNAASFL, EDGRVPVRTKDKKRPTTRLW	plas(23),mito(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGI0	Pyridoxal phosphate homeostasis protein	Low	6.9	1	41-61	PTTSTSTTRRHRPANKPVRLV	cyto(10),cyto_nucl(9.833),cyto_mito(9.333),nucl(8.5),mito(7.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QH12	Uncharacterized protein	Low	9.5	1	154-173	SHQQRSHSTPKPKQNRQSTS	nucl(17.5),cyto_nucl(13),cyto(5.5),extr(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQQ5	Mitochondrial import inner membrane translocase subunit TIM54	Low	9.6	2	14-36, 62-83	ASASTTKPPTPPKPQNPVFKMMG, AITYDRRQKKRAQQKWADLVAH	mito(10),nucl(9.5),cyto_nucl(9),cyto(7.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QS63	F-box domain protein	Low	9.5	1	193-212	IRVWRDWLKRKAKKDQHDAT	nucl(18),cyto_nucl(14),cyto(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSB8	Glycosyl transferase, putative	Low	5	1	310-335	LTVYYCTCLRRRRYAAKRNKIIADKF	plas(17),extr(3),E.R.(3),mito(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QT58	Tyrosine--tRNA ligase	Low	9.1	1	338-368	EINLKAYPPPPKKEKKVKNKGTRYPGADKQT	cyto(16),cyto_nucl(11),nucl(4),plas(4)	PPPKKEKKVKNKGT (346-359, prob:0.89)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTU7	Uncharacterized protein	Low	9.8	1	350-374	NNTFSRLQLRPRRGRKPNFKFTTKN	cyto(13),cyto_nucl(11.333),cyto_mito(9.333),nucl(8.5),mito(4.5)	RRGRK (361-365, prob:0.651)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q229	pH signal transduction protein PalA, putative	Low	9.4	1	568-589	VSRLENRRKRRVQVLKEKARAD	nucl(11),mito(8),cyto(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q348	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial	Low	8	1	56-79	QLKEEAKRAKSQSRNGRGKKQVAA	mito(25)	KEEAKRAKSQSRNGRGKK (58-75, prob:0.801)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q475	Uncharacterized protein	Low	9.8	1	43-66	DYALFLCRGRKNRRRISNSDDGRD	nucl(13),cyto(6),mito(4),plas(1),pero(1),golg(1),cysk(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5C8	Chitinase	Low	5	1	1069-1088	GNVPCRKIYRKELNYPQKAA	extr(24),plas(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6M8	Integral membrane protein 25D9-6	Low	7.7	1	210-233	YVNTHTKKKRLEALRRQYDQRRGG	cyto(10),nucl(7),mito(6),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QK60	C6 transcription factor, putative	Low	9.9	1	5-32	GKPSTGCYLCRRRKIKCDEARPGCRNCE	nucl(19),cyto_nucl(11.5),mito(4),cyto(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLP1	ABC transporter (Adp1), putative	Low	5	1	676-699	ENSSRPSTKRQQSLKQRQDKQLFT	plas(12),extr(10),E.R.(2),mito(1),pero(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPG0	Zn(2)-C6 fungal-type domain-containing protein	Low	8.4	1	28-64	GSERKRPRTLQACLPCRRRKVKCNGAKPRCHNCARFD	plas(12),nucl(10.5),cyto_nucl(6.5),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPH4	Dihydroorotase	Low	5	1	324-343	PAANSTKKIRLEKKGEKIPD	cyto(23),cyto_nucl(13.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QWP1	DNA helicase recq, putative (Fragment)	Low	9.1	1	116-144	EHGWKNPQNRGRPRSKAPSKPQPNMPWNI	plas(8),cyto(6),mito(5),nucl(3),pero(2),extr(1),E.R.(1),cysk(1)	RPRSK (127-131, prob:0.635)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7F5	Zn(2)-C6 fungal-type domain-containing protein	Low	7.9	1	41-62	CTYLDIPQTKRKYRNSPSRVEV	mito(10),nucl(8),plas(5),cyto_nucl(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q808	Protein SDS23	Low	7.8	1	524-550	LNPNDPTETRNRRRRSSSSSLNMRRSG	cyto_nucl(10),nucl(9.5),cyto(9.5),plas(3),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QB57	Uncharacterized protein	Low	7.5	1	57-76	SFDVKRYEKHHHQKCLHSIT	cyto_nucl(10.833),nucl(10.5),cyto(10),cyto_mito(6.333),extr(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QED5	RNA binding protein	Low	9.6	1	404-425	LFSKQRGYKRLCFRNKQNGPMC	nucl(18.5),cyto_nucl(13),cyto(4.5),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGJ8	Oxidoreductase-like domain-containing protein	Low	8.6	1	203-224	IREFMKIEKKLREKKNSNNLQP	mito(10),nucl(9),cyto(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLT2	BTB domain-containing protein	Low	5	1	109-130	GFVSPINKKKHKNKLANRSSFY	mito(12),cyto(9),mito_nucl(9)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QP76	Serine/threonine-protein kinase TOR	Low	8.2	1	1990-2011	ILHVLQTKKRPRRMTLKGSDGN	nucl(11),cyto_nucl(10.5),cyto(8),pero(3),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QV54	MBOAT family protein, putative	Low	8	1	208-234	GTDPSKVPPTRKKRKIPRSGRPALKKM	plas(19),E.R.(4),vacu(2)	PPTRKKRKIPRSGRPALKK (215-233, prob:0.976)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QWM1	Mitochondrial chaperone bcs1, putative	Low	5	1	421-445	QEEEEKKEKKEKEPQQPQCQICPKL	cyto(7.5),cyto_nucl(5),E.R.(5),golg(4),mito(3),pero(3),extr(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q221	SUMO conjugating enzyme (UbcI), putative	Low	7.8	1	4-23	CLNRLTEERKQWRKDHPFGF	cyto_nucl(11),nucl(10.5),cyto(10.5),mito(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3P6	60S ribosomal protein L10	Low	7.4	1	1-31	MARRPARCYRYCKNKPYPKSRFNRGVPDPKI	mito(14),nucl(6),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9J0	Retrovirus polyprotein, putative	Low	6.4	1	31-52	RFCVDFRKLNKLTKKDRYPLPL	cyto(14),cyto_nucl(10.5),nucl(5),pero(4),cysk(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QA10	Nucleotide-sugar transporter, putative	Low	8	1	87-119	EETGLTAKQRNERRRRRKRQRRRLDAKIAGVRG	plas(16),mito(6),E.R.(4)	QRNERRRRRKRQRRRLDAKIA (95-115, prob:0.996)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFJ8	Signal peptidase subunit 3	Low	5	1	137-165	SKSSTSKLSKKTNNKKKQQQTKPEKTGVL	extr(21),plas(2),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QG37	Sister chromatid cohesion protein Dcc1, putative	Low	6.1	1	382-401	SGIKVKNSRNWHERFKGQRK	mito(17.5),cyto_mito(11.5),cyto(4.5),nucl(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHH3	Pyruvate carboxylase	Low	9.2	1	971-995	FPEPLRSRALRNRRKLDKRPGLYLE	cyto(15),pero(4),nucl(3),cysk(3)	RNRRK (981-985, prob:0.656)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHL5	Ribosomal protein	Low	8	1	85-116	KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK	mito(19),nucl(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QID1	Mitochondrial escape protein 2	Low	7	1	3-23	LPAIIRPQCHRHQRYGDFFRS	mito(10.5),cyto_mito(8.333),nucl(7.5),cyto_nucl(6.833),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QS31	RNase L inhibitor of the ABC superfamily, putative	Low	9.3	2	7-37, 567-592	RIAIVNSDKCKPKKCRQECKKSCPVVRTGKL, VTFRRDPNSYRPRINKHQSQLDQEQK	nucl(9),cyto_nucl(8.833),cyto_mito(7.666),mito(7.5),cyto(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUA3	Uncharacterized protein	Low	9.9	1	8-37	SLLSSSEKKRLRDRKAQQTLREKRQNRMLE	nucl(18.5),mito_nucl(13),mito(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2U8	Mitochondrial thiamine pyrophosphate carrier 1	Low	9.2	1	286-310	IPNSDAPSKSKKRQGKRRLQLTASA	mito(12),cyto(7),cyto_nucl(6.5),nucl(4),plas(3)	KSKKRQGKRR (294-303, prob:0.775)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5K1	AP-3 adaptor complex subunit beta, putative	Low	7.6	1	247-270	TIYARKCFPRKMQKVKKNEVKGFY	cyto_nucl(12.833),nucl(12),cyto(9.5),cyto_mito(7.832),mito(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9P9	Pseudouridine synthase	Low	9.4	1	62-90	GEITRRKNDVNFRNRRKKRPEVKIGHGGT	mito(17.5),cyto_mito(11),nucl(5),cyto(3.5)	RNRRKKRPE (74-82, prob:0.839)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDG0	Multidrug resistance-associated protein, putative	Low	5	1	55-74	MPYRIFTLRSKRPKVARGGF	plas(23),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJZ5	Chromate ion transporter, putative	Low	8	1	223-242	SIGKLKAKIKRRKSNTESQV	plas(21),E.R.(3),mito(2)	LKAKIKRRK (227-235, prob:0.757)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKQ6	GARP complex subunit (Sac2), putative	Low	8.8	1	15-44	GTPPTFTNRHPSPNRRPSRTPSQSYRPSLH	nucl(14),cyto_nucl(10.5),mito(7),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QL39	Uncharacterized protein	Low	9	1	219-241	LKSLYTYRCRHHRRRPYLGSSLA	nucl(14.5),cyto_nucl(10.5),cyto(5.5),mito(2),plas(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMJ7	UPD-GlcNAc transporter (Mnn2-2), putative	Low	5	1	9-34	QSNRNDATVRQRQRHRNGIPNNSRSS	plas(24),mito(1),cyto(1),E.R.(1),cyto_mito(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2U3	Curved DNA-binding protein (42 kDa protein)	Low	9.8	1	379-409	QPLAKSTGSKGKKNKKKKPAKKVAGEEEGKE	cyto(17.5),cyto_nucl(14.333),nucl(8),mito_nucl(4.999)	GSKGKKNKKKKPAKKV (386-401, prob:0.995)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4X4	MFS transporter, putative	Low	5	1	466-486	WSDNIRRNRRAGRKIDARDVP	plas(23),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q573	WD repeat protein	Low	8.5	1	826-847	SSSTTSSKKKAQRKQSASNATV	nucl(14),cyto_nucl(13),cyto(8),pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q709	Transmembrane glycoprotein, putative	Low	8	1	625-645	LKRDSLKSSKSKRYSRRSSGL	extr(15),plas(9),E.R.(2)	RRGSRRYSKREPLKPIQARSLKRDSLKSSKSKRYSRR (605-641, prob:0.907)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8G6	Cytochrome b5 reductase, putative	Low	5	1	75-97	HVGTLKKDGNRKQKRSDTARLIQ	cyto(14),cyto_nucl(8.333),cysk(8),cyto_pero(7.833),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9V9	5'-nucleotidase, putative	Low	5	1	573-603	ERHIQHTHTKSKPRPHVRRYGRYYEPRRHHT	cysk(13),cyto(10),cyto_nucl(7.333),cyto_pero(5.833)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QB58	Uncharacterized protein	Low	7.1	1	54-76	VDPFVTKKFEKRHHKDCLHSVTT	cyto_nucl(12.333),cyto(11.5),nucl(9),cyto_pero(7.832),pero(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QCE1	Monooxygenase, putative	Low	6.6	1	344-364	LETYAQKRKIRTKPVLNGANM	cyto(11.5),cyto_nucl(10),pero(6),nucl(5.5),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFV8	tRNA-splicing endonuclease subunit Sen2	Low	8.1	1	7-35	AQPQGGGKNKHPRPQKPNYRHIHRFPLPV	mito(12),nucl(11),cyto_nucl(8.5),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QH36	F-box domain-containing protein	Low	6.9	1	37-63	NITKNELPLRRKYRRIRIKENTDFDKA	cyto(8.5),cyto_nucl(8),nucl(6.5),E.R.(5),golg(3),mito(1),extr(1),pero(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QII6	RING finger ubiquitin ligase (Tul1), putative	Low	8	1	729-755	SSRAQLDRGSRPKDKKKKIFDCAICMQ	plas(25)	SRPKDKKKK (738-746, prob:0.755)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMG5	DDE_Tnp_1_7 domain-containing protein	Low	8.5	1	398-419	DDYIERTRRRPQKTSTNGPLVH	nucl(13),cyto_nucl(12),cyto(9),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QRT8	ANK_REP_REGION domain-containing protein	Low	6.2	1	617-636	EIARRGDKTCTKPRDHRELI	cysk(10),mito(6),cyto(5),nucl(3),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QST9	Zn(2)-C6 fungal-type domain-containing protein	Low	8	1	40-67	GEPPTKLRRTNKACIQCRVRKQRCGGLS	nucl(10.5),cyto_nucl(10),cyto(8.5),mito(4),plas(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTQ8	Fasciclin domain family protein	Low	8	1	118-141	EGEMKKDKKKYDGKGKKHHKDLHS	extr(13),cyto(4),E.R.(3),cyto_pero(3),pero(2),golg(2),vacu(2),cyto_mito(2)	KKDKKKYDGKGKKHH (122-136, prob:0.862)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTT4	Uncharacterized protein	Low	7.6	1	14-35	SATGHHPWKRPQDLKKLQFRLA	nucl(8.5),pero(8),cyto_nucl(7.5),cyto(5.5),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUB6	RNA exonuclease Rex3, putative	Low	6.2	1	50-69	EPAEKKRKLVHEHDGQPRKT	cyto(16),cyto_nucl(11.666),cyto_mito(10.166),nucl(6),mito_nucl(5.166)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QW48	Zn(2)-C6 fungal-type domain-containing protein	Low	9.5	1	4-43	QLAKRSRTGCLTCRKRKIKCDETRIKCKQCIKHRFSCEWP	nucl(16.5),mito_nucl(12.5),mito(7.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9E6	Vacuolar membrane-associated protein IML1	Low	9.9	1	692-718	ENVFRPTPKRHHHTRKNTKPRRLLESK	mito(13.5),mito_nucl(11.333),nucl(8),cyto_nucl(6.333),cyto(3.5)	PKRHHHTRKNTKPRR (699-713, prob:0.779)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBM5	Uncharacterized protein	Low	7.6	2	534-556, 566-590	QPTSTKKRKTEDLQPPKPQNNTS, LKVQKRCIWCLYKNPKRQTGQSPSF	mito(10.5),cyto_mito(9),cyto(6.5),plas(3),pero(3),nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFS6	Uncharacterized protein	Low	8.3	1	118-139	EEQFFWAPRKKKTRQAQVAAEV	nucl(9),plas(8),cyto(5),mito_nucl(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHL3	AB hydrolase-1 domain-containing protein	Low	5	1	387-408	TSSAGNNKKQVKRVRWEKVGYG	plas(9),extr(8),mito(3),E.R.(3),cyto(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QI62	C6 transcription factor, putative	Low	8.6	1	17-48	IGFNSKKRSRTACTRCKDKKQRCDGNYPVCGN	nucl(11),mito(5.5),cyto_mito(5.5),cyto(4.5),plas(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJP2	Nonsense-mediated mRNA decay factor (Upf2), putative	Low	7.9	1	1094-1117	TEQPEEKRPSRDNRMDKSNRPGFR	nucl(13),cyto_nucl(12.833),cyto(11.5),mito_nucl(7.833)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QM75	Dolichyl-diphosphooligosaccharide--protein glycotransferase	Low	8	1	715-741	QSAVAFEKGHKKKKSMKRKGAPVLRVE	plas(20),E.R.(3),mito(2),vacu(2)	KGHKKKKSMKRKGAP (722-736, prob:0.97)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMX5	Sucrose transport protein, putative	Low	5	1	27-46	RSDNCRSRWGRRKPFIAIGG	plas(24),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSK2	Glutaredoxin domain-containing protein	Low	6.8	1	354-376	AETKKEVKKEEEKTQKQDPKNES	cyto_nucl(10.333),cyto_mito(9.332),mito(8.5),cyto(8.5),nucl(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1H0	Very-long-chain acyl-CoA synthetase family protein (CefD1), putative	Low	5	1	555-580	VFLRVSKGSKHTHNNKQNKVPLRQEG	cyto(8),extr(7),E.R.(4),pero(3),mito(2),plas(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1K5	Tethering factor for nuclear proteasome sts1	Low	9	1	60-80	AFTPRPLPNRQMKRSRPNVSG	nucl(14.5),cyto_nucl(10),mito(7),cyto(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5U5	Peptidase A1 domain-containing protein	Low	5.9	1	498-518	LACILCKRTRRPQRGGYSPPG	extr(13),plas(4),mito(3),cyto_nucl(3),nucl(2.5),cyto(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAY1	Ubiquitin-protein ligase Sel1/Ubx2, putative	Low	5	1	792-817	ILVYIRQQRNRQRDNGNRQQQQQQQQ	extr(10),plas(8),mito(3.5),golg(3),cyto_mito(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJ21	Nucleotid_trans domain-containing protein	Low	5.8	1	10-31	FMFPTPERRRRLPANCRWPLSI	plas(14),mito(5),nucl(2),cyto(2),cyto_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJ67	Carboxylic ester hydrolase	Low	5	1	521-544	DGSVEYTRKHCKFPKRNVYVGPGK	extr(25)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJ80	DUF202 domain-containing protein	Low	9.1	1	111-137	TSAANSQERRNRKKREKWIPGPVRRFW	plas(19),nucl(3),cyto(3),cyto_nucl(3)	RRNRKKREKWIPGP (119-132, prob:0.886)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJT1	Uncharacterized protein	Low	5	1	306-326	GTYGRYQFRVHYRQRVQRAMA	extr(19),plas(4),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKN2	F-box domain protein	Low	8.5	1	564-589	TDEKKEKESGWDRRWRRLDENQSWRS	nucl(14.5),cyto_nucl(11.333),cyto(7),cyto_mito(4.833),extr(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNQ9	Golgi complex component (Vps8), putative	Low	8.2	1	1457-1477	LWTAWERKKDNEDRRRSEREA	nucl(12),cyto_nucl(10),cyto(6),mito(5),plas(1),golg(1),cysk(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QV06	alpha-1,2-Mannosidase	Low	5.6	1	823-843	PESTRTKNKNHTKASRHQTHN	extr(17),nucl(2),mito(2),cyto(2),cyto_nucl(2),vacu(2),cyto_mito(2),mito_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1D0	CID domain-containing protein	Low	9.7	1	787-806	ETSPVGRVRKPRPKAEDMFA	nucl(18.5),cyto_nucl(13.5),cyto(7.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4U8	Small oligopeptide transporter, OPT family	Low	5	1	648-669	TWALWKYTKKDYWKKVNWPLFW	plas(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QA88	C6 transcription factor, putative	Low	5.7	1	940-964	VSTACEFCRKRKKKCDFQYPNCSAC	plas(13),extr(5),mito(3),nucl(2),cyto(2),cyto_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAJ2	C6 transcription factor, putative	Low	8.5	1	97-126	SAAGQPQQKRAYRQRRKDPSCDACRERKVK	nucl(9),mito(6),cyto(5),plas(4),extr(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAY5	WD repeat protein	Low	8	1	367-390	SDRAAAARARDKKKFKDEKRFRPY	mito(11.5),extr(11),cyto_mito(7.833),cyto(3),cyto_nucl(2.833)	ARARDKKKFKDEKRFR (373-388, prob:0.882)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QG10	ABC metal ion transporter, putative	Low	5	1	79-98	WLLLKRREPQHVPKNWHFYA	plas(20),E.R.(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHH0	Uncharacterized protein	Low	9.8	1	29-57	AAQRERKRLMNRASQSRRRNNLKNTLKTV	nucl(16.5),mito_nucl(10.5),cyto(4),mito(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLE3	26S proteasome regulatory subunit RPN2	Low	5.8	1	911-937	VLSTTNQAKRRAQRREKQQRRESMDVD	cysk(12),cyto(10.5),cyto_nucl(7),nucl(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLX6	Uncharacterized protein	Low	7.9	1	286-305	EKPRGFKQSKRKFTHKMLAQ	nucl(9.5),cyto_nucl(9),cyto(7.5),pero(4),plas(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QM58	Sulfonate biosynthesis enzyme, putative	Low	8.7	1	60-84	GFGFARSNPRPKKPRMKGVTEIRGP	mito(21.5),mito_nucl(12.833),nucl(3),cyto_nucl(2.833)	PRPKKPRM (68-75, prob:0.733)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNK3	NACHT domain-containing protein	Low	9.9	1	191-214	EECDKERLVKRKPRETRTPYIHYG	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVZ8	Glycerophosphocholine acyltransferase 1	Low	9.8	1	101-121	ALNIQRDRVRRQREKLKSVSG	nucl(12),cyto(5),mito(4),plas(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q269	MFS monosaccharide transporter, putative	Low	8	1	826-853	NDYLHRRRLTLRGRPSRRKNGDARNETG	plas(21),mito(2),E.R.(2)	LRGRPSRRK (836-844, prob:0.716)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5T7	Anion exchange family protein	Low	5	1	27-52	SSVHSHTSSTRKKSWQQRQQASSHIS	plas(21),E.R.(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAG2	Rad60-SLD_2 domain-containing protein	Low	8.1	1	159-179	RHPFKIDKKYLKRRSVKVEND	cyto_nucl(13.5),cyto(12.5),nucl(11.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAW8	Uncharacterized protein	Low	8	1	1-23	MGQRHNRRRTRPRSRNRAASLDS	mito(25)	RRRTRPRSR (7-15, prob:0.711)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHH9	Amino acid transporter, putative	Low	8	1	337-357	PDTPVMRRRKHKERAPKGTNT	plas(23),E.R.(3)	RRRKHKERAPK (343-353, prob:0.814)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHW9	LEM3/CDC50 family protein	Low	5	1	20-43	SDDGDKKKSRRPANTAFRQQRLRA	plas(24),cyto(1),pero(1),golg(1),cyto_pero(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJ13	Integrase catalytic domain-containing protein	Low	8.5	1	434-456	FTDRRYNTRQPSRSPHRNRSSYA	nucl(11.5),cyto_nucl(9),pero(7),cyto(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLK9	1-phosphatidylinositol-3-phosphate 5-kinase	Low	8.9	1	637-662	SANPSRHPMGHKRHHSRQQHLRGFKP	nucl(14.5),cyto_nucl(11),cyto(6.5),mito(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNF0	Amine oxidase	Low	5.7	1	80-100	IVNYDPKQRKHARPLEKFLTG	cyto(10.5),cyto_nucl(7),extr(4),mito(3),plas(3),nucl(2.5),pero(2),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNF1	Succinate-semialdehyde dehydrogenase	Low	5	1	55-74	FPEWRSRSGRERSRILRRWY	cyto(10.5),cysk(9),cyto_nucl(6.5),mito(3),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3D9	Uncharacterized protein	Low	6.2	1	120-143	IRFWSRIAKKERNHKDRNDRVPSI	cyto(18.5),cyto_nucl(12),nucl(4.5),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIW0	Uncharacterized protein	Low	6.5	1	198-220	ICEKCDRDKIVRRKPRANQEPVI	cysk(19),nucl(4),cyto(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJ89	Ab-hydrolase associated lipase, putative	Low	6.8	1	646-665	VDGRRLLRRIRNGREPHVKL	mito(9),plas(7),nucl(5.5),cyto_nucl(5),cyto(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKU9	Glutamate carboxypeptidase, putative	Low	5	1	22-41	TAPTRHRYPHHTLRRTCTAI	cyto(9.5),plas(6),cyto_nucl(5.5),mito(5),extr(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QM98	Serine/threonine-protein kinase ripk4, putative	Low	5	1	248-274	DDDCRFCNKSKVIKRRPRNMRLHYGLI	plas(19),E.R.(3),vacu(2),cyto(1),pero(1),golg(1),cyto_pero(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPH9	NTP binding protein, putative	Low	9.5	2	195-216, 867-887	ADSRSRHRWATPPKQKERFYQV, SSNEAKPTRKTRKSAVWRQSI	mito(12),nucl(8.5),cyto_nucl(7.5),cyto(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQS2	37S ribosomal protein Rsm22	Low	8.8	1	815-854	LQNQAKSLERRKKGHNIPTWKRHADKKKIRQAVRKLSSNT	mito(16.5),cyto_mito(11.833),cyto(6),cyto_nucl(5.333),nucl(3.5)	ERRKKGHNIPTWKRHADKKKIRQAVR (823-848, prob:0.934)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QV46	Leucyl-tRNA synthetase	Low	5	1	966-987	EGKTWLREKHDWEKRKRVIVVP	mito(23),cyto(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q326	PH domain protein	Low	9.6	1	828-851	IKMSGYLYRKPRRRSTFHRCQVIC	nucl(17.5),cyto_nucl(13),cyto(7.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q432	Uncharacterized protein	Low	8	1	232-259	AGGSNSPKKTQKSKQKKKPDFDLERGIE	plas(13),mito(5),extr(4),mito_nucl(4)	PKKTQKSKQKKK (238-249, prob:0.801)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4Z2	Uncharacterized protein	Low	5.4	1	104-132	NTSPRSPRRLWMRRWSRNRRSNSNVNITP	mito(20),cyto(4),nucl(1),plas(1),pero(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8L9	MACPF domain-containing protein	Low	5.7	1	82-106	FPSDEAKRKFEKQRAKNKNTLIQKL	extr(12),mito(5),cyto(4),nucl(2),pero(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8P2	Sodium/calcium exchanger protein	Low	5	1	8-29	PSSTSTKLCTRHKLYHPRPFFL	plas(21),E.R.(3),mito(1),cyto(1),vacu(1),cyto_mito(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8Q2	Phosphatidylinositol 4-kinase (STT4), putative	Low	9.1	2	240-263, 1576-1602	TDSTSRDWKRYNRRYAAQRRPLGA, SGKLRPYIKMSKPEKKQKIEEELRKIK	plas(13),nucl(6),mito(3),cyto(3),cyto_mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8Q5	Protein FYV4, mitochondrial	Low	8	1	234-255	GGERRRAEVRAKKRSAERRAAG	mito(26)	GGERRRAEVRAKKRSAERRAAGA (234-256, prob:0.965)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9Q7	Uncharacterized protein	Low	6.7	1	193-218	QDNTNPHHHHHHRHHHHHHNNSNNNE	cyto_nucl(11.833),cyto(11.5),cyto_mito(9.332),nucl(8),mito(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGT5	Prephenate dehydratase	Low	8.2	1	216-235	AGDTDRQKKKRKSLISFTIE	nucl(9),extr(5),cyto(4),mito(3),E.R.(3),vacu(2),cyto_pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIV7	Uncharacterized protein	Low	8	1	440-469	NEEQNLKKTKKAKKDKKDKKPLLICPNCYR	plas(19),E.R.(5),extr(2)	KKTKKAKKDKKDKK (446-459, prob:0.97)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJI2	Dimethylallyl tryptophan synthase GliD1	Low	9.2	1	433-456	GAEAFHPARKPRRSSRGTRRRGDD	cyto(16),mito(6),nucl(3)	ARKPRRSSRGTRRRG (440-454, prob:0.894)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMD5	Integrase catalytic domain-containing protein	Low	7.6	1	415-437	FTDRRYNTRQPSRSPHRNRSSYA	cyto_nucl(10),nucl(9),cyto(9),pero(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNC2	Uncharacterized protein	Low	5	1	83-102	QEWAQCRKMKRDCAKFTNGR	plas(10),mito(7),E.R.(7),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQT1	Uncharacterized protein	Low	8	1	215-235	AYLRKVKYAKAAEKKVKERKE	plas(14),cyto(5.5),E.R.(4),cyto_nucl(3.5),mito(1),pero(1),vacu(1)	KKV (228-230, prob:0.621)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QR20	MAP kinase kinase kinase	Low	8.8	1	128-152	QNDGRRSSSTKRNARRDPNAQYRAQ	nucl(14.5),cyto_nucl(11),cyto(6.5),mito(3),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QRY5	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	2-28	LQAAQACHSCRDRKKRCDRALQGCSDC	nucl(12),mito(8),cyto(3),plas(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTA2	IFRD domain protein	Low	9.1	1	350-370	TVSGKRISKKDKKSLHTNFAS	nucl(14.5),cyto_nucl(10.5),mito(7),cyto(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVC5	Phosphatidyl synthase	Low	5	1	97-116	QDKSKEQKSKPKSKLLSRIP	plas(12),mito(6),E.R.(6),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QB61	Poly(A) polymerase	Low	9.6	1	544-568	FEPGEARPTRPKKKVAKPITTAAPQ	cyto(12.5),cyto_nucl(9.5),pero(7),nucl(5.5)	TRPKKKVAK (552-560, prob:0.745)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDS5	Zn(2)-C6 fungal-type domain-containing protein	Low	8.7	1	2-38	ADRPVNRDTRRFHRKSRNGCMQCKQRHVKCDECKPSC	nucl(10),mito(8),plas(4),cyto(2),extr(1),pero(1),E.R.(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMZ6	Uncharacterized protein	Low	7.1	1	316-335	GTVNCRSENHPRREQKDHPR	cyto(16),cyto_nucl(14),nucl(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QT36	RNA processing protein Emg1, putative	Low	9.3	1	9-29	AEDGGKRKRPRTQSCPPPELP	nucl(17),cyto_nucl(14.5),cyto(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3P1	Tr-type G domain-containing protein	Low	6.1	1	843-867	DDERDKQKQGNRIRRVRPESEKTID	cyto(20),cyto_nucl(13.333),cyto_mito(11.333),nucl(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6N8	Uncharacterized protein	Low	5	1	386-405	VYVLRWWKRQLEREEKRDSE	plas(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QB82	GTP-binding protein Obg	Low	5	1	31-50	ANILRTRRRWHSTSNNRIVT	mito(22),cyto(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QC82	Uncharacterized protein	Low	6.6	1	152-177	HDTSGETTKKQRRKFRQTWSKEFHVS	plas(19),nucl(4),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEA7	Amino acid transporter, putative	Low	8	1	8-32	PASTGAAHRGRRRRGKRDAFQGSAS	plas(23),E.R.(3)	HRGRRRRGKR (15-24, prob:0.873)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QH99	Uncharacterized protein	Low	5.8	1	8-39	DPQTIRSKSAKQYHKNALRHPQQRKSSQLCRL	plas(6),cyto(5.5),mito(5),cyto_nucl(4.5),E.R.(3),vacu(3),nucl(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHN0	Acetamidase/formamidase family protein	Low	5	1	3-25	ANSHVHSHHKHLKWSNKQPPVLT	mito(13),cyto(7.5),cyto_nucl(5),pero(3),extr(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHP3	Integral peroxisomal membrane protein	Low	7.8	2	1057-1079, 1107-1126	RRGDSWGRYTRRRKWYRDAELVE, DPQGSMRKRRWFNNSKDLGR	plas(24),nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIZ4	Pyridine nucleotide-disulphide oxidoreductase AMID-like, putative	Low	6.7	1	39-58	VLFLRNRSTRKRRFYTDSET	cyto(10),cyto_nucl(9),nucl(6),mito(4),plas(3),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLV7	Pogo transposable element, putative	Low	9.2	1	561-585	LATPSAPKRAKKQVSKQVKVKAQPE	nucl(15.5),cyto_nucl(11),cyto(5.5),pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNS3	C2H2 transcription factor (TFIIIA), putative	Low	9.7	1	375-396	RERLGIKKEPSKRKTNNNVSAM	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQC7	C2 domain protein	Low	8.6	2	24-48, 1134-1157	IHKFVEKLDKEKKDRDQRIDEEFKR, GASSSKSGNKANKRTEQRQQRGLM	plas(15),nucl(4),cyto(3),mito_nucl(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4W1	Polyketide synthase, putative	Low	6	1	44-69	DTRDLLRRLRVHSKDKRHPTLARFIA	cyto(10.5),cyto_nucl(7.5),plas(5),nucl(3.5),mito(3),cysk(1),golg(1),E.R.(1),pero(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q849	Uncharacterized protein	Low	5.4	1	466-490	IAYCYWSRKRWSHRRQRDQELRKLA	extr(17),cyto(2),plas(2),E.R.(2),nucl(1),mito(1),pero(1),golg(1),mito_nucl(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8H1	ATP-dependent Clp protease, putative	Low	5.8	1	583-606	ESDWENKMQKDKKQRSTTNGGNGN	mito(16),cyto(3),plas(3),nucl(2),extr(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBS1	Zn(2)-C6 fungal-type domain-containing protein	Low	6.4	1	47-66	DSSTSKSTLKQRKTGQVQHF	plas(10),mito(9),nucl(4),cyto(1),extr(1),pero(1),E.R.(1),cyto_pero(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDH1	Lipase/thioesterase family protein	Low	5	1	24-46	IITGPFRARKQKLNPKQTIARSL	extr(9),cyto(6),E.R.(6),mito(2),plas(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QH00	NADPH:adrenodoxin oxidoreductase, mitochondrial	Low	8	1	504-527	SVEKDRGKAKGKPRQKFGHVEEML	mito(26)	RGKAKGKPR (509-517, prob:0.764)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLX9	Reverse transcriptase, putative	Low	6.6	1	31-52	LRRYAKPIRLCARSKRWWGPHT	mito(8),cyto_nucl(6),nucl(5),cyto(5),pero(5),plas(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQ44	DNA repair protein Rad50	Low	7.3	1	640-660	CRATLEKRKKERDQCLKKIRD	nucl(7.5),mito(7),cyto_nucl(7),cyto(5.5),E.R.(3),extr(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTW4	Uncharacterized protein	Low	8	2	9-30, 289-310	VIGPTQKKRTKATKQLPQSLID, EERIRDQLRKVRERKRASLEFD	cysk(13),cyto(6),mito(5),nucl(3),cyto_pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3G1	Ribosomal protein S15, putative	Low	9.5	1	245-283	LSRHLQTTNKDRHNKRNLRILVHKRQKLLQYLRRKERGG	nucl(14),mito(10.5),cyto_mito(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8C2	C6 transcription factor, putative	Low	9.9	1	109-133	SGLSCEYARERKKRGKASKKDLAEA	cyto(8.5),cyto_nucl(8),mito(7),nucl(6.5),plas(2),pero(2)	RERKKRGKASKK (117-128, prob:0.917)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9Z2	DUF2433 domain-containing protein	Low	8.7	1	558-581	RQPLDHKKPTPQGQPRKPNVKFFE	mito(11.5),cyto_mito(9.666),cyto(6.5),cyto_nucl(5.833),extr(4),nucl(3)	RGRGGFGRGRGGRGSDRGGRGRGRGG (621-646, prob:0.939)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBU6	C6 transcription factor RosA-like, putative	Low	6.8	1	3-39	GPGGGPPRKSHTKSRNGCRTCKRRHIRCDETFPQCRN	plas(17),nucl(5),mito(3),cyto_nucl(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QE25	BTB domain-containing protein	Low	8.8	1	386-409	EGQVKKYEVRCKRCHLRGINLWDS	nucl(13),cyto_nucl(10),cysk(6),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFL9	Reverse transcriptase, putative	Low	5.8	1	768-789	SPILNNRHIKRKQKKAHWEDFL	mito(21.5),cyto_mito(12.5),nucl(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFW0	20S-pre-rRNA D-site endonuclease NOB1	Low	6.5	1	390-411	KEYSRAVTDEKRQQRRERDLMD	cyto(16),cyto_nucl(12.666),cyto_mito(9.666),nucl(8),mito_nucl(5.666)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLW1	Integrase catalytic domain-containing protein	Low	7.7	1	156-175	NSWTSRKERKADANRWHARL	cyto(11),pero(8),nucl(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMM8	Uncharacterized protein	Low	5.9	1	1-23	MTKHLFRSPKAPRRQTSWQCVNL	mito(16.5),cyto_mito(9.5),extr(6),nucl(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2T9	60S ribosomal protein L32	Low	6.7	1	2-48	AAKSHIPIVKKRTKRFFRHQSDTFKCVPSSWRKPKGIDNRVRRRFKG	mito(15.5),mito_nucl(11.5),nucl(6.5),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4V3	NAD-dependent epimerase/dehydratase, putative	Low	5	1	22-41	LLKSPKNKIHAYCRNQKKLH	cyto(19),mito(4),cysk(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7E9	C6 transcription factor (War1), putative	Low	9.7	1	148-176	AKANRRCVVTPPTRKRQKKTDSRVSELEK	nucl(16.5),cyto_nucl(10),plas(4),cyto(2.5),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q879	Xenobiotic compound monooxygenase, DszA family	Low	8	1	29-49	QAPGLWRHPRNKTDQYKKLSF	cyto(17.5),cyto_mito(9.5),pero(4),cysk(3)	RRGRFRSRP (434-442, prob:0.665)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8T2	5-oxo-L-prolinase, putative	Low	7.1	1	1260-1285	QTGHNLWVRKIPKKDKDGKEFKEDRI	cyto(13.5),cyto_nucl(12),nucl(7.5),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9P1	Uncharacterized protein	Low	8.3	1	22-45	GYGVKRVAFRSAKKKNTNKDDDSE	nucl(11.5),cyto_nucl(10),cyto(7.5),mito(4),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAF7	Chloride channel protein	Low	5	1	78-97	DEVQEQIRRRARRREGHGFW	plas(25)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAN5	Carboxypeptidase Y homolog A	Low	5.4	1	82-104	IPFFSSPKKHTRRPDSHWDHIVR	extr(20),vacu(3),nucl(1),mito(1),pero(1),E.R.(1),mito_nucl(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDC3	NAAA-beta domain-containing protein	Low	6.6	1	342-365	DCIQAKWDKKVQRHQKHIARNAEQ	mito(13),cyto_nucl(6.5),cyto(6),nucl(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHY1	Aspergillopepsin F, putative	Low	5	1	376-395	FDARRGRPPRVGFSKQRPPV	extr(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQU9	PA and RING finger domain protein	Low	8	1	599-624	YALLLLRSRIRRRRWRAPKSVVERLP	extr(15),plas(6),E.R.(3),golg(2)	RIRRRRWRAPK (607-617, prob:0.798)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUT1	Uncharacterized protein	Low	9.8	1	7-46	TTEDRNKENEKGKKVKNRSRKQPRTTNPKKQTHGHPDHDD	mito(7),cyto(7),cyto_mito(7),nucl(6),pero(6)	NEKGKKVKNRSRKQPRTTNPK (15-35, prob:0.943)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1F7	Pogo transposable element, putative	Low	9.3	1	570-594	LATPSAPKRAKKQVSKQVKVKAQPE	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2S1	G2/mitotic-specific cyclin (Clb3), putative	Low	9.6	1	18-37	INVHPTKTIHHRNKSTPALS	nucl(18.5),cyto_nucl(13),cyto(4.5),mito(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q446	ANK_REP_REGION domain-containing protein	Low	6.2	1	370-390	LLEKTRNKWHQEEQERLKRVS	mito(12),cyto(7),nucl(3),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7P3	OPT peptide transporter Mtd1, putative	Low	5	1	696-715	FSQVWLRRRLPRVYNKYNYL	plas(27)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDT0	ABC1 domain protein	Low	5	1	59-81	GKAAPAKTYTRTRKWLRRLFYVS	mito(21),cyto(2),plas(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFC8	MYND-type zinc finger protein samB	Low	6.9	1	523-545	TIIGKWPMKLPRRSTKRQFEMMY	cyto(6),nucl(5),mito(5),plas(5),mito_nucl(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMW8	Uncharacterized protein	Low	5	1	153-173	HNLNDDWRKKRSRNSEPDELY	extr(24),plas(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNI2	Synaptobrevin-like protein Sybl1, putative	Low	5.6	1	207-227	HDFRMRSRGLRRKMWWKNVKV	mito(10),extr(7),nucl(2),cyto(2),plas(2),cyto_nucl(2),pero(2),golg(2),cyto_pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQX1	UDP-glucose:glycoprotein glucosyltransferase, putative	Low	5	1	1425-1444	CNNPLTKEPKLERARRQVPE	extr(12),plas(4),E.R.(4),cyto(2.5),cyto_nucl(2),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QU27	HTH CENPB-type domain-containing protein	Low	8.9	1	717-741	LATPSAPKRAKKQVSKQVKVKAQPE	nucl(13.5),cyto_nucl(11),cyto(7.5),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QV44	Cytochrome c mitochondrial import factor (Cyc2), putative	Low	7.7	1	3-26	VSTRCPYWRTCKLPQRIPRPSPSP	mito(19),nucl(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2N4	Cyclin dependent kinase inhibitor Pho81, putative	Low	9	1	26-46	RTPDPTHRKFGKQIQRRQLDL	nucl(15),cyto_nucl(11.5),cyto(6),pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGL9	Uncharacterized protein	Low	8.7	1	13-36	AATFEFTYRNRRQHRRTKLLIALL	nucl(10),mito(3),cyto(3),cyto_mito(3),plas(2),pero(2),E.R.(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGQ3	Pogo transposable element, putative	Low	9.9	2	20-39, 122-143	IDAVKNKKTKTIRQTARLFD, SRNPDLKCKFARRLSRKRALCE	nucl(9.5),mito(9),cyto_nucl(7),cyto(3.5),plas(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLN1	EF hand domain protein	Low	5.7	1	36-57	GSTPRLQRRGAVLRRNRRENVP	cyto(8),E.R.(6),mito(3),nucl(2),extr(2),pero(2),golg(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLR4	Alpha/beta hydrolase, putative	Low	5.9	1	326-345	FSNPKNQKYRVVRYRPRGRA	cyto(10.5),cyto_mito(8.5),cysk(6),mito(5.5),nucl(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QV86	Uncharacterized protein	Low	9	1	451-481	TPPPAKDATTKVKKSKSKKKKSGNAIDDIFG	cyto(11.5),mito(8),cyto_nucl(8),nucl(3.5),pero(3)	TKVKKSKSKKKKS (460-472, prob:0.954)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1T3	Integral membrane protein, putative	Low	5	1	212-235	EMSFLINRKSRKKNYPRRPTTLDV	plas(18),E.R.(4),golg(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7C2	Uncharacterized protein	Low	6.2	1	302-324	GRIRSAKQPHPIRHNQQQQQPRE	cyto(10),cyto_nucl(8),nucl(4),E.R.(4),extr(3),mito(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QC19	DRAP deaminase, putative	Low	8.2	1	216-240	SQEERERQDKLPRNPKKRMMETSLQ	nucl(13.5),cyto_nucl(9.833),mito(7.5),cyto_mito(6.833),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QCS6	Uncharacterized protein	Low	9.8	1	70-89	AAKERRRKAREEIEQRREFN	extr(13),nucl(5),E.R.(3),mito_nucl(3),pero(2),golg(2)	KERRRKARE (72-80, prob:0.776)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIC4	Uncharacterized protein	Low	9.7	1	408-433	EEQKKFLEKEKEKEQRKMMKRSTRRG	cyto(11.5),cyto_nucl(9),nucl(5.5),mito(5),pero(2)	KLRNAREEEIRKLRRADEEEKAEERKFAAEKLKKDERERLLRGMTAEEQKKFLEKEKEKEQRKMMKRSTRRG (362-433, prob:0.947)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJV3	Uncharacterized protein	Low	7.3	1	323-345	KESSPTTTRKNMKKKLLHKLSVN	nucl(7.5),cyto_nucl(7),cyto(5.5),mito(5),extr(4),plas(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKD6	Gram-negative bacteria binding protein, putative	Low	5	1	61-80	RPWVNDKRLKRIRVNNYIIW	extr(15),cyto(5),mito(3),cyto_pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQ72	Steroid alpha reductase family protein	Low	8	1	274-304	TFQMWDWAKKKERRYRKEFGDKYKRKRFTVL	plas(9),mito(7.5),cyto_mito(7.5),cyto(6.5),pero(2)	KKKERRYRKEFGDKYKRKR (282-300, prob:0.902)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QT45	NADPH oxidase, putative	Low	5	1	432-453	LKSIWYRMSRGKQQTRLRKVYF	plas(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5B3	Uncharacterized protein	Low	5	1	430-453	VEASWKWKTVPKKKCTFVRSIRLG	golg(9),extr(7),E.R.(5),mito(3),vacu(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDW0	Uncharacterized protein	Low	9.3	1	466-488	PLVFIKLSTKKKRPVPQVEPSGE	nucl(21.5),cyto_nucl(13.333),mito_nucl(12.166),cyto(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QI68	C-24(28) sterol reductase	Low	5	1	1-22	MPQTRSQSGKTPRKVDRPDFVE	plas(25)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QI90	Aspartic-type endopeptidase, putative	Low	5	1	21-41	DATPIKSNKSHRNRRSLDSTT	extr(24),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJ25	Aminohydrolase, putative	Low	5	1	476-503	DGQYVKRGPNQLKKDSPRMDKDPRRVAT	cyto(15),cyto_nucl(9.5),mito(4),pero(3),cysk(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKG2	Patatin-like phospholipase domain-containing protein	Low	7.4	2	60-100, 139-158	VAINDWRPIRQRVRRPFRSRAVSNTTNKPPRRTKDETREGF, TWTGRREKLRRSLHSTRNYE	plas(22),nucl(1),cyto(1),cyto_nucl(1),E.R.(1),golg(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKR1	Protein YIP	Low	5	1	274-293	HGSPASKKNRHDNDDKDKDH	plas(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMC9	Integrase catalytic domain-containing protein	Low	5	1	156-175	NSWTSRKERKADANRWHARL	cyto(9),pero(9),cyto_pero(9)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNV6	Monooxygenase, putative	Low	5	1	101-121	TQFPGIRRVNHKKTKHHLSQG	extr(15),E.R.(4),mito(3),golg(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPR8	Uncharacterized protein	Low	7.5	1	494-516	ASTMRTKSLRRTKSRDRLDRLSS	nucl(8.5),cyto_nucl(8),mito(7),cyto(6.5),extr(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q213	DUF28 domain protein	Low	5	1	36-59	GHSRWSTIKHDKAKNDKAKSKERG	mito(15),cyto_mito(12.333),cyto(7.5),cyto_nucl(6.166)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9B9	Uncharacterized protein	Low	9.3	1	21-41	ETTSPPSMKRHPFHRHAPFST	nucl(17),cyto_nucl(14.5),cyto(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9N5	Solid-state culture expressed protein (Aos23), putative	Low	6.7	1	251-272	QEQKSKTSKLEKVKNKLHIGNH	cyto_nucl(11),cyto(10.5),mito(10),nucl(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGX5	2-(3-amino-3-carboxypropyl)histidine synthase subunit 1	Low	8.4	1	5-28	DDTTSRPATRQPKKRFVGRRTADA	nucl(11),cyto(9),pero(6),mito_nucl(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJ39	Uncharacterized protein	Low	7.1	1	147-171	MLSTTKSSAKPKRPEQKFQTRLNSE	extr(8),nucl(6.5),mito(6),cyto_nucl(6),cyto(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMA9	Uncharacterized protein	Low	9.9	1	322-342	CAGCYEQLKKCKNRDLRELVD	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQC2	ADAM family of metalloprotease ADM-B	Low	5	1	718-741	LSYITSACRRQRYRKVVPAPLPDG	extr(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QR05	zf-3CxxC domain-containing protein	Low	8.9	1	88-109	RVYHQRCKSCKRLSRPKLNETY	nucl(18),mito_nucl(12.333),cyto_nucl(10.833),mito(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QS08	Mitochondrial inner membrane AAA protease Yta12, putative	Low	5	1	51-79	SINPGDPKRPDDKNKNKKVQKSKDEELAE	mito(24.5),cyto_mito(14)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVR3	Protein transport membrane glycoprotein Sec20, putative	Low	8.1	1	363-382	DGPRNTKKRMWEESEERRDE	nucl(11.5),cyto_nucl(11),cyto(9.5),mito(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q474	Uncharacterized protein	Low	9.9	1	152-172	EIIHKHEHKHHHDHNHAKIES	nucl(17.5),cyto_nucl(12),mito(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4N5	FAD-binding FR-type domain-containing protein	Low	5	1	64-86	IRHDCKISFHRPNRPKAWLNRHL	plas(21),E.R.(3),mito(1),pero(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAP5	Reverse transcriptase, putative	Low	7.5	1	30-51	TQLRRIYTYWRNQARSRRRAGC	mito(11.5),cyto_mito(9.5),nucl(9),cyto(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QE38	DNA mismatch repair protein	Low	9	1	186-206	PTPPPAPKGRQTKKTGSKLTP	nucl(13.5),cyto_nucl(9),mito(8),cyto(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFB0	Glucose 1-dehydrogenase, putative	Low	6.5	1	329-353	ALCPGCKWETKKKNLMKNDSRSSTD	mito(11),cyto(7),nucl(4),plas(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFK2	Uncharacterized protein	Low	6.1	1	1-27	MGRQLQSKRCVPRRPPPPRLVPKPELP	mito(15),nucl(4),cyto(4),cyto_nucl(4),pero(4),cyto_pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QG20	MFS domain-containing protein	Low	5	1	572-599	KTGLQSLKVEDRQKKKKPDEESPTQTRS	plas(24),mito(1),pero(1),E.R.(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIE7	Uncharacterized protein	Low	6.7	1	45-66	AVNTRQCRCHRRCFSQLTPKPL	mito(20),nucl(5),cyto_nucl(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJC2	MFS transporter Liz1/Seo1, putative	Low	5	1	462-483	IIRFLHKREKLSKIRRHIDQDD	plas(23),mito(1),pero(1),E.R.(1),golg(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNJ4	Uncharacterized protein	Low	9.3	1	134-159	DSQYSQKSAQQQRQHKQKRRGEGLKQ	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPA6	Uncharacterized protein	Low	7.2	1	185-205	NPSSSKEKRGRTTKNKMLFRT	cysk(10),nucl(8),cyto_nucl(7.333),cyto(4.5),cyto_pero(4.166),pero(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QRB8	Uncharacterized protein	Low	7.8	1	83-105	ELGRVLRHHHHHRHYQNPSHNLR	cysk(14),nucl(9.5),cyto_nucl(7),cyto(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QS24	MFS multidrug transporter, putative	Low	5	1	417-436	LLNQRFYISRFKKNNNRPVP	plas(27)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUY1	40S ribosomal protein S24	Low	9.5	1	138-157	VPPRPRVPRRARTKSFLRRG	mito(13),cyto(7),nucl(4),pero(2)	RPRVPRRARTK (141-151, prob:0.739)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1W9	Ribosomal protein L14	Low	5	1	120-139	FERFKVMRLKKQSRYEVLKT	cyto(23),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1Z6	Phospholipid-transporting ATPase	Low	7.8	2	51-77, 1239-1258	YGARIALRNLRTRKRNRLWSREHQGAE, VWVGKVIKRSWKPPSYRKVQ	plas(22),nucl(2),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3Q0	Pfs, NACHT and Ankyrin domain protein	Low	5.4	1	766-789	EVLEQKPRLRRRYQRPDPKTDRLY	plas(17),extr(3),mito(2),vacu(2),nucl(1),pero(1),E.R.(1),cyto_mito(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4L4	Uncharacterized protein	Low	7.1	1	61-80	QVFLKFRKVQTHKKSRFLES	cyto(7.5),cyto_nucl(7.5),nucl(6.5),mito(5),E.R.(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6V8	tRNA ligase	Low	8.6	1	17-38	EAATKRSRSESKKTFSCKKSTF	nucl(14.5),cyto_nucl(13),cyto(8.5),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6Y4	R3H domain protein, putative	Low	9	1	439-458	SSTSGRKKNFRQKTPHDDSF	nucl(15.5),cyto_nucl(11.5),cyto(4.5),extr(3),mito(2),plas(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QCD8	Uncharacterized protein	Low	7.4	1	73-95	AKEELKRKSIRHNYSRRGRNSTL	mito(19),nucl(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIW2	Ankyrin repeat-containing protein, putative	Low	7.4	1	1328-1349	LLNDRKRSSRLDFKNRSRFSLR	cyto(10),cyto_nucl(10),nucl(8),extr(3),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLL9	Uncharacterized protein	Low	9.3	1	266-285	YQETERRVKERQSRRVKFAS	nucl(14.5),cyto_nucl(10),mito(7),cyto(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMW5	Pogo transposable element, putative	Low	9	1	570-594	LATPSAPKRAKKQVSKQVKVKAQPE	nucl(15.5),cyto_nucl(12),cyto(7.5),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPA7	Amino acid transporter, putative	Low	5	1	102-121	VIPVRPSRDRITKRRLRGIH	plas(25)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQM1	V-type proton ATPase subunit C	Low	5.8	1	349-369	NAFGRDKKGRVKKDDPNEMQV	cyto(9.5),cyto_nucl(6.5),mito(4),extr(4),E.R.(3),nucl(2.5),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8R5	HTH CENPB-type domain-containing protein	Low	9.5	1	16-37	ALEILRKNPKQKIKPLARQFGV	nucl(13),cyto(8),pero(4),cyto_mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBS3	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial	Low	7	2	7-31, 97-118	AQNAVCRSLRRVRPQRPLIYTPKPA, EEDGNPPRRKRIRPSGPWQVQV	mito(23.5),cyto_mito(13.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QD48	Uncharacterized protein	Low	8	1	181-200	SSVGATKKHKQKPPRSAKSP	extr(24),mito(1),cyto(1),golg(1),cyto_mito(1)	KKHKQKPPRS (187-196, prob:0.719)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDA4	Autophagy-related protein 2	Low	7.7	1	1703-1725	RPSSTRGKRLRLSRSKHHKMTFE	nucl(13),cyto_nucl(11.333),mito_nucl(9.833),cyto(8.5),mito(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEN3	MFS domain-containing protein	Low	5	1	487-507	DVVRIARLKRQARKEGKVFTD	plas(25)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJ35	MFS domain-containing protein	Low	5	1	473-494	CLQTWRAQVKEKKQYIQNKASE	plas(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJB3	Zn(2)-C6 fungal-type domain-containing protein	Low	7	1	21-70	LADTMPSRRQHPKSRHGCLTCKSRKVKCDFQRPICSHCQRRKERCEYAEA	cyto(7.5),cyto_nucl(7.5),mito(7),nucl(6.5),plas(2),extr(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLF3	GPI anchored cell wall protein, putative	Low	5	1	223-242	HKALEKTKTMKEKFRRSTEA	extr(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQ13	Methylthioribulose-1-phosphate dehydratase	Low	6.9	1	88-110	TPKYPPSERKYIRKPKNLKPSDC	cyto(14.5),cyto_nucl(11),nucl(6.5),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q227	Fungal specific transcription factor, putative	Low	9.8	1	43-67	YISIACNECKRRKIKCNGQVPCQRC	nucl(12),plas(11),cyto(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3Y5	Mitochondrial intermediate peptidase	Low	5.8	1	6-32	RSRPWTCKVCLQRLQRLQRSRPERTFA	mito(23),nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6B2	Pre-mRNA-processing factor 19	Low	9.3	2	627-646, 832-858	SSDSRRPAHHHRQPRFGRNI, VYCGECTTNRSKRKNTALKMTKPFSKC	cyto_nucl(12.666),nucl(12),cyto(12),cyto_mito(7.666),mito_nucl(7.666)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFX5	Uncharacterized protein	Low	9	1	146-175	EATRQNKQKKLVRNCLKCRFEKKKVICPYN	nucl(14),cyto_nucl(11),cyto(6),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHV7	Polyketide synthase, putative	Low	7	1	16-36	FLDHLFKKKRTPLLQNFLERS	cyto(12),cyto_nucl(10.5),nucl(7),mito(3),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSN8	Integrase catalytic domain-containing protein	Low	8.3	1	435-457	FTDRRYNTRQPSRSPHRNRSSYA	nucl(11.5),cyto_nucl(9.5),pero(7),cyto(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q394	MFS multidrug transporter, putative	Low	5	1	261-282	LKQQASKLRKKWRSNRYFSRAE	plas(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3W2	RING finger domain protein	Low	8.8	1	492-513	LAQTHRKRRVLDYDRQKKKVVK	nucl(10),mito(6),plas(5),cyto_mito(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q603	Serine/threonine-protein kinase Tel1	Low	8.3	1	2594-2614	SNVLRDHRSTRQRNLHIRTYK	nucl(10.5),plas(10),cyto_nucl(7),cyto(2.5),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q738	DNA-directed RNA polymerases I and III subunit RPAC1	Low	7.3	1	353-373	SVKVLKLKCVRLKRDLNKLVQ	nucl(9),cyto_nucl(8.333),cyto_mito(5.666),cyto(5.5),mito(4.5),plas(3),pero(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8G9	Uncharacterized protein	Low	8.6	1	63-88	MQDRSTPRPSKPSKSRRNDQALKIIQ	nucl(13.5),cyto_nucl(10),cyto(5.5),mito(4),plas(1),pero(1),golg(1),cysk(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QA18	Uncharacterized protein	Low	8	1	38-65	LAAHRQWKTSSKKYKRNWNKYVRMEFDK	nucl(13),mito_nucl(11.833),mito(9.5),cyto_nucl(9.333)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAU4	2-isopropylmalate synthase	Low	7.1	1	1-27	MPMLKDPSKKYKRFKPLNLPDRTWPNK	nucl(6.5),cyto_nucl(6.5),plas(6),cyto(5.5),pero(4),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QE55	Allantoate permease, putative	Low	5	1	46-70	VTDPTPKEARKIRNKCLRRILPFLC	plas(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEV3	Uncharacterized protein	Low	9.9	1	76-99	ELQDVGKTKKFRKKKGHTLVAALC	cyto(10.5),cyto_nucl(9),nucl(6.5),pero(6),mito(2)	TKKFRKKK (83-90, prob:0.792)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKA8	Polyketide synthase, putative	Low	9.1	1	1630-1654	LPAVTKPRKTPKAPKAPKKKVSSGQ	cyto(10),cyto_mito(8.333),cyto_nucl(7.833),mito(5.5),nucl(4.5),plas(2),extr(2),pero(2)	KPRKTPKAPKAPKKK (1635-1649, prob:0.954)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKM1	Cytoplasmic tRNA 2-thiolation protein 1	Low	7	2	8-33, 335-357	NCQASRAVIIRRKNRHKLCKACFIEI, PTVNDSKKTKKPAQVQVKGKTIR	mito(27)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1U6	Benzoate 4-monooxygenase cytochrome P450, putative	Low	5.4	1	94-116	VVGTNPHKLHRKRRAALNPFFSK	cyto(11),plas(5),E.R.(5),extr(3),nucl(1),mito(1),golg(1),mito_nucl(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5Z2	Pantoate--beta-alanine ligase	Low	5	1	34-55	RDVPSLRDRRRQLQKSMRTVGL	mito(19),cyto(7.5),cyto_nucl(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7J6	MFS multidrug transporter, putative	Low	5	1	563-582	QEDQRRLKGKREARDARNAT	plas(27)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9Q8	MYND-type zinc finger protein samB	Low	9.3	1	348-378	KWEDYQRQFAKCRRCRRTKYCSKECQKAAWI	nucl(13),cyto_mito(5),mito(4.5),cyto(4.5),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAK9	Zn(2)-C6 fungal-type domain-containing protein	Low	7.4	1	1-30	MAKSKVRTGCRTCKTRKVKCDESYPVCRRC	plas(16),nucl(6),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAX6	Transcription factor TFIIA complex subunit Toa1, putative	Low	8	1	326-346	LCTYDKVQRVKNKWKCTLKDG	nucl(10),cyto_nucl(9.5),cyto(7),pero(5),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHX1	Nucleolar RNAse III, putative	Low	9.2	2	13-33, 89-113	GAEISNPHKRHKSNRAGSDCH, ATIKRDTDTKHRKPKETKPTAQPVS	cyto(9.5),cyto_nucl(9),mito(8),nucl(7.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QW09	tRNA wybutosine-synthesizing protein 4	Low	8.5	1	448-470	LEELAKQKEGRKRKWDEIVHANS	nucl(13.5),cyto_nucl(12),cyto(9.5),mito(1),extr(1),pero(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QW61	Zn(2)-C6 fungal-type domain-containing protein	Low	8.5	1	34-64	VSYHRHIVYCRRAKNRRRTRLRSCRACSAAK	nucl(9),mito(6),plas(5),cyto(2),extr(2),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q251	DDENN domain protein	Low	9.8	1	159-182	AITPNAKPPKPRPKVQKIVSEDRP	nucl(15),cyto(8),mito_nucl(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q557	DUF21 and CBS domain protein (Mam3), putative	Low	8	1	706-736	YDDGSASTSKKKRRRRKKKKPANEDPENAPL	plas(10),E.R.(6),mito(4),extr(3),golg(2)	KKKRRRRKKKKP (715-726, prob:0.998)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q672	Protein transport protein Sec39, putative	Low	6.1	1	857-883	NLTPLQQQQQRQQRHHHQQQQLLPPTD	cyto(8.5),cyto_nucl(6.5),mito(4),nucl(3.5),extr(3),plas(2),pero(2),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7Y5	DNA polymerase kappa	Low	9.1	1	618-646	PSNAWNKEQYSKKRKTNIETDPRQKRLFF	nucl(15.5),cyto_nucl(12),cyto(7.5),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBG4	Tyrosine--tRNA ligase	Low	9.1	1	339-369	ITLKAYPPPVVQKKQKKIKDKGSRYPGPDKE	cyto(18),cyto_nucl(12),nucl(4),E.R.(2),cysk(2)	KQKKIKDK (352-359, prob:0.679)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QCA4	Isoleucyl-tRNA synthetase	Low	7.7	1	895-916	WPTLGKKLKKDAQKVKKSLPSL	cyto(14),cyto_nucl(13),nucl(10)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHY5	HTH CENPB-type domain-containing protein	Low	9.6	1	339-366	HDLRAANEKEKQKRQKSKKQISIEQGIT	cyto(12.5),cyto_nucl(10.833),cyto_mito(8.166),nucl(7),mito(2.5),pero(2),E.R.(2)	KQKRQKSK (349-356, prob:0.663)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQB6	DDE_Tnp_1_7 domain-containing protein	Low	9	1	828-850	DDYIERTRRRPQKTSTNGPWCIK	mito(15),nucl(10)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSJ7	MYB DNA-binding domain protein	Low	9.2	1	678-698	IHDRRAQKPVQTAKRPRHDLT	nucl(16),cyto_nucl(11.5),mito(6),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUB4	Uncharacterized protein	Low	7.8	2	255-277, 601-621	AILFCGRKLRRRRLQEKAAPQSF, IPYQVRRQSQQQQQQQPPRLS	extr(14),mito(7),nucl(2),plas(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVR1	Inorganic diphosphatase	Low	6.2	1	29-57	VSNRPKCSTSKPRNFTTPRPNLRQVPKSC	mito(8.5),cyto_mito(6.5),plas(6),nucl(4),cyto(3.5),pero(2),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1H9	Uncharacterized protein	Low	6.5	1	82-102	LLASRRKQKFMKKWGPRGIVR	mito(17),cyto_nucl(5),nucl(4.5),cyto(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1J5	Pentatricopeptide repeat protein	Low	9.4	2	6-26, 190-211	ELSRHCQTTYRRIAPRRSAVT, IDYNRWLKTTRRRNNKDGPAVQ	mito(12),nucl(7),cyto(4),plas(2),golg(2),cyto_pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1K0	Uncharacterized protein	Low	6.1	1	19-38	RDTSYSHKHHHQRSDSPSFQ	cyto(10.5),cyto_nucl(7.5),mito(4),plas(4),nucl(3.5),extr(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2C6	Pentatricopeptide repeat protein	Low	5	1	849-872	VSMLVNDKKRKRMSKVFYCPQIHK	mito(19.5),cyto_mito(12.5),cyto(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2X8	Cytochrome P450 oxidoreductase OrdA-like, putative	Low	5	1	25-44	QFKHIRRPPLPPGPKPKFLV	extr(6),mito(5),cyto(5),cyto_mito(5),plas(4),E.R.(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q343	Uncharacterized protein	Low	5	1	1-21	MPTYRRTTARRRYQWPELQLN	plas(14),extr(5),E.R.(4),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q587	CCT-epsilon	Low	5	1	19-42	RPFIIVRDQGKKKRQHGNEAVKSH	cyto(24),cyto_nucl(14)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDH8	Carbon catabolite derepressing protein kinase Snf1, putative	Low	9.1	1	785-808	IDGEWRPVSKRIRNKEKEVTSPYP	nucl(15.5),cyto_nucl(13),cyto(9.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QF24	Uncharacterized protein	Low	6.9	1	17-37	RQSSINKKTKTERNDYRPDMS	mito(6),plas(6),nucl(5.5),cyto_nucl(5),cyto(3.5),golg(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QG81	MFS sugar transporter, putative	Low	5	1	312-331	SPRWLMTKKKHKKAYNSLLR	plas(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QI40	Cyclin, putative	Low	8.5	1	302-330	IGPSPGPKHGKHNKNKGKGKDQRDREFEN	cyto(16),cyto_mito(11.499),cyto_nucl(10.833),mito(5.5),nucl(2.5)	PGPKHGKHNKNKGKGKD (306-322, prob:0.909)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMG2	Ribosome recycling factor, putative	Low	5	1	65-86	TTSAVLSKKKDKSKRNDDAESS	mito(23),cyto(2.5),cyto_nucl(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QR90	Calcium transporter, putative	Low	5	1	6-31	LRNKIFPSWDQRDKNKKVTWSKRSAA	plas(11),cyto(8),extr(3),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QS66	CIA30 domain-containing protein	Low	9	1	251-270	ADEPKRPHLRGRAKNPILRF	nucl(10),cyto(9),mito(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSQ9	Zn-dependent hydrolase/oxidoreductase family protein, putative	Low	5.7	1	4-24	FIRRLFATWRRERHTPRPFLS	mito(21),cyto(3),nucl(2),cyto_pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUU3	Uncharacterized protein	Low	7.3	1	24-47	STIIYRPRYSRHHCRRTSMRIIGD	cyto(8.5),nucl(7),cyto_pero(6.5),mito(5),pero(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1I2	SAP domain-containing protein	Low	8.3	1	391-413	VSETKTSKKSKTSNNDNKQAYKI	mito(24),nucl(1),cyto(1),cyto_nucl(1),pero(1),cyto_pero(1)	K (327-327, prob:0.606)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3V5	Zn(2)-C6 fungal-type domain-containing protein	Low	8.8	1	1-34	MQTRRSHNKSRRGCLECKRRRVKCDETRPQCSNC	plas(11),nucl(10),mito(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8J9	Peroxin-1	Low	5	1	1122-1142	RLTALKLARRRQRQAEHGTYD	mito(10),cyto(8),mito_nucl(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAM4	Zn(2)-C6 fungal-type domain-containing protein	Low	8.8	1	22-44	CGTCRIRKIKCDENKPFCRKCSS	nucl(12),mito(7.5),cyto_mito(5.5),cyto(2.5),plas(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QE00	Palmitoyltransferase	Low	8.4	1	111-135	EHESWLSKRRKTKEKSKPDHGNGTT	plas(20),mito(2),vacu(2),nucl(1),cyto(1),cyto_nucl(1),E.R.(1)	KRRKTKEKSK (118-127, prob:0.741)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMR0	RNA binding protein	Low	5.6	1	2-23	HMTTSPPRERGRRGHRSSEEEF	plas(13),cyto(4.5),cyto_mito(4.5),mito(3.5),nucl(2),E.R.(2),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNE9	Lactam utilization protein LamB	Low	5	1	179-199	IVDRKKKPWKIEDVKKHVAKQ	cyto(26.5),cyto_nucl(14)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPN8	3-hydroxyacyl-CoA dehydrogenase, putative	Low	6.9	1	88-116	LPNKMFTSLHRQRQKRVRHRKVWSVTEVP	mito(17),nucl(5),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QU06	Uncharacterized protein	Low	9	1	22-44	TEVHYYNKAKKAPRKQQELEGGV	nucl(10),cyto(9),mito(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QW90	MFS sugar transporter, putative	Low	5	1	477-496	FDAPRIAKHLPKKMRSPDDS	plas(19),E.R.(4),mito(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QWJ8	Uncharacterized protein	Low	6.4	1	1-21	METPKGAHRGRRSPQFHRGWD	mito(13),cyto(8.5),cyto_nucl(7),nucl(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2W0	Polyphosphoinositide phosphatase Fig4	Low	9.7	1	1017-1045	VVAEDYDKKRYKRYRQWLKGKSLFKQRVD	nucl(17.5),cyto_nucl(12),cyto(5.5),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q469	RNA exonuclease, putative	Low	8.7	1	399-429	KDIKYAKPDVKRYVRKDFKKDGRKYVKDGSR	cyto(16.5),cyto_nucl(10),mito(5),nucl(2.5)	VKRYVRKDFKKDGRKYVKDGSRKEAGKE (408-435, prob:0.869)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q480	Integral membrane protein TmpA	Low	5	1	53-76	EDVEAQKSKRQSKPRSYWNFLRYT	plas(22),E.R.(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5P3	Component of oligomeric Golgi complex 3	Low	9.2	1	13-32	SDPSGTQRTKPKAKAPTQFT	nucl(15),cyto_nucl(10.5),mito(6),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q620	Oxidoreductase, zinc-binding	Low	5	1	15-37	PDTWLSFQKRHYKLKPFEDHDVD	cyto(25.5),cyto_pero(14)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEB1	Beige/BEACH domain protein	Low	7	1	894-913	VPSLHKKKSMRFNSRSRQLS	cyto_nucl(8.5),cyto(8),nucl(7),plas(3),pero(3),mito(2),E.R.(2),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJH2	Uncharacterized protein	Low	5	1	49-70	LYSYTAIKKRRAKQPWRHWLIV	plas(11),mito(8),extr(4),mito_nucl(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2W7	Uncharacterized protein	Low	9.9	1	187-210	VWNWGKPNDQKKRDELKDKKEGSS	nucl(17.5),cyto_nucl(11),mito(4),cyto(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4T5	Uncharacterized protein	Low	9.8	1	21-44	NNSEEERKKQQRKIEEQQKRICEN	nucl(12),cyto(10),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q597	Dynamin GTPase, putative	Low	8.2	1	681-702	AYYSDFKKTRKEKKAIALYRSR	nucl(11),cyto_nucl(10.5),cyto(8),pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7C1	Elongation of fatty acids protein	Low	5	1	278-297	IATYRKPSTRGRKALTVKKD	plas(22),E.R.(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8Z9	Zn(2)-C6 fungal-type domain-containing protein	Low	8.2	2	116-142, 167-192	IGRPSRDCNSCRKRRIKCDLKYPECGQ, ISFPDNQSKDRRKKQIQQIQQRENGV	plas(6),E.R.(6),extr(4),nucl(3),golg(3),cyto(2),mito_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGF4	Mucin family signaling protein Msb2, putative	Low	5	1	598-622	GVMFYVARRYRKRKQLHTRSSSVST	extr(27)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHM6	Small nucleolar ribonucleoprotein complex subunit, putative	Low	9	1	300-323	DRRTVLYRLKPGKKNDKSRRWMEV	nucl(14.5),cyto_nucl(10.5),cyto(5.5),mito(3),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKB4	FAD binding oxidoreductase, putative	Low	8	1	29-54	YENARVKRVFNCQRPRRYPRAVVSAK	nucl(12.5),cyto_nucl(11.333),cyto(9),cyto_pero(5.833),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QML2	Alanyl-tRNA synthetase, putative	Low	5.8	1	252-273	LCGHTTVKKITRKQGQSKVSYS	cyto(16),cyto_nucl(10.5),mito(5),nucl(3),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QRM1	Dihydroorotate dehydrogenase (quinone), mitochondrial	Low	5	1	42-68	EPEPIATITKKNKKSPVRKFIFRASLA	mito(23),cyto(2),pero(2),cyto_pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QWE0	Uncharacterized protein	Low	8.6	1	35-62	NRPTALRRRNYLRRLRKVWRSLRRESSR	cyto(8.5),cyto_mito(8),mito(6.5),plas(3),extr(3),nucl(2),pero(2)	RRLRK (47-51, prob:0.632)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2K6	Signal peptide peptidase, putative	Low	8.8	1	45-69	ASLSRPSSAAKPKKKSKVESDSEDE	plas(14),E.R.(5),mito(3),nucl(2),golg(2)	KPKKK (55-59, prob:0.681)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6V4	Uncharacterized protein	Low	8	1	251-283	LSRTWKDRGSRGERRSRSRKRGRSGRGVADERR	plas(15),E.R.(4),vacu(4),mito(2),extr(2)	KDRGSRGERRSRSRKRGRSGRG (256-277, prob:0.983)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7Y3	Squalene synthase	Low	6.4	1	36-57	SKDPETRKKCFKFLKLTSRSFA	cyto(10),cyto_nucl(8.333),cyto_mito(6.833),nucl(5.5),E.R.(5),mito(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9Y9	Nucleotide binding protein, putative	Low	5	1	25-47	GTPPTFKSRRGLPQKRRIRDVAK	mito(21),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAE3	WD repeat protein	Low	8.9	1	44-65	AVRTYRPSKRFKLSKHENSHIT	nucl(13.5),cyto_nucl(10),pero(6),cyto(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QG93	Peroxisomal membrane protein (Pex3), putative	Low	6.4	1	1-20	MIGATRRWFRRNRKSLAIGA	mito(14),nucl(4),extr(4),cyto(2),pero(2),cyto_pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLQ9	Heme O synthase	Low	8	1	104-131	GRSEQTQELPHRRRKRLKEEQSRGENAT	mito(13),plas(6),E.R.(4),extr(2)	RRRKR (115-119, prob:0.668)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPW5	Sodium P-type ATPase, putative	Low	8	1	247-267	AASMQGKKKHQKGTKNRSMSI	plas(17),E.R.(5),mito(2),cyto(2),cyto_mito(2)	KKKHQKG (253-259, prob:0.645)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTF6	Uncharacterized protein	Low	8.2	1	203-224	KNESRREKSKEHNNNDKQKTKL	plas(11),nucl(8),mito(4),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q335	Uncharacterized protein	Low	9.7	1	98-120	PILVHQRPQARRHPRRVDTRRAR	mito(18.5),cyto_mito(11),nucl(6)	RRHPRRVDTRRAR (108-120, prob:0.737)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3D7	Uncharacterized protein	Low	9.1	1	1-21	MAPKHPRKDRVLDLNKRVKIT	nucl(14.5),cyto_nucl(10),mito(6),cyto(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q640	Chalcone_isomerase domain-containing protein	Low	5	1	3-22	PPTACRQCLRQVRPRLLART	mito(27)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q918	Uncharacterized protein	Low	9.6	1	30-50	ASSLPKGKRLRPISKGRFYRA	nucl(17.5),cyto_nucl(13),cyto(7.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QCF3	Uncharacterized protein	Low	9.6	1	449-469	PGQTKKKKRDLEEVRKNQKRW	mito(13),cyto(7),cyto_nucl(7),nucl(5)	KKKKR (453-457, prob:0.707)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHH4	Carboxylic ester hydrolase	Low	5	1	53-75	TICVLARYKKKHTNYTRQLPTPD	plas(18),mito(3),vacu(2),cyto_mito(2),mito_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QM17	Valyl-tRNA synthetase	Low	8.6	1	46-73	KVKSEKELERERRKAEKAKKFAEKQAKA	cyto(17),cyto_nucl(10.333),cyto_mito(9.833),pero(5),nucl(2.5)	KVKSEKELERERRKAEKAKKFAEKQAKAAAAKPAQPKAEKKEK (46-88, prob:0.994)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTZ9	Protein-tyrosine-phosphatase	Low	7.5	1	450-476	PAPTPGQPRKSHRKDSRHHPYARNVSG	cyto(11.5),cyto_nucl(10.5),nucl(8.5),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUC1	WD-repeat protein, putative	Low	5	1	171-191	LEGNKRLKRKYERPPFESDRL	plas(15),mito(7),E.R.(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVN6	Calcium binding modulator protein (Alg2), putative	Low	8.5	1	25-47	LANAQTRPQQQRPPPPPKANSPG	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(3),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q214	Uncharacterized protein	Low	9.1	1	277-303	GVESSAKSKKSKRQSKKPPPKATDVDE	plas(12),E.R.(4),nucl(3),vacu(3),mito(2),cyto(2),cyto_mito(2)	KSKKSKRQSKKPPPK (283-297, prob:0.934)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q485	Trehalose synthase (Ccg-9), putative	Low	7.6	1	648-669	EQLTAHKKIKPKERWINDMARE	nucl(9.5),cyto_nucl(9),cyto(7.5),mito(5),pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6L8	Na+/H+ antiporter Nha1	Low	8.7	1	516-540	EGGRRSQSLRSKRRRKRMTNAGGPI	plas(18),cyto(4),nucl(2),pero(2),cyto_mito(2)	GRRSQSLRSKRRRKR (518-532, prob:0.926)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QH82	C6 finger domain protein, putative	Low	8	1	40-59	RTSVACVHCRRRKIRCLVAA	nucl(10),cyto_nucl(8.5),extr(6),cyto(5),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIV4	Zn(2)-C6 fungal-type domain-containing protein	Low	7.3	1	39-65	KFCAVDPTFKRTKRRQRLQQIEQELRE	mito(13),nucl(6),cyto(4),plas(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLT7	C6 transcription factor, putative	Low	8.8	1	1-33	METPRKRRRTKLACDPCRSRKRKCDGHLPCETC	plas(12),nucl(10),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QR48	DNA mismatch repair protein Msh5, putative	Low	8.6	1	1-20	MALSKRKRDPGPRNSLRASS	nucl(12.5),mito(9),cyto_nucl(9),cyto(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QS76	YeeE/YedE family integral membrane protein	Low	5	1	41-62	DPGLLFRGRRDKQKQNEPTEEV	plas(22),mito(2),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTF9	Alpha methylacyl-CoA racemase, putative	Low	5.7	1	43-71	IDPPAKKTTPTKNNNTTPQKQKRWIDSLC	extr(10),cyto(5),mito(3),plas(3),nucl(2),pero(2),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVK3	Aldolase, putative (Fragment)	Low	5	1	14-33	TSTAPKPTKTPERPLRHIPW	cyto(11),mito(7),pero(4),mito_nucl(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1V6	HhH-GPD family base excision DNA repair protein	Low	6.4	1	22-43	SATKKSTKSTSSKDKTHKSASS	mito(18),cyto_mito(11.833),nucl(5.5),cyto_nucl(5.166)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2X4	RHOMBOID-like protein	Low	8	1	118-142	PMDPVMGSRKKRRRTQKGGFFGKQT	plas(25)	RKKRRRT (126-132, prob:0.81)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3U8	UPF0132 domain protein	Low	5.7	1	25-46	DPTSRTKSPSQNQYNNNNNRQH	plas(20),nucl(2),mito(2),E.R.(2),mito_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3Z4	C6 transcription factor, putative	Low	8.2	1	28-47	AERRKITRACDSCKVKKTRC	nucl(9),cyto(5),plas(4),cyto_mito(4),mito(3),cyto_pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6T1	DNA helicase recq, putative	Low	5	1	139-159	EQQKQACRRVPCQRIFPRKTG	mito(7),plas(6),cyto_mito(6),cyto(5),mito_nucl(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGD0	Membrane-spanning ATPase, putative	Low	9.6	1	66-93	DDDSPGRSGSRRRRKQKKEELVLNQYEQ	mito(12),cyto(10),nucl(5),cyto_pero(5)	RSGSRRRRKQKK (72-83, prob:0.901)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLU6	Uncharacterized protein	Low	9.7	1	53-83	QQDIQRRKTQRTSNSKRHSHRRNRVNPDVID	nucl(18.5),cyto_nucl(14),cyto(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNJ2	Integral membrane channel protein, putative	Low	5	1	2-22	LASLLRPRKSRQPVLRSVSPH	plas(24),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQP5	Mannose-1-phosphate guanylyltransferase	Low	5.8	1	21-44	YTSNSHRESHPRRQNPSSNKKLES	mito(24),nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTJ7	Cystathionine gamma-synthase, putative	Low	8	1	176-199	KQPFYSKGPKRYQQRTPTPKEHEH	cyto_nucl(12.833),nucl(12.5),cyto(10),cyto_mito(6.499)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTT3	Uncharacterized protein	Low	9.6	1	306-327	DPASGHKMKHSRLKNRDQYTST	nucl(19.5),cyto_nucl(15),cyto(7.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QW11	Uncharacterized protein	Low	9.8	1	314-338	LEVFCKPRALRNKRRAIYNTRARSR	nucl(19.5),cyto_nucl(14.5),cyto(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q389	NAD-specific glutamate dehydrogenase	Low	7.8	1	1103-1127	PSLISCPKNSHRNCLRRNNHFTTCF	cyto_nucl(14.333),nucl(12.5),cyto(11),cyto_mito(6.665)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q564	Uncharacterized protein	Low	7.4	1	4-23	GSSKWPSRHRDPPLASPPRF	mito(11.5),mito_nucl(10.5),nucl(8.5),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8B3	Phosphotransferase	Low	9.1	1	130-151	SERSRDTIRKAQRQRVRRTLEK	nucl(15),cyto_nucl(13),cyto(9)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QA40	Uncharacterized protein	Low	9.1	1	5-27	ISIRSVKKDGKQDKSSNRHRFSM	nucl(15),cyto_nucl(12),cyto(7),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QD02	Beta-N-acetylglucosaminidase, putative	Low	7.4	1	839-860	EYIPALHKKDKEKEKPVNDSIS	cysk(9),nucl(8),cyto(8),cyto_nucl(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QE74	DNA mismatch repair protein Msh4, putative	Low	9.9	1	5-30	LTTNDNSPSRRRARPRFSQRLCTDTR	nucl(17),mito(9),cyto_nucl(9)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QG80	Uncharacterized protein	Low	9.1	1	16-37	QPTTTTKPTPQQQQQRRITSRN	nucl(15.5),cyto_nucl(12),cyto(5.5),pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIA8	Hsp90 chaperone protein kinase-targeting subunit	Low	8.7	1	25-48	VDKRSFIRAKQNQIHQQRMQRRHE	nucl(16),cyto_nucl(13.333),cyto(8.5),cyto_pero(5.666)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQ84	Xanthine dehydrogenase	Low	6	1	261-280	LAVGNKKKRWYRPVTLQQLL	cyto(21),cyto_nucl(13.5),nucl(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QST0	Uncharacterized protein	Low	6.7	1	74-94	CDGMLERKERRRTQRHCCTMV	cyto_nucl(7.5),cysk(7),cyto(6.5),nucl(5.5),mito(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QT19	Rho GTPase Rac, putative	Low	6.2	1	179-199	IRAVLNPRPQPKNKAKRCTIL	cyto(12.5),cyto_mito(10.5),mito(7.5),nucl(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVR0	Uncharacterized protein	Low	5	1	362-382	LGFLWWKRRTGRQQDVKFAPI	extr(11),mito(5),golg(5),cyto(3),mito_nucl(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6E7	Zn(2)-C6 fungal-type domain-containing protein	Low	7.3	1	375-400	IKKRNRKPVSCDPCRQRKQRCDQALP	plas(15),nucl(7),mito(4),cyto_nucl(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6W8	N-acetyltransferase complex ARD1 subunit, putative	Low	9.3	1	206-227	DLGAKEKEKEKKIRVKVGRGLG	cyto(13),cyto_nucl(9.833),cyto_mito(9.333),nucl(5.5),mito(4.5)	EKEKEKKIRVK (211-221, prob:0.749)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7F3	Acetamidase, putative	Low	5	1	5-29	FDYFQYIKIRNTKRREREARFSSLS	mito(21),cyto(5),cyto_nucl(3.333),cyto_pero(3.333)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFP2	Uncharacterized protein	Low	5	1	51-74	SILHLHKQQKQRTQDQKLRLNNLQ	extr(23),golg(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLZ6	Pantothenate transporter, putative	Low	5	1	473-498	VFVIRWFVQRDKRRAREQQQQQQEEE	plas(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QN51	Reverse transcriptase, putative	Low	5	1	32-56	LRCIYTYWRNQARSRRRAGRMVPGL	mito(22),cyto_mito(13.5),cyto(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTQ3	rRNA processing protein Bystin, putative	Low	6.1	1	24-50	STSQVRTTTKSGKKRSHKSANDDDDDD	mito(13),cyto(9.5),cyto_nucl(7),nucl(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2Y8	Uncharacterized protein	Low	9.2	1	149-172	VKPNTASKQPNRKRYEYRNFRAKF	nucl(15.5),mito_nucl(12.5),mito(8.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q461	Uncharacterized protein	Low	8.8	1	657-676	GIYPRKVKVKEHRVNPNAPN	nucl(13.5),cyto_nucl(11),cyto(7.5),mito(2),plas(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QCI9	Serine/threonine-protein phosphatase 2A activator	Low	8.8	1	20-39	AELRASKSRRSPPTARQQQD	nucl(14),cyto_nucl(11.5),cyto(7),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHW0	ER to Golgi transport protein (Sly41), putative	Low	8.7	1	77-96	GWDHHKPASKHRPRKSISET	plas(22),nucl(2),mito(2),mito_nucl(2)	KHRP (86-89, prob:0.616)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQ14	Vacuolar protein sorting-associated protein Vps5, putative	Low	8.5	1	42-63	PQSPVRRGPRTSRKVNAQVTKL	nucl(15),cyto_nucl(11.833),mito_nucl(8.333),cyto(7.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1G6	Beta-glucosidase, putative	Low	8	1	74-108	VMAPLNRRSSSNRKRQRSRRRPPTNSKFRRWLTLL	plas(9),cyto(6),mito(3),extr(3),golg(3),cyto_pero(3)	RSSSNRKRQRSRRRPPTNSKFRR (81-103, prob:0.958)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4E3	Stromal membrane-associated protein	Low	8.3	1	23-46	LESNKTCADCKRNKHPRWASWNLG	nucl(11),cyto_nucl(8.5),mito(6),cyto(4),extr(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBZ9	Oxidoreductase, putative	Low	9.4	1	1-30	MRFRDIKDSKQKERKKERKKMFGMFRRIYE	mito(14),cyto_nucl(5),nucl(4.5),cyto(4.5),pero(4)	SKQKERKKERKK (9-20, prob:0.921)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QCB2	Integral membrane protein, Mpv17/PMP22 family, putative	Low	6.1	1	20-47	LSSLRSRRTTNGNKSQRRQNSNNSTEKN	mito(18),cyto(4.5),cyto_nucl(4.5),nucl(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QK26	Beta-1,6 glucan synthetase (Kre6), putative	Low	6.7	1	91-114	ELLFPPPRKVRRSRESPERSKSPS	plas(12),nucl(5),golg(4),E.R.(2),cyto_mito(1),vacu(1),pero(1),cyto(1),mito(1),cyto_pero(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKZ4	Tryptophanyl-tRNA synthetase	Low	9.2	1	417-447	FMTPRKLEWKGNPNPKPKEAKKDKEPKSEKK	cyto(15),pero(4),cysk(4),nucl(3)	KLEWKGNPNPKPKEAKKDKEPKSEKK (422-447, prob:0.983)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLE7	Uncharacterized protein	Low	7	2	87-108, 120-143	IVFFFRRKKKWDEKIKRYETIN, QQAMSNRQQRQRRQRQQERDAEQG	extr(23),plas(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTP5	3-oxoacyl-[acyl-carrier-protein] reductase	Low	5	1	1644-1663	QSYRNKVEARQKKAYRYFHN	cyto(16),cyto_nucl(9.5),pero(4),cysk(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVL3	Uncharacterized protein	Low	8.8	1	236-264	QVRYHPWDQKSPPRQPRRRLSQEELQPQL	nucl(13),cyto_nucl(9.5),mito(8),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3W7	Transcription factor TFIIIC complex subunit Tfc6, putative	Low	9.1	2	1-20, 35-60	MPPRRSTRRATTRKSYTEDV, IEKPSSSKEAKDKSRKRLRDESDDEF	mito(12),nucl(7),cyto(7),cyto_nucl(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6G2	Uncharacterized protein	Low	5	1	31-54	LTLTLKRVNRVKRPLNNPTQHTRC	extr(14),mito(6),cyto(4.5),cyto_nucl(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7I4	Aureobasidin resistance protein Aur1	Low	8	1	26-57	TMPWRSFKLLMPHRMRRRLRSKLRSRISPATS	plas(23),mito(3)	RMRRRLRSKLR (39-49, prob:0.741)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QB31	Uncharacterized protein	Low	8.5	2	40-62, 242-261	QTTQPGKKDRKVLNKRLQWQIDN, WVERPSTKRNPTSKNVRFAT	mito(20),nucl(4),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDB3	NupC family nucleoside cotransporter	Low	5	1	64-83	QHPSRPWLRRILKHWRHPLY	plas(27)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QF93	Mst3-like protein kinase, putative	Low	8.1	1	527-547	AQNNPHLKSHRRRQSEQIQIE	nucl(11.5),cyto_nucl(11),cyto(9.5),pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHM5	Serine/threonine-protein phosphatase	Low	8.8	1	482-506	DSSALKNHIKKGRNKRNSMLNSPPA	nucl(10),cyto(4),mito(3),plas(3),golg(3),cyto_pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLP4	Uncharacterized protein	Low	6.5	1	1-24	MFTSSRRAHPWKRITRTTQCCLYS	mito(22),nucl(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLS0	4-hydroxybenzoate octaprenyltransferase, putative	Low	5	1	93-113	DYEFDRRVRRRQSRPVARWAL	plas(21),E.R.(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQY6	Patatin-like serine hydrolase, putative	Low	5	1	528-553	IELDRCYQTVRRRRRRSDVSQQPAVV	cyto(8.5),plas(6),extr(5),cyto_nucl(5),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q559	Uncharacterized protein	Low	7.1	1	575-596	GLQMRKVHRIRQKKTSNLKILC	plas(11),nucl(6),E.R.(3),mito_nucl(3),cyto(2),extr(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q852	Ima1_N domain-containing protein	Low	5.4	1	153-174	MERSKMSRAVQKARRRNWRSIL	plas(14),mito(8),cyto(2),nucl(1),pero(1),E.R.(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBH2	C6 transcription factor, putative	Low	9.4	2	22-42, 64-84	QRVSRACLFCRQRKSRCDLDS, GTSNRGGRRIRKNKGVANPTS	mito(16),nucl(7),cyto(2),pero(2),cyto_pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QD20	Nonsense-mediated mRNA decay protein (Nmd5), putative	Low	7.9	1	251-270	ESNHWWKCKKWAYGNLNRLF	nucl(8),plas(8),mito(4),cyto(4),cyto_mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMP9	Mitotic check point protein (Bub2), putative	Low	6.6	1	19-41	VPPASPQSPRKLRKFQSHQSLTS	mito(16),cyto(5),nucl(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQJ1	TPR domain protein	Low	7	1	1-22	MGKSRTKNKKNSTKSEKSVLHS	mito(15.5),cyto_mito(10.166),nucl(8),cyto_nucl(6.833)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QS72	Galactose-1-phosphate uridylyltransferase	Low	7.8	1	23-43	LVSPHRTKRPWQGQQESPSKT	mito(9.5),nucl(9),cyto_mito(8),cyto(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1G8	Isocitrate lyase	Low	5	1	2-21	IRNVTRRLPRRPFRPAIVTS	mito(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2D2	Decapping enzyme Dcp1, putative	Low	8.9	1	1-20	MTPRKGRGGRANNHNHNQDN	nucl(15.5),cyto_nucl(10.333),cyto(4),cyto_mito(3.833),mito(2.5),plas(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAA6	Mismatch-specific thymine-DNA glycosylase, putative	Low	9.2	1	97-118	QEQSRSPIRKRNPRTSKPATTT	nucl(16),cyto_nucl(13.5),cyto(9)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDL4	NACHT domain-containing protein	Low	5.8	1	185-205	DCGHCDKKQFIHRPLRQNRTP	plas(10),mito(5),golg(3),nucl(2),extr(2),pero(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHE2	Uncharacterized protein	Low	5	1	399-420	RFLDMGRKLRDRKRANRLFDTV	cysk(14),cyto(10.5),cyto_nucl(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJT5	Ribose-phosphate diphosphokinase	Low	6.8	1	88-110	VMPYFPYSRQSKKKSHRGAITAR	cyto(11.5),cyto_nucl(9.5),mito(8),nucl(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNT7	Zn(2)-C6 fungal-type domain-containing protein	Low	7.9	1	6-26	HTKSRNGCIVCKRRHVKCDES	nucl(9),mito(6.5),cyto_mito(6.5),cyto(5.5),plas(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQJ4	tRNA (guanine-N(7)-)-methyltransferase	Low	9.9	1	23-44	NTIDLPKKRFYRQRAHANPFSD	nucl(17),cyto_nucl(10.5),mito(5),cyto(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSI4	Oligo-1,6-glucosidase	Low	8.5	1	419-440	ALSNYRKEYQKKSRDNARTPVQ	nucl(11),cyto(5.5),cyto_pero(5.5),mito(5),pero(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTX3	DDE_Tnp_1_7 domain-containing protein	Low	8.4	1	398-419	DDYIERTRRRPQKTSTNGPLVH	nucl(12),cyto_nucl(11.5),cyto(9),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q404	Uncharacterized protein	Low	9.9	1	20-40	QSGSTRRVTKKRKIEGPDTIQ	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QC31	C6 transcription factor, putative	Low	9.8	2	4-32, 60-82	LLRSTKGCWTCRLRRKKCDERHPVCQLCH, SLKQTVRYTSRQRDRARSQQLRS	plas(15),nucl(7),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDT4	Cytochrome P450 alkane hydroxylase, putative	Low	5	1	22-50	IRYISVARFKRRHGCKPAKQLPQREKIIG	mito(6),cyto(5),extr(5),plas(4),mito_nucl(4),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGE6	Mitochondrial 18 kDa protein	Low	8.7	1	23-44	RPESPKSQIPRQKLSRNLQKLV	nucl(14),cyto_nucl(12),cyto(8),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGP1	tRNA-specific adenosine deaminase subunit TAD2, putative	Low	9.8	1	168-188	NENAPNPKPKRNRELNTEFSS	nucl(19),cyto_nucl(14),cyto(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QH54	tRNA (uracil-O(2)-)-methyltransferase	Low	7	1	557-580	ALSGARYRYRPPKKEKSATNTTRE	mito(8),cyto_nucl(7),nucl(6.5),cyto(6.5),extr(2),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QI75	Uncharacterized protein	Low	9.8	1	10-33	HDQTSKTTTSKPKRITNPLRILIL	nucl(16.5),cyto_nucl(10),mito(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSR2	Serine protein kinase, putative	Low	7.7	1	760-779	LEQLTRRKRHHSLRNITVAD	cyto(9.5),nucl(9),cyto_pero(7.5),pero(4.5),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2B9	DUF2439 domain-containing protein	Low	9.6	1	26-47	IKFRCLYTHDVRRKAKRWQDGY	nucl(18),cyto_nucl(12.5),cyto(5),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9E7	Uncharacterized protein	Low	5	1	46-72	ENTHNPFKKIRVNRRRKQNATRDIEQG	plas(23),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9T2	Uncharacterized protein	Low	5	1	18-37	AYAPKRSQRTQSLHKFNTKQ	mito(22.5),cyto_mito(13),cyto(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAA7	Pogo transposable element, putative	Low	9.3	1	608-632	LATPSAPKRAKKQVSKQVKVKAQPE	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QE86	F-box domain protein	Low	9.7	1	817-840	SPLPIKATRKRKHLSQPAAFDRKL	nucl(16.5),cyto_nucl(11),cyto(4.5),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHI6	L-serine dehydratase, putative	Low	6.2	1	11-42	LQPLFSSKTKTKTPKKSVYKPRKPWIETPLIE	cyto(19.5),cyto_nucl(12.5),nucl(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJ79	Serine/threonine protein kinase, putative	Low	8.3	1	1124-1146	LASSTKISPQKQRHQQLQNGATQ	nucl(10),mito(5),cyto(5),plas(5),cyto_mito(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKP8	C2H2 transcription factor, putative	Low	5.7	1	3-34	LRKCEICDRKFKKTEHYKRHERSHTKERPYEC	plas(22),nucl(2),mito(1),cyto(1),pero(1),cyto_mito(1),cyto_pero(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QM15	Ribonuclease P complex subunit Pop2, putative	Low	9.6	1	274-301	AQEIEKPLSKREMKRRAKKARLEAHVQS	cyto(15),cyto_nucl(12.833),cyto_mito(10.499),nucl(7.5)	PLSKREMKRRAKKAR (280-294, prob:0.929)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSJ5	MFS transporter, putative	Low	8	1	278-302	PETFWDRTPRRKPKARRPGFVRSVS	plas(26)	PRRKPKARRPG (286-296, prob:0.896)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVU3	Uncharacterized protein	Low	8.3	1	100-124	WLCLNNQKRLKLRHRLRQLWKRASI	mito(11),nucl(9),cyto(4),pero(1),golg(1),cysk(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QA43	MFS transporter, putative	Low	5	1	465-488	NKKLDRMYGTKKERQARQKSGFVT	plas(27)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QF57	Vacuolar protein sorting-associated protein 54	Low	6.5	1	342-361	GGLKVVKLRQRRQNIRKLAD	mito(16),cyto(7),nucl(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QG53	C6 finger domain protein, putative	Low	8.4	1	62-82	CENCRLKKTRCDESRPKCGLC	nucl(10),plas(6),mito(3.5),cyto_mito(3.5),cyto(2.5),E.R.(2),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHT9	AMP-binding enzyme, putative	Low	5	1	669-688	LTPTLKMKRPPIVKKFRVLI	cyto(11),mito(8),cyto_pero(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHU2	Ankyrin repeat-containing protein, putative	Low	9.1	1	241-267	KVFILIKDPKTRQRRRRYLSSYFPPSD	nucl(11),cyto(10),mito(3),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIC8	Glutamate synthase Glt1, putative	Low	5	1	1614-1639	DKTRGFMKYHRRSEKYRNPTTRTRDW	cyto(17.5),cyto_nucl(10),pero(4),cysk(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKM6	Uncharacterized protein	Low	5	1	372-397	PMTPSRLVTKRDRKRLEKSNGLKVLH	extr(10),plas(5),mito(4),cyto(3),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSH7	Uncharacterized protein	Low	8.3	1	198-219	SSGLKVKYNKPVHSRDKWKEEV	nucl(9),golg(6),mito(4),E.R.(4),cyto(1),plas(1),cysk(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSI6	Phosphatidylinositol:UDP-GlcNAc transferase PIG-C	Low	8.4	1	87-119	GTEPRKNEFRKSRDGRRKKRKGVWKKLLWVRQS	plas(23),nucl(1),cyto(1),cyto_nucl(1),E.R.(1),golg(1)	PRKNEFRKSRDGRRKKRKGVWKK (90-112, prob:0.995)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QU96	Uncharacterized protein	Low	5	1	25-48	FLVRSLRFRRARKIESKFNGRPLS	cyto(8.5),E.R.(6),plas(5),cyto_nucl(5),mito(3),extr(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUP1	Methionyl-tRNA synthetase	Low	9.1	1	619-648	EKAAAKKLAKEKEKEKKRLKKEAAAKEAAA	cyto(18),cyto_mito(10.5),nucl(4),pero(4)	KALEAEKAAAKKLAKEKEKEKKRLKKEAAAKEAAAKK (614-650, prob:0.998)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QWH3	Oxidoreductase, 2OG-Fe(II) oxygenase family, putative	Low	6.9	1	337-357	TSGTWIRKKFKALRGRKDAGN	cyto_nucl(11.666),cyto(10.5),nucl(9.5),cyto_mito(7.332),cyto_pero(7.332),mito(2.5),pero(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5L7	ABC bile acid transporter, putative	Low	5	1	41-63	IAIHSHFRHKKTKPRLYEDEDGV	plas(19),mito(3),vacu(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5N1	Uncharacterized protein	Low	6.4	1	1-21	MAKATKRTGKGRQPSSKSAVK	plas(10),mito(9),nucl(4),cyto(1),pero(1),E.R.(1),golg(1),cyto_pero(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7A8	Uncharacterized protein	Low	7.5	1	457-481	IMLGWWYYRKKEKKIEENARLQEER	cyto_nucl(11.833),nucl(10.5),cyto(9),mito_nucl(7.832),mito(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8K0	DNA replication licensing factor MCM7	Low	8.8	1	646-669	MVGAYVRMRRQQKKDEGSKRQFSH	nucl(14.5),cyto_nucl(13),cyto(10.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGF3	Ankyrin repeat-containing protein, putative	Low	6.3	1	83-102	LSSPPQKKRRSGPAPGERTC	cyto(9.5),cyto_nucl(7.5),mito(5),nucl(4.5),vacu(2),golg(2),extr(1),pero(1),E.R.(1),cysk(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGN0	Calcium permease family membrane transporter	Low	5	1	89-109	IERTRKPSTLRRMSSKPYRGQ	plas(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGR3	Cation-transporting ATPase	Low	5	1	1282-1307	GRTIALVRPKQEKNRRQYKVLLERMR	plas(21),E.R.(3),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHN2	MYND-type zinc finger protein samB	Low	9.8	1	41-62	FYCSRDCQKSHWKTHKKVCASN	nucl(14),cyto(5),pero(5),cyto_pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIB5	Uncharacterized protein	Low	6.1	1	766-790	GELYSVKRWNRTLRQKNPFRFSRIL	mito(17.5),cyto_mito(11),nucl(4),cyto(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJA7	Uncharacterized protein	Low	8.8	1	38-63	AYLKRREQVRKAQRTHRERKDQYLKT	nucl(12.5),mito(12),cyto_nucl(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJP1	Transcription factor Tos4, putative	Low	8.5	1	499-524	VVNDLRKPGLRNCRKQHKQYYWRKPK	nucl(12.5),mito(10),cyto_nucl(9),cyto(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVE7	PH domain-containing protein	Low	8.1	1	90-111	PADVSKQKRKSLQPSKRASMFG	nucl(11.5),cyto_nucl(11),cyto(9.5),mito(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVX0	Uncharacterized protein	Low	8.2	1	496-517	LESPRMAKRKNMKIRLKDPLGG	nucl(11.5),cyto_nucl(11.5),cyto(10.5),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QW85	Integral membrane protein (Pth11), putative	Low	5	1	292-311	GVNLKSGSRRKQRSGSHPLD	plas(20),E.R.(3),mito(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1G7	mRNA-nucleus export ATPase (Elf1), putative	Low	9.1	1	1073-1107	EDTGELKFKARKKKKLTRAQMKERETRRRLRHIEW	cyto(15),cyto_nucl(10.5),mito(7),nucl(4)	KFKARKKKKLTRAQMKERETRRRLR (1079-1103, prob:0.983)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBP5	Cleavage and polyadenylation specifity factor, 73 kDa subunit, putative	Low	6.5	1	668-692	SSPASVKQSCKNKHHHHDHKEELDE	cyto(13),cyto_nucl(10),nucl(5),mito(4),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBV5	Uncharacterized protein	Low	5.3	1	312-331	VTLQDKWNERPRSNRQKDEE	plas(17),mito(6),nucl(1),cyto(1),cyto_nucl(1),pero(1),E.R.(1),cyto_pero(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QD74	Fungal_trans domain-containing protein	Low	5.6	1	31-53	QLPSRPPSPSKTRAKTNPAQHVT	plas(15),nucl(2),mito(2),cyto(2),cyto_nucl(2),E.R.(2),golg(2),cyto_mito(2),mito_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFM2	Plasma membrane ATPase	Low	5	1	10-32	DEQQSRTSRRMSRAERRMSRAVS	plas(25)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIF2	SPX domain protein	Low	9.6	1	136-161	FSGFLKAAKKHDRKRGARYRIRPLLQ	plas(14),mito(6),nucl(4.5),cyto_nucl(3.5)	AAKKHDRKRGARYR (142-155, prob:0.857)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNW2	Zn(2)-C6 fungal-type domain-containing protein	Low	8.8	1	12-46	CAECNRRKIKCDKVLPYRNCTRRGSSCYRNDQPNS	nucl(12.5),mito(10),cyto_nucl(8),cyto(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QR97	MFS domain-containing protein	Low	5	1	458-479	ASWFILRRRIAQKKKLREEGAT	plas(27)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QW25	FHA domain protein	Low	6.1	1	615-637	HTDNEEHRRKRVKQNQAYTFMKY	extr(9),cyto(8.5),cyto_nucl(6.5),nucl(3.5),pero(2),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q667	Uncharacterized protein	Low	8.9	1	354-374	FEGPKETRRIKRMKNEDIGNN	nucl(15),cyto_nucl(12),cyto(7),mito(2),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAJ8	Endo-chitosanase	Low	8.8	1	362-382	CDQCRSRKVKCDRQQPECSNC	extr(12),nucl(10),mito(2),plas(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHB2	Uncharacterized protein	Low	9.6	1	88-114	FQKPEVARRHSKQCAKKHNQPIPPAAR	nucl(13),plas(9),mito(2),cyto(2),cyto_mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJE4	Molybdopterin cofactor sulfurase, putative	Low	7.2	1	184-206	NMNGHRTPKQWAKRLRQKSYTTS	cyto_nucl(9),nucl(8),pero(8),cyto(6),mito(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMF4	Pentatricopeptide repeat protein	Low	5.9	1	752-775	PPDTSRRSRVRARRRLSTTPQSKE	mito(12.5),cyto_mito(10),cyto(6.5),nucl(3),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPU6	Zn(2)-C6 fungal-type domain-containing protein	Low	7.9	1	39-66	HTSYCRKAIGRVRSRKRACQACTKAKAR	nucl(8),cyto(6),mito_nucl(6),mito(4),cyto_pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQX5	Actin cortical patch protein Sur7, putative	Low	5	1	231-250	ASRRSSTKSHGSTRSKREDE	plas(18),mito(4),extr(2),vacu(2),cyto_mito(2),mito_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTS2	Alkaline protease 1	Low	8.5	1	272-292	VKNLCEPIKKRKQFDRIKLRV	nucl(13),cyto_nucl(12),cyto(9),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVK9	Uncharacterized protein	Low	6.8	1	745-766	NEVNMVQKKSFKKPTRESIAGP	cyto(13.5),cyto_nucl(11.833),cyto_mito(8.166),nucl(8),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q726	Zn(2)-C6 fungal-type domain-containing protein	Low	6.7	1	2-30	VGVPGKSKGCKTCRKRKIACDLQRPVCAN	mito(10),plas(7),cyto_mito(7),nucl(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q833	Uncharacterized protein	Low	9.2	1	13-42	KCTRVFSKVEHLRRHQRSHTGERPHKCKTC	plas(13),nucl(11),cyto(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9K8	Zn(2)-C6 fungal-type domain-containing protein	Low	6.5	1	14-42	LLNLIPTCQRCHRQRRKCDTQLPACRLCQ	plas(9),nucl(4.5),cyto_nucl(4.5),cyto(3.5),E.R.(3),mito(2),cysk(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QB62	Uncharacterized protein	Low	5	1	578-599	KGWCMLSKKRAKRSKVCPWNAS	plas(23),mito(1),cyto(1),golg(1),vacu(1),cyto_mito(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGG6	Uncharacterized protein	Low	8.2	1	382-407	LVDDSIRRRWHNKRQVRLNMGHRRAS	nucl(11.5),cyto_nucl(8.5),cyto(4.5),mito(4),golg(3),plas(1),pero(1),E.R.(1),cysk(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QK55	Histone acetyltransferase type B catalytic subunit	Low	8.3	1	314-334	NPNPYPKETAKRRPRNMPTSS	nucl(11),cyto(11),cyto_nucl(11)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QL82	Uncharacterized protein	Low	8	1	168-192	KETVVRRRSHSSRRGHHRSRSGSSS	plas(18),mito(5),E.R.(2)	RRSHSSRRGHHRSR (174-187, prob:0.71)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPH1	Zn(2)-C6 fungal-type domain-containing protein	Low	9.8	1	22-63	GERSQPAMPRRVRPKNASRACNECQKRKIKCIGSNPCKNCHE	nucl(15.5),mito_nucl(9),cyto(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUE8	Uncharacterized protein	Low	9.3	1	31-59	EDPLSDHNSNRKRTRRRWFENTKPERDLI	nucl(16.5),cyto_nucl(13),cyto(8.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7H6	GTPase activating protein Sar1, putative	Low	8.2	1	662-686	HNVRSQSEGKSRKQQKNQELGPYKF	nucl(12.5),mito_nucl(12),mito(10.5),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7I8	AMPK1_CBM domain-containing protein	Low	9.2	1	398-424	GAVAQDNPKEKKKKNRASGFFQRLKEK	cyto(17.5),cyto_nucl(11.833),nucl(5),mito_nucl(4.333),mito(2.5)	KEKKKKNRASGFFQRLKEKLR (406-426, prob:0.901)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q956	DUF788 domain protein	Low	5	1	154-173	GGASKRQQKLEKRGGRVQYR	mito(16),plas(4),extr(3),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBB5	CDP-diacylglycerol synthase	Low	8.5	1	492-515	WTYVAEKRKKHLNSKKNDQKEESE	mito(15),nucl(9),cyto(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QCU4	Uncharacterized protein	Low	9.4	1	118-143	LPDTQPRISGRNRKRTRREDDQFLHY	nucl(17),cyto_nucl(13.5),mito(4),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QG18	Uncharacterized protein	Low	5	1	10-32	MNRHPVIQGNRSRRRPKICVFCG	mito(22),cyto(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJ61	C6 finger domain protein, putative	Low	9.4	1	2-42	TNKVSRTRTGDLKQRRSRRGCRNCKLRKVKCDELRPHCQGC	nucl(11),mito(6),plas(5),cyto(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJU7	Uncharacterized protein	Low	6	1	140-162	DAYMEARKKDKQRRWHHVYPVMS	cyto(13.5),cyto_nucl(9),cysk(5),mito(4),nucl(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSY4	Uncharacterized protein	Low	9.4	1	54-78	HGQTHPYQGGKKRRRAKRVVLVSFL	mito(12),cyto(6.5),cyto_nucl(6),nucl(4.5),plas(2),pero(2)	GKKRRRAKR (63-71, prob:0.855)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QWE9	Uncharacterized protein	Low	9.3	1	258-277	PTSTKKRKTEDLQPPKPQNN	nucl(15.5),cyto_nucl(10),mito(7),cyto(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2Q4	Protein-lysine N-methyltransferase EFM6	Low	8.5	1	209-233	PDTICYFCFKRRRRADLRCIKMVKK	nucl(13.5),cyto_nucl(12),cyto(9.5),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q869	Uncharacterized protein	Low	9.7	1	454-479	APAIHSTQRCKSPKRRNVFRFLHNLV	nucl(18.5),cyto_nucl(14),cyto(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8J2	Uncharacterized protein	Low	9	1	70-90	TLPEPFRKWREEKKQPAHSSL	nucl(19),mito_nucl(12.333),cyto_nucl(11.333),mito(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QD98	RanBP1 domain protein	Low	9.6	1	3-25	RFSPHHSRIKELNKRRVKPTSST	nucl(16),cyto_nucl(10),mito(9)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGS1	Transcription elongation factor 1 homolog	Low	8	1	1-22	MGKRKKSSRGPQGPKKREPLAT	mito(13.5),cyto_mito(12.5),cyto(10.5)	KRKKSSRGPQGPKKR (3-17, prob:0.892)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKN5	Dedicator of cytokinesis domain protein, putative	Low	8.1	1	1980-2005	QVDQQRRDRSRDRSRARSATNKSTKS	mito(14),nucl(8),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QL12	Uncharacterized protein	Low	7.7	1	510-536	TSISTPSTAPRPRKRIRIQESLPERWR	mito(10),nucl(8.5),cyto_nucl(7),cyto(4.5),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQM9	Nuclear pore complex protein	Low	7.2	1	848-873	LRSPTKSPSKTSRFRRPQTEDERQQS	mito(9),nucl(6),cyto(5),pero(2),golg(2),plas(1),E.R.(1),cysk(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QS40	DUF1339 domain protein	Low	6.4	1	1020-1044	AVPSSLSPRRTQHRRRKGSDMSSIA	cyto(10.5),cyto_nucl(8),mito(5),nucl(4.5),extr(3),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QS81	Tyrosine--tRNA ligase	Low	5	1	615-636	MPETPFKLRKFHNNNPPDRTSK	mito(21.5),cyto_mito(13),cyto(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2A5	Integrase catalytic domain-containing protein	Low	9.3	1	418-441	EAYYTDRRYHRRQSRSPYRGRSLY	nucl(15.5),cyto_nucl(11),cyto(5.5),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7J2	Fe2OG dioxygenase domain-containing protein	Low	8.2	1	1-24	MPAQKPSKKKPTSTTTKPEPTPRA	nucl(14.5),cyto_nucl(10.833),cyto_mito(6.833),mito(6.5),cyto(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAG9	RNA helicase	Low	5	1	36-58	LLERANPKSKPTTRKHSGRFADG	mito(19.5),cyto_mito(12.5),cyto(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDQ1	Alpha-1,3-glucosyltransferase	Low	5	1	1-25	MAPSPTSYRPRQKKKLPTTFSGTNN	plas(20),E.R.(3),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEN6	Uncharacterized protein	Low	5	1	13-34	RTSSSLRHRSERARPRHQASSP	plas(22),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGL0	Uncharacterized protein	Low	7.4	1	17-43	RANTKRMRAHVTRKNFEKRRERLEDAR	mito(15),nucl(6),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPQ3	Zn(2)-C6 fungal-type domain-containing protein	Low	5.7	1	10-41	ALVGRPCLTCQRRKIKCDRVKPDCQRCQKAGL	mito(22),nucl(2),cyto(2),cyto_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QRS7	Uncharacterized protein	Low	5.4	1	343-363	RSDDRQTRQTRDSRRSQSQRG	extr(17),plas(7),nucl(1),E.R.(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTE1	Ubiquinone biosynthesis protein coq4, mitochondrial	Low	5	1	263-283	LREIRRMMRQQEKRAKEQQAQ	mito(20.5),cyto_mito(13.5),cyto(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2B6	Uncharacterized protein	Low	8	1	44-63	GRALKDVKRRSRKHAFRLSS	extr(12),mito(7),cyto(6)	KRRSRK (51-56, prob:0.686)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5M1	Uncharacterized protein	Low	9.8	1	1-26	MNSCLNSPHQRRRMRRQSREVNEILP	nucl(16.5),cyto_nucl(10.5),mito(4),cyto(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6H6	PXA domain protein	Low	8.1	1	31-51	FQQPSRTKSRTENRRNIPDTE	nucl(10.5),mito(10),cyto_nucl(9),cyto(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6W6	Protein kinase family protein	Low	5	1	723-744	AAQSKAKTKKPLPKGLNSTKAS	cyto(11),extr(8),cyto_mito(7.833),cyto_nucl(6.833),mito(3.5),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8F4	Alpha-1,2-mannosidase family protein	Low	5	1	601-621	AAKYLNRSRNWRNHWNPRATS	extr(24),mito(1),cyto(1),plas(1),cyto_mito(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDD7	DUF833 domain protein	Low	9	2	8-28, 124-150	LDLLHIHKKSRKRNMCIAIIS, GNDPNEKQRNNNKKKNNNNNEPRKAQR	mito(13),nucl(6.5),cyto_nucl(5.5),pero(4),cyto(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDH4	Uncharacterized protein	Low	8.1	2	20-53, 593-617	VERCFRLKKDCKPSSSVRKKRATPRQSSQTARLE, QETQQQERRKRSVQQPQPQQQQQQQ	mito(12),cyto(7),nucl(3),plas(2),extr(1),pero(1),E.R.(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEB4	Probable endonuclease LCL3	Low	6.3	1	714-733	DNEWYRAKIRRNDREKKTAE	cyto(20),cyto_nucl(13.833),nucl(5.5),mito_nucl(3.666)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNA5	Uncharacterized protein	Low	9.8	1	8-33	LKELNNAKNKSKKKGRHQHADPETAD	cyto_nucl(7.5),mito(7),cyto(7),nucl(6),pero(5)	NAKNKSKKKGR (13-23, prob:0.855)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QRM7	54S ribosomal protein L4, mitochondrial	Low	9.1	1	213-240	KKAQLTAKSKKEAKRKARAEKRNAQAAP	mito(18.5),cyto_mito(11.5),nucl(4),cyto(3.5)	TAKSKKEAKRKARAEKR (218-234, prob:0.974)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUX8	Membrane associated DnaJ chaperone, putative	Low	5	1	32-56	AGDPRPQPGSPRFNKHRRRIFISVV	cyto(7),plas(7),mito(5),extr(3),mito_nucl(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QW35	Translation factor guf1, mitochondrial	Low	8	1	624-648	AADIGRKRKLLEKQKEGRKRLNAVG	mito(20),cyto(5)	IGRKRKLLEKQKEGRKR (627-643, prob:0.882)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QWJ0	DDE-1 domain-containing protein	Low	7.2	1	32-53	SRNPDLKCKFARRLSRKRALCE	mito_nucl(8.666),nucl(8.5),mito(8.5),cyto_nucl(6.833),cyto_mito(6.833)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4W3	Polysaccharide export protein (CAP59), putative	Low	5	1	369-391	FSTPFFWKRAIRRRVERWQEESN	extr(12),golg(5),mito(3),plas(3),E.R.(2),cyto_mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5X2	Uncharacterized protein	Low	5	1	275-297	GPMCEIPSRKRRRVEGVRCKGDV	plas(24),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q649	AP-1 complex subunit gamma	Low	5	1	606-630	GEPTNKRQSRMLKDKSKKSVKQSED	mito(21),cyto(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8V2	L-ornithine N(5)-monooxygenase	Low	6.6	1	38-57	ENANHRKHYKPPRICFLEKQ	cyto(9.5),cyto_nucl(9),nucl(5.5),E.R.(5),extr(3),plas(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8Y6	BRCT domain-containing protein	Low	9.2	1	1-27	MPTPTPNTSQNKKQQQQPQPRNQHIFD	nucl(16),cyto_nucl(11.5),mito(6),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHK4	Uncharacterized protein	Low	9.3	1	370-391	GNGNRISKRKSVRNFFSRSGRV	nucl(16),cyto_nucl(13),cyto(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLZ9	Pre-mRNA splicing helicase, putative	Low	7.8	1	81-104	ADVLDREQRKRKRGEQDQLRGAGI	cyto_nucl(12),nucl(11),cyto(11),mito(1),plas(1),pero(1),E.R.(1),cysk(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPB8	Lon protease homolog, mitochondrial	Low	5	1	1089-1116	AANNVWKKQLTKQSKYKKRKEEYDDDDD	mito(18.5),cyto_mito(14),cyto(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QR53	Uncharacterized protein	Low	5.7	1	173-192	SSMSKTTRYRDPNQWSRPRD	plas(11),mito(4),cyto(3),mito_nucl(3),nucl(2),pero(2),E.R.(2),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QRP9	ANK_REP_REGION domain-containing protein	Low	7.9	1	8-29	EANMNKKQSLKAQKERRDFLDW	nucl(9.5),cyto_nucl(9),cyto(7.5),pero(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QU30	Integrase catalytic domain-containing protein	Low	8.5	1	426-448	FTDRRYNTRQPSRSPHRNRSSYA	nucl(12.5),cyto_nucl(9),pero(6),cyto(4.5),mito(1),extr(1),golg(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1L7	Uncharacterized protein	Low	8.8	1	331-361	YQRAKKNKFTIDKYTQKRKQLYQNLLNAKKD	nucl(12),cyto(10),pero(5),cyto_mito(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4L0	Glycerol-3-phosphate O-acyltransferase, putative	Low	5	1	635-656	EPQTPNRSRSRSRSSGRRLSDS	plas(18),E.R.(5),mito(2),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9Y2	FAD-dependent oxidase, putative	Low	5	1	448-471	LVEKYGKRKLPRLLDLKKKWDPKG	extr(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QB45	Uncharacterized protein	Low	9.7	1	402-424	EVTPSKRSSLHRRSKGQKHDDKT	nucl(22),mito_nucl(12.833),cyto_nucl(12.333)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLX4	Allantoate permease, putative	Low	5	1	461-482	LMWLNKRQEKKRVANGKPAKMV	plas(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QM46	Uncharacterized protein	Low	8.1	1	457-479	RGRFRNFTKAKHERVRKPIWLKH	nucl(10.5),cyto_nucl(10),cyto(8.5),mito(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMA8	Uncharacterized protein	Low	8.8	1	507-531	WTAEVQPRKARAKRIEKVQHTKGPW	nucl(17),cyto_nucl(12.333),cyto_mito(5.666),cyto(5.5),mito(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QRM0	Zn(2)-C6 fungal-type domain-containing protein	Low	7.8	1	49-90	WRPSLMPCKRCRKARIACTISSMDRPVSKKKSKDRVLAITRP	cyto(10.5),cyto_nucl(10.5),nucl(9.5),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QRQ0	Asparagine-linked glycosylation protein 10	Low	8	1	458-491	PSYPETQKPSKRQEKEAKKQQKKQESKTNSDKKS	plas(20),E.R.(6)	SKRQEKEAKKQQKKQ (467-481, prob:0.786)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSL4	Methyltransf_11 domain-containing protein	Low	9.6	1	976-995	LSGWAMKPRRRSQRLTMMSG	nucl(13),mito(11),cyto(1),plas(1),pero(1),cyto_pero(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUF6	Uncharacterized protein	Low	9.6	1	22-45	TPHRHARVIHWLKRRRPNLKWSDV	nucl(15.5),cyto_nucl(9.5),mito(6),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2F8	GTPase activating protein (Tsc2), putative	Low	5.8	1	209-229	VANLRSKAKKSKQPRAIELEE	plas(17),E.R.(4),vacu(3),nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3W1	Acetolactate synthase	Low	5	1	674-693	EAKNKERKALMKKRGVTQML	mito(23.5),cyto_mito(14)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4M7	Integral peroxisomal membrane peroxin, putative	Low	7.4	1	363-382	QRAGAWRRRRWVRVVHRVGV	plas(7),nucl(6),cyto(6),cyto_nucl(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4R7	Uncharacterized protein	Low	9.5	1	52-73	DGQQIIRPRRRRKTPESPQQDE	extr(7),nucl(4),mito(4),plas(4),mito_nucl(4),cyto(3)	RRRR (60-63, prob:0.632)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5Z5	DUF221 domain protein, putative	Low	5	1	47-66	AFIILRRKYRRDYMPRTFLP	plas(21),E.R.(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6W4	Actin-interacting protein (Bud6/Aip3), putative	Low	9.2	1	159-179	LLHGLKKKQARLRSRQTREGL	nucl(17),cyto_nucl(13),mito(5),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8T0	DDHD domain protein	Low	8.7	1	83-105	FTSLEKKEPPKPFPPAKKFIPFY	nucl(13.5),cyto_nucl(11.5),cyto(8.5),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QA66	Putative transferase CAF17, mitochondrial	Low	5	1	6-25	SKCFICTRCAHRNNSRAPFS	mito(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QCP3	SCF ubiquitin ligase complex subunit CulA, putative	Low	9.7	2	11-33, 746-768	PALSLRRSDRLKKYTPRTPKMAT, SAIVRIMKSRKKMKHVQLVQEVI	mito_nucl(13.333),mito(13),nucl(12.5),cyto_mito(7.833)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFK0	Ubiquitinyl hydrolase 1	Low	9	1	56-81	ETYNTWHIKDWRKLKKKEHGPIFECG	cyto(13),nucl(10),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QN93	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	1	293-315	ELLCKLKTSRRGKQQQQQQSFNC	nucl(11),mito(11),mito_nucl(11)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSZ7	Monoxygenase, putative	Low	7.4	1	9-30	LEVKIETQRRRKINEQNFRNAI	cyto_nucl(10.333),nucl(10),cyto(8.5),cyto_mito(7.666),mito(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTA9	MAP kinase kinase Ste7	Low	7.2	1	1-23	MADAFKPRTMKRKNVKGLALNST	mito(18),nucl(6.5),cyto_nucl(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVD1	Translation elongation factor eEF-1 subunit gamma, putative	Low	9	1	210-229	KYTPPKKEEKPKKEAPKPAA	cyto(19),cyto_mito(12.5),nucl(4),mito(4)	PKKEEKPKKEAPKPAA (214-229, prob:0.901)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2X0	Phospholipase D	Low	9.4	1	81-101	SYSQQPPPSNRPPKQDKLSSF	nucl(16.5),cyto_nucl(11.5),cyto(5.5),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q574	Sugar transporter, putative	Low	5	1	509-529	FTDPKPVKKSLQKKKVIVEGG	plas(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6M1	Cell division control protein Cdc48	Low	9.6	1	28-49	MDTSTAILKKKKKPNSLIVTDA	nucl(17.5),cyto_nucl(13),cyto(7.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7S3	DUF2235 domain-containing protein	Low	5	1	155-174	TKSTWYQKHKDKLRLTNNLK	extr(16),cyto(6.5),cyto_nucl(4.5),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAD9	Neurofilament heavy polypeptide, putative	Low	9.5	1	1-21	MPKKGGKKHNKKKGAGGGGAK	mito(13.5),mito_nucl(10.833),cyto_nucl(7.333),nucl(7),cyto(6.5)	KKGGKKHNKKKGAGGGGAK (3-21, prob:0.977)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QC54	C6 transcription factor, putative	Low	8.6	1	17-63	ACMQCFKAKCRCVPRPNAPCERCLRLKKDCQPSQSARRRNAQKSQGQ	nucl(12.5),cyto_nucl(9.5),cyto(5.5),mito(4),extr(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEA5	Signal transduction protein Syg1, putative	Low	8	1	12-42	VPEWRAKYLNYKLGKKKIKAIQKALQKANRT	plas(25)	KKKI (26-29, prob:0.632)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEQ2	Autophagy-related protein 9	Low	8.7	1	155-180	AGPSSTRSRKRWESPRNRKKLGQFLP	plas(22),nucl(2),mito(1),cyto_nucl(1),E.R.(1),vacu(1)	SRKRWESPRNRKK (162-174, prob:0.733)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJ85	Uncharacterized protein	Low	8	1	40-62	EAITLHLRKKRSKRFTSSQIEDI	nucl(10.5),cyto_nucl(9.5),cyto(7.5),mito(2),pero(2),E.R.(2),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJW2	Uncharacterized protein	Low	9.9	1	21-40	PSNPVSRNPQEQRRQPNQPS	nucl(20),cyto_nucl(15.5),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLP8	IZH family channel protein (Izh3), putative	Low	5	1	28-48	ETPLIRSRRRHSFQHARRSSC	plas(23),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLW9	Protein arginine methyltransferase NDUFAF7	Low	8.8	1	85-108	LVTAKDLRSRRERPRQVKMLTREF	mito(13),nucl(10),cyto(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMW3	Aspergillopepsin-2, putative	Low	5	1	32-51	NRVARRARPNQQTHTNQRIN	extr(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QN52	Integrase catalytic domain-containing protein	Low	6.9	1	156-175	NSWTSRKERKADANRWHARL	cyto(9.5),pero(9),cyto_mito(6.5),nucl(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNL7	Kinesin, putative	Low	9	1	1174-1195	QSQPPSLPTRQRKQLYRSRVFD	nucl(10),mito(8),cyto(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPC2	Uncharacterized protein	Low	6	1	24-46	LLPVSQQKRIRNRFQGHNSNNVL	plas(17),mito(4),nucl(3),cyto(3),cyto_nucl(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQ54	Cell cycle regulatory protein, putative	Low	9.5	2	27-48, 760-779	VQCRAFSEKFPRPRHRLHLVRE, TPNFVICYRVWRKPHRAFTG	cyto(10.5),cyto_nucl(10.5),nucl(9.5),mito(3),plas(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTM1	Uncharacterized protein	Low	6	1	79-104	TAHVYSRARKCKWRRNHSKSNETQGG	cysk(20),cyto_nucl(3.5),nucl(3),cyto(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4E1	Mitochondrial Rho GTPase	Low	8.8	1	400-427	STTAALKVTKPRKRRRRPGRVGRNVVLC	cyto(9.5),cyto_nucl(6.5),mito(4),plas(3),nucl(2.5),extr(2),pero(2),E.R.(2)	TKPRKRRRRPGRV (408-420, prob:0.978)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4M9	COPII-coated vesicle protein (Erv41), putative	Low	8	1	163-189	ARHVLSHTRRNPKRKFPKTPRLSSKYP	plas(23),E.R.(2)	RRNPKRKFPK (171-180, prob:0.751)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5B7	Sensor histidine kinase/response regulator, putative	Low	9.3	2	192-214, 345-364	AQTPSHRVKEKSKRTASKAPGTI, NTPTQKKNSKRPSLLGRHSF	mito(18),nucl(6),cyto(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5C6	C6 finger domain protein Acr-2, putative	Low	7.6	1	1-21	MSKGCYTCRRRRIVCDNGFPT	nucl(8),mito(8),mito_nucl(8),plas(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5V6	Hexose transporter, putative	Low	5	1	16-39	YLAGRVFPRKQWWKDKNMRTLYFF	plas(24),mito(1),pero(1),E.R.(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEU1	Trehalase	Low	7	1	507-528	ETSSVWDRRARKRKVTMDKLMW	cyto(10),cysk(8),nucl(6),cyto_pero(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIA0	alpha-1,2-Mannosidase	Low	5	1	82-107	QYDFPKEKTSDRRKRLERQSAVKEAF	plas(6),golg(6),E.R.(5),extr(4),mito(3),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUC8	Uncharacterized protein	Low	9.5	1	62-89	DHSTKMVTSKRDKKPKRLAKPTNLEPID	cysk(20),nucl(4),cyto(3)	KRDKKPKRL (71-79, prob:0.77)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QWN2	WD-repeat protein, putative	Low	6.7	1	171-195	LENNPRLCRKYKRPHPGSDRLFKAD	cyto_nucl(9),cyto(8),nucl(6),extr(6),pero(3),mito(2),cysk(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4C9	Cysteine-binding protein FliY, putative	Low	9.6	2	8-27, 48-73	KGCLVCRNRRIKCDEARPEC, DEGPNLQRRHRRMSDRKSHNDVEKKS	mito(17),nucl(7),cyto(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q632	Uncharacterized protein	Low	8.3	1	1-22	METVRQKCRPKHQVLILKCFPR	nucl(11.5),mito(10),cyto_nucl(8.5),cyto(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7K3	Uncharacterized protein	Low	5	1	189-211	LLGFTKDKRKRFVRNRQLKYTAF	plas(21),E.R.(3),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q880	C6 transcription factor, putative	Low	5.7	1	13-74	SPEAVGFKTRRSHKKSRYGCTKCKQRRIKCDERSPKCSRCEKMNLSCQYPKRKPNPLVPDDF	plas(21),mito(3),nucl(2),cyto_mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIQ8	Zn(2)-C6 fungal-type domain-containing protein	Low	8.9	1	9-47	GQNPKGKKTATRQSRSCRVCRLRKVKCDRVKPCHACCAH	nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QK57	Benzoate 4-monooxygenase cytochrome P450, putative	Low	7	1	24-43	ASTHKNSRARRGYMNKYFSK	mito(6),pero(6),nucl(5),plas(4),cyto_nucl(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKI2	Mitochondrial intermediate peptidase	Low	8	1	220-239	GIEKGPKRDRFKEIKRRLSQ	extr(9),E.R.(6),golg(5),vacu(3),cyto(2)	KKERKSYIRNGLGIEKGPKRDRFKEIKRR (208-236, prob:0.878)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QS88	Uncharacterized protein	Low	7.2	1	330-351	SDERHPPYRFTQRQRAAWNRLV	mito(17),nucl(6),cyto(2),cysk(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QT79	Hexaprenyl pyrophosphate synthetase Coq1, putative	Low	5.7	1	38-57	APVVHSRKYHPSRRRDVSPI	mito(19),cyto_mito(11.833),mito_nucl(11.833),nucl(3.5),cyto(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1J4	37S ribosomal protein S25, mitochondrial	Low	7.3	1	71-93	FESVQPKKTSRNKKASKLFQPLK	mito(18),nucl(6.5),cyto_nucl(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1P0	PAP2 domain protein	Low	5	1	21-40	NSLPKWRYYPRQKILPVVRF	plas(27)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2D5	DUF4203 domain-containing protein	Low	5.8	1	315-334	LSQFKLWKLTRERREKQEKV	plas(20),E.R.(3),nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q692	Integrase catalytic domain-containing protein	Low	8.4	1	426-446	TDRRYNTRQPSRSPHRNRSSY	nucl(12),cyto_nucl(10),pero(7),cyto(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q796	Kinesin, putative	Low	6.9	1	177-197	QGKLKKAKKVYQQRLEDYKKG	mito(13),cyto_nucl(9.5),nucl(6.5),cyto(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8C1	Pyruvate formate lyase activating enzyme, putative	Low	8.8	1	312-338	QYHPDAHVGKKKRRRAKRQDVESGGEE	mito(19),cyto(5),nucl(2)	GKKKRRRAKR (320-329, prob:0.947)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9D2	Uncharacterized protein	Low	9.7	1	1280-1307	SRSKGNTTFRTRKSTKPREPGTKYNGSN	nucl(18.5),cyto_nucl(14),cyto(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAZ4	Histidine biosynthesis trifunctional protein	Low	8	1	340-360	DMKNFKVKRRKGDAKPRWAEK	cyto(17),mito(8)	KVKRRKGDAKPRWAEK (345-360, prob:0.884)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDZ4	SRR1 domain-containing protein	Low	9.1	1	1-22	MPNASRKHRKKFVHSRRIEVTD	nucl(14.5),cyto_nucl(9.5),mito(8),cyto(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGE4	Mitochondrial ribosomal protein DAP3, putative	Low	8	1	63-92	EGAPKFRESKSARMRKPKKATVDRGRPPAV	mito(20.5),cyto_mito(12.5),cyto(3.5)	KSRSMEGAPKFRESKSARMRKPKKATVDRGRPPAVGERKALRKR (58-101, prob:0.992)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGI5	Pre-mRNA-splicing factor	Low	9.7	1	22-46	ALAQKHWLKQSKIRKIKQDVIKNEI	nucl(17.5),cyto_nucl(11.5),cyto(4.5),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGZ6	Lectin C-type domain protein	Low	6.4	1	533-560	STIFVKCNSNRRISRRKRVNQGWEYEGV	extr(17),nucl(4),cyto(3),golg(2),mito_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QL43	Uncharacterized protein	Low	5	1	92-111	GRCRPSKLWMQKKRKCDCMS	extr(9),mito(8),plas(6),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLU0	Zn(2)-C6 fungal-type domain-containing protein	Low	6.9	1	10-29	QCTVSKRKCIVQLPKCERCS	mito(16),nucl(5),cyto(2),pero(2),cyto_pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QME9	Acyl_transf_3 domain-containing protein	Low	5	1	543-566	DFHYGRCGPKKNNIRRLDREIIRH	plas(19),mito(4),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QS01	Nicotinamide N-methyltransferase, putative	Low	7.6	1	1-26	MLHSRLRPLPRRGRSVQKSNNNDSTT	nucl(11.5),mito(10.5),cyto_nucl(8.833),cyto_mito(8.333),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3R4	Uncharacterized protein	Low	9.5	1	32-52	LSSTWPWKRVPRRSTPTQQTS	nucl(17),cyto_nucl(12),cyto(5),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLK5	Cell wall integrity signaling protein Lsp1/Pil1, putative	Low	9.4	1	271-294	SNLSTRSRTLSQRRRNNIKRGVED	nucl(16),cyto_nucl(11),mito(5),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLV3	Zn(2)-C6 fungal-type domain-containing protein	Low	9.2	1	23-53	AARKLRVPKACYPCYKRKVKCDRNSPCSLCV	nucl(11),plas(6),cyto(4),mito(3),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMJ9	ELMO/CED-12 family protein	Low	9.8	1	281-302	GENDIKKSRKHNPEKWRRLGFQ	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNM0	Uncharacterized protein	Low	8.8	1	237-264	GVEIEARRRQRRRQQQHHHHHHHHHQTS	nucl(13.5),cyto_nucl(10),cyto(5.5),pero(3),mito(2),plas(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QRB7	Cytochrome b561 domain-containing protein	Low	5	1	365-385	GYVLWQHQRRQSQQRGHAIPK	plas(23),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QSX8	40S ribosomal protein S4	Low	5	1	1-20	MPRGPKKHQKRLSAPAHWLL	mito(22),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QV05	Pogo transposable element, putative	Low	8.9	1	570-594	LATPSAPKRAKKQVSKQVKVKAQPE	nucl(14.5),cyto_nucl(11.5),cyto(7.5),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1N4	DnaJ domain protein	Low	6.2	1	219-245	HYKTQKAEDARRKERRSQQIQREREIL	mito(16),extr(4),nucl(3),plas(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEF2	Septin AspA, putative	Low	6	1	1-25	MMSSPLNAIRRKKNVKKGIQFCLMV	mito(20),nucl(3),cyto(3),cyto_nucl(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QH33	Uncharacterized protein	Low	7.3	1	320-341	DDYIERTRRRPQKTSTNGPLVH	cyto(13),cyto_nucl(12),nucl(9),pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIH9	Nucleoside diphosphatase Gda1	Low	6.2	1	91-111	NSSTTKCTKPHDPSKPLRQYV	plas(10),cyto(5.5),cyto_nucl(5),nucl(3.5),pero(3),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIX6	Ankyrin repeat-containing protein, putative	Low	8.6	1	923-948	LVRALYYRKKQKLAVRKLERRVKDQD	nucl(10),plas(8),pero(4),golg(2),mito(1),cyto(1),E.R.(1),cyto_mito(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPA9	Uncharacterized protein	Low	9.7	2	602-624, 634-658	QPTSTKKRKTEDLQPPKPQNNTS, LKVQKRCIWCLYKNPKRQTGQSPSF	nucl(8.5),cyto_nucl(8),cyto(6.5),mito(5),pero(2),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QT17	SURF1-like protein	Low	7.4	2	35-59, 319-340	DSVCLRCRQLQFRQRQQRNFNTGSR, LWMVVRKRPNEALRRVRQSKNM	mito(15.5),cyto_mito(11.833),cyto(7),cyto_nucl(4.833),nucl(1.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUC2	Protease S8 tripeptidyl peptidase I, putative	Low	5	1	31-57	HEKRDSLPARWTKRDRVPRDKLLPMRI	extr(25)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVX6	Peroxisome biosynthesis protein (PAS8/Peroxin-6), putative	Low	8	1	4-33	EAAPAAPVHKHRRMRKRIRARSPISGRLLL	mito(22.5),cyto_mito(14),cyto(4.5)	HKHRRMRKRIRARS (12-25, prob:0.926)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2M3	RSC complex subunit Sfh1, putative	Low	8.8	1	456-483	SETPLGRGERSKRKRRFRSLSPVGRSGT	mito(20),cyto(3.5),cyto_nucl(3.5),nucl(2.5)	RGERSKRKRRFRS (462-474, prob:0.916)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4G2	Uncharacterized protein	Low	7.5	1	560-584	ESNYLLRTHKKWRRAQKRSGVEFLQ	mito(13.5),mito_nucl(12.833),nucl(11),cyto_nucl(6.833)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4L1	Uncharacterized protein	Low	9.4	1	319-340	DNRARILCKSRRSRRAKFYCLP	nucl(14),cyto(8.5),cyto_mito(5),extr(1),pero(1),E.R.(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QFX9	Alpha-actinin, sarcomeric (F-actin cross linking protein)	Low	9.8	1	11-30	VQQKTFTKWLNNKLKARNLA	nucl(13),mito(7),cyto(4),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIS8	Cytochrome P450, putative	Low	8	1	253-272	NKKTERAKTLRRRRDKYLSF	plas(6),extr(5),cyto(4),golg(4),E.R.(3),cyto_mito(3)	ERAKTLRRRR (257-266, prob:0.682)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKL6	NifU-related protein	Low	7.5	1	46-66	AITPSQKRRRPTLHLNHQTSG	mito(17),nucl(7.5),cyto_nucl(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QN71	Zn(2)-C6 fungal-type domain-containing protein	Low	6.6	1	2-53	TSKALHSCFLCRRNKRRCDKSLPSCQLCIRKGWKCSYPQRRGQRSASPPRSL	plas(11),mito(7),nucl(4),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q278	Ubiquinone biosynthesis protein, putative	Low	5	1	70-90	SGSTGSKRSSRRRTAIRLGAA	mito(19),cyto(4),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QA56	ZT_dimer domain-containing protein	Low	5	1	24-50	NTSLLSKHIHRRIRRAHTYHKTQNSHI	plas(24),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QCN1	Uncharacterized protein	Low	9.2	1	898-921	AEQNKLVRRSKAHKQKDRISSNWM	nucl(11),mito(7),cyto(6),extr(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNJ6	ABC transporter, putative	Low	7	2	20-46, 778-800	FLRHAATSSKPKKYQQKTNQSKLYQLK, GERYRYAIPRKTQTKNKLRALND	mito(17.5),cyto_mito(12.5),cyto(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QNN8	60S ribosomal protein L12	Low	9.6	1	84-105	ALKEPPRDRKKEKNIKHSKSIP	cyto(18),cyto_nucl(13),nucl(6)	KEPPRDRKKEKNIKH (86-100, prob:0.835)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTD9	GDP/GTP exchange factor Sec2p, putative	Low	7.1	1	24-44	RPNNHKRSQSAGKRTRSPARF	mito(15),nucl(7),cyto_nucl(7),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QV39	Serine-rich protein, putative	Low	7.3	1	705-727	IEQYEKKRYYNARWWRNVNRVMI	plas(18),nucl(6),cyto(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QV58	Uncharacterized protein	Low	5	1	302-326	SSRLCHSKPLPCKRQRPQSNDECIT	extr(12),golg(5),cyto(3),plas(3),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2B7	Uncharacterized protein	Low	9.7	1	5-27	SGFHRLRRAKSAPSVQKRRQAAI	nucl(16.5),cyto_nucl(9.5),mito(9)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7Z7	Annexin	Low	8.8	1	409-429	LDQVKKAYQHHYHRDLRERVK	nucl(14.5),cyto_nucl(12),cyto(8.5),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QR01	Nuclear pore complex protein (SonA), putative	Low	6.5	1	353-372	QEEVKPRPNARKPSRNKMDT	cyto(12),cyto_nucl(10.833),cyto_mito(9.499),nucl(6.5),mito(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1R3	Alpha-1,3-glucan synthase	Low	5	1	1647-1668	YVSSIAKHRKHSKQENPSRTNS	plas(23),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q230	Mitochondrial thiamine pyrophosphate carrier 1	Low	5.7	1	28-52	TSSPWGFDTKKRNRMLKRYRTQVAS	mito(21),nucl(2),cyto(2),cyto_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2W8	Uncharacterized protein	Low	5	1	51-75	VPIQSRPQTKRQKIGQKVLHFERKV	plas(19),mito(3),E.R.(2),cyto_mito(2),mito_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q960	Biotin carboxylase	Low	9.1	2	1694-1713, 2140-2160	YLTPEFKKKLDERKKKEVLT, EAKGTIRKPLQWKNARRFFYW	cyto(8.5),cyto_nucl(8.5),nucl(7.5),mito(6),pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBQ8	Phosphate transporter	Low	5	1	553-572	SSRYAVRRTRSVHRLPTRRF	plas(25)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QCT2	Hsp70 chaperone Hsp88	Low	8	1	523-545	AADGEKKTRKVKKQVRKGDLPIS	cyto(24.5),cyto_nucl(13.5)	KKTRKVKKQV (528-537, prob:0.725)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QED6	Uncharacterized protein	Low	9.3	1	319-338	KLEQQRKRIAKEKAEKRLTR	mito(18.5),mito_nucl(12.666),nucl(5.5),cyto_nucl(5.333)	KRIAKEKA (325-332, prob:0.657)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QET0	Threonyl-tRNA synthetase	Low	7.5	1	704-724	LEEARVKLRALRKERRLSNTL	cyto(14),nucl(7),cyto_mito(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJI9	Lactamase_B domain-containing protein	Low	6.2	1	3-23	EEPQPEKKQHKGGYRQINKAL	cyto(22),nucl(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKH6	General stress response phosphoprotein phosphatase Psr1/2, putative	Low	9.6	1	57-76	APSSHPKKKRSLLLVPSRTS	nucl(22),cyto_nucl(13.833),mito_nucl(11.833)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QND3	Fanconi-associated nuclease	Low	7.5	1	6-27	DFFETRRPSAKRQKVSHEADSD	cyto(10.5),cyto_nucl(10),nucl(8.5),pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPS3	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	Low	9.8	2	154-175, 547-568	AFSLAKYKLRKEKKYLKRFTIV, QVQARGISSRKKRKLDVGDIDT	cyto(12.5),cyto_nucl(12),nucl(10.5),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQD1	MFS transporter, putative	Low	5	1	530-556	YVWGMGWRQKRWRKVAEKAERERQNGV	plas(26)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTN2	C-4 methyl sterol oxidase Erg25, putative	Low	9	1	297-320	TEYTPESVKRWREKKAEKVAKKAN	plas(11),mito(4),cyto(4),cyto_mito(4),nucl(3),pero(3)	KRWREKKAEKVAKKAN (305-320, prob:0.849)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBQ4	Uncharacterized protein	Low	9	1	14-33	SCPNCEKQPVNKPSHRTRAY	nucl(12.5),cyto_nucl(7.5),mito(4),E.R.(3),golg(3),cyto(1.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDE1	Eukaryotic translation initiation factor subunit eIF-4F, putative	Low	9.4	1	357-385	NKSWRNKKMDPFQKNTQRQKNSQRTRSDE	nucl(14),mito(10.5),cyto_mito(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEG6	Phosphatidylinositol 3-kinase VPS34	Low	7.8	1	134-157	DTDGKLRMGRQKCKIYRNKAADGF	cyto(13),nucl(8),cyto_pero(8)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJW5	pH-response regulator protein palC	Low	7.4	1	40-59	IALKTHKRLSPRERENNLQV	mito(13),nucl(6),cyto(4),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QS23	Uncharacterized protein	Low	7.8	1	1257-1276	NTNANNNNNKHKPSPRRVIV	nucl(9.5),cyto_nucl(9.5),cyto(8.5),mito(2),plas(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QVX3	Uncharacterized protein	Low	9.1	1	168-189	DVASLNKKQRKRHEKKMAALAA	mito(24),nucl(3)	KKQRKRHEKK (174-183, prob:0.805)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q1J0	Zn(2)-C6 fungal-type domain-containing protein	Low	8.8	1	46-71	RTGCITCKRRHIKCDEAKPHCNNCLK	nucl(11),plas(6),mito(4),cyto(4),cyto_mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q875	cAMP receptor (Car4), putative	Low	5	1	395-422	SIGMKSWRRESRFQKWRPGDKVKDMARL	plas(17),E.R.(4),golg(3),mito(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q904	O-methylsterigmatocystin oxidoreductase, putative	Low	5	1	121-140	VPYGMKWRTNRRIYHKHFTE	cyto(8),E.R.(7),plas(4),cyto_mito(4),extr(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDJ6	GTP binding protein (EngB), putative	Low	8	1	19-44	SQTCQHQRRSYHQTLRREKKLEKTTT	mito(10),nucl(9.5),cyto_nucl(7.5),cyto(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJU3	DUF890 domain protein	Low	9	1	355-376	KEDIWSRKARRKFAREQHDGET	nucl(14.5),cyto_nucl(11.5),cyto(5.5),mito(3),extr(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QM59	Cytochrome P450 alkane hydroxylase, putative	Low	5	1	29-50	IQNRRKAATRGCQPPKKNPAGF	mito(8),pero(6),cyto_mito(6),cyto(4),extr(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QP85	AP complex subunit beta	Low	6.7	1	24-44	NSGGKKDKNHSAKKIALKKIV	cyto(18.5),cyto_nucl(13),nucl(6.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQE4	Zn(2)-C6 fungal-type domain-containing protein	Low	7.8	1	1-28	MQKRKQFHSCDRCRQSRRACDAAKRGIN	nucl(8),mito(7),cyto(7),cyto_mito(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QTT5	Zn(2)-C6 fungal-type domain-containing protein	Low	8.5	1	65-88	VTKLTNTRHHQQHQQQQQQQRKIH	mito(15),nucl(9),cyto(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QU77	Pogo transposable element, putative	Low	9.2	1	570-594	LATPSAPKRAKKQVSKQVKLKAQPE	nucl(16.5),cyto_nucl(12),cyto(6.5),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QWG4	Uncharacterized protein	Low	6.1	1	354-374	WKDGRFKRKGWSEKPYRMLYR	mito(19),nucl(3),cyto(3),cyto_nucl(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q3P5	Uncharacterized protein	Low	6.9	1	229-248	EEIERETRRRQRRSSRGSIG	mito(18),nucl(5),cyto(2),extr(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q427	G1/S regulator NimO, putative	Low	8.2	2	386-405, 592-618	LAHMKEEKKRQRQEKVSVKD, TDRKGALQKKAVKEKQRDPKPGYCENC	mito(19.5),mito_nucl(12.5),nucl(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6C2	ATP-dependent DNA helicase PIF1	Low	9.5	2	205-228, 373-396	SSPPSHHQPPQQKRRKLPWGQEDS, ATELVKKVRKNQKARNRWMRTKVL	mito(12.5),mito_nucl(12.333),nucl(11),cyto_nucl(7.333)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q929	MFS allantoate transporter, putative	Low	5	1	404-423	FIWWWYARQNKKKAMIRASE	plas(20),E.R.(3),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q9H6	Uncharacterized protein	Low	9.7	1	73-99	AVVDRPGQTKKKKRDLEEVRKNQKRWL	cyto(15),cyto_nucl(12.833),cyto_mito(8.499),nucl(7.5)	KKKKR (82-86, prob:0.707)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QA58	Uncharacterized protein	Low	9.2	1	11-30	LQQGPDRKRSWRERLHPSAW	nucl(15.5),cyto_nucl(12.5),cyto(8.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBS5	Anaphase promoting complex subunit 10 (APC10), putative	Low	8.8	1	253-273	GGRNKRRKSHAVGGNRRRTRN	mito(17),cyto(6.5),cyto_nucl(5),nucl(2.5)	GRNKRRKSHAVGGNRRRTRNSKPAK (254-278, prob:0.948)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QE75	Ribosome biogenesis protein Rsa4, putative	Low	6.7	1	2-25	ATVLPPPSKKQKREIAERAREQQE	cyto(10.5),cyto_mito(8.5),nucl(6),mito(5.5),pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QMG3	Uncharacterized protein	Low	9	1	115-140	AKSRTGKATASKRPRRKRDDDDDSEE	mito(21),nucl(3),cyto(3),cyto_nucl(3)	RLKRGTSFRGRPGAGTRGRAAATGGKTSAKSRTGKATASKRPRRKR (87-132, prob:0.981)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QRD7	Calcium/calmodulin dependent protein kinase, putative	Low	7.2	1	3-24	APAPKAQPQRPQIQPCRYKTGK	mito(11),cyto(7),nucl(6),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUG2	Transcription factor (Sin3), putative	Low	8.9	1	1490-1514	KELAAIKERRRDRFREKFVNNPSWA	nucl(14.5),cyto_nucl(11),cyto(6.5),mito(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4G8	Uncharacterized protein	Low	5	1	242-267	QVHTCKLKLKLKRRYQKRFSNYRILD	mito(12),cyto(9),extr(6),mito_nucl(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QEK9	CCR4-NOT transcription complex, subunit 3	Low	9.7	1	44-64	EENLKREIKKLQRFRDQIKTW	nucl(17),cyto_nucl(11),mito(5),cyto(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QH42	Uncharacterized protein	Low	9	1	178-198	RCKACETVKRFPQNQKRSVKL	cyto(11),nucl(10),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QI52	Uncharacterized protein	Low	9.4	1	5-27	RGLLSHLSKRQPRYHRWLSNGIA	mito(14),nucl(11)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQP4	Uncharacterized protein	Low	9.5	1	428-456	RPSGTPKSDDPNKKKRKRVARERDLCDVK	plas(14),nucl(4),cyto(4),cyto_nucl(4)	GTPKSDDPNKKKRKRVAR (431-448, prob:0.945)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6K8	Zn(2)-C6 fungal-type domain-containing protein	Low	8.5	1	11-37	RIRTAQACENCKRRKQKCNGVFPCANC	plas(13),nucl(9),mito(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8U5	Signal recognition particle receptor subunit beta	Low	9.1	1	149-175	QLQAELSSKKKKKKKKKDTSSIRGIIF	cyto(11.5),cyto_nucl(8),extr(4),E.R.(4),nucl(3.5),vacu(2)	KKKKKKKKK (157-165, prob:0.99)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAH5	C6 transcription factor, putative	Low	8.3	1	1-24	MRSSIACSRCRRSKIKCVNAGIDT	nucl(11),mito(11),mito_nucl(11)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBM1	Uncharacterized protein	Low	9.1	1	8-31	IAQGRARDRKSHPSPRRIRNEAET	nucl(12),mito(6),cyto(5),plas(3),cyto_pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHW6	Mitochondrial carrier protein, putative	Low	6.4	1	329-348	QETFKRCQKRANRSGGWMRW	cyto(9.5),mito(8),cyto_nucl(7.5),nucl(4.5),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJR0	Translation elongation factor eEF-3, putative	Low	9.2	1	1033-1063	EKKAKLSASELRKKRKDRMARRKRGEEVFSD	cyto(20.5),cyto_nucl(13),nucl(4.5)	VEKKAKLSASELRKKRKDRMARRKRG (1032-1057, prob:0.992)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QP59	Uncharacterized protein	Low	9.3	1	625-661	KLKTMRLRQMWDKSRRRAIKREQKQGKNGNSNNKSRS	cyto(7.5),cyto_nucl(7.333),cyto_pero(7.166),cysk(6),pero(5.5),nucl(5)	KSRRRAIKREQKQG (637-650, prob:0.802)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QRH6	Mitochondrial zinc maintenance protein 1, mitochondrial	Low	9.3	1	108-129	LSLYRKCLREARKKPEDTRDHF	nucl(16.5),cyto_nucl(13),cyto(8.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2G6	Hypercellular protein HypA	Low	6.2	1	1431-1450	ADGIPRKRRIWHARDHCVIA	plas(12),E.R.(4),nucl(3),mito(3),mito_nucl(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q6B5	Ribosome assembly factor mrt4	Low	8.3	1	5-31	KRARLVHESKTSKKNHKEQTRRLFANI	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8Y5	DUF803 domain membrane protein	Low	5.8	1	834-853	GSRSRNITGQGQRRNPRSNS	plas(19),E.R.(4),nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QA06	Amidase	Low	7	1	9-34	QMADWESRALKKRKEREDKIYQWGLE	cyto(9),nucl(7),cyto_mito(7),pero(6),mito_nucl(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBF6	Phenol monooxygenase, putative	Low	7.8	1	7-31	TAHASRDLRVRRSRARPLPRLSAQP	nucl(7),mito(6),cyto(6),cyto_mito(6)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBN7	Nonribosomal peptide synthase, putative	Low	5	1	1837-1856	LTPSRKVDRRKMKKLASQIP	plas(19),mito(2),extr(2),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGB1	DNA damage and replication checkpoint protein Rfx1, putative	Low	9.7	1	17-39	RSRSNTAMPRAHRRPRSRGSTAS	nucl(17.5),mito_nucl(11.5),mito(4.5),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QGZ4	Carnitine acetyl transferase	Low	8.2	1	116-138	VSYFYSYKDDRKRRSNPAARAAT	nucl(11.5),cyto_nucl(10),cyto(7.5),mito(4),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJ59	Zinc-containing alcohol dehydrogenase, putative	Low	5.7	1	331-353	AEAKDAYRRLKERKHFAKVLIRI	cyto(15.5),cyto_nucl(9.5),mito(6),nucl(2.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QL60	ABC multidrug transporter, putative	Low	8	1	60-88	PGKEATAQKRKWYRKLNPLRLRKIPPVPE	plas(21),E.R.(3),vacu(2)	K (539-539, prob:0.605)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUF2	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	19-51	TSHPKVRTGCLTCKRRHKKCDENRPSCRRCIAS	nucl(17.5),cyto_nucl(11),cyto(3.5),mito(2),plas(1),pero(1),cysk(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUY5	Uncharacterized protein	Low	6.1	1	38-60	KKTAGRFMKSWKRTKRVTNTDGT	plas(21),nucl(3),cyto(2),mito_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q399	Uncharacterized protein	Low	5	1	67-88	LLSLVYKRYRERPQRPLKIWAF	plas(9),mito(8),E.R.(6),vacu(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q5Q5	Integrase catalytic domain-containing protein	Low	8.5	1	415-437	FTDRRYNTRQPSRSPHRNRSSYA	nucl(11.5),cyto_nucl(9),pero(7),cyto(5.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDK8	EH domain binding protein epsin 2	Low	9.6	1	169-188	TGGQRSNRDRRERRGRDEDD	nucl(12),mito(10),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QIH6	Uncharacterized protein	Low	5	1	480-502	NITILKHRRGSKKGDNRDDDKAV	extr(20),golg(3),vacu(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QK69	Midasin	Low	7.5	1	4658-4678	ASQYKRDKIWMRRSIPSKRNY	nucl(8.5),cyto_nucl(7.5),plas(7),cyto(5.5),vacu(2),mito(1),pero(1),E.R.(1),golg(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKT1	Fungal_trans domain-containing protein	Low	8.2	1	10-29	NRFPQPQQAQPQQQQRKQSS	nucl(11.5),cyto_nucl(8.5),mito(7),cyto(4.5),plas(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QL69	Dolichol kinase	Low	5	1	103-129	GSTNGNTKVGQRKKQRNSNRNGNGWSK	plas(25)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2T4	DnaJ domain protein (Mas5), putative	Low	8.5	1	209-232	FFATKDKCKKCKGKKVTEEKKMLE	cyto(10),nucl(9),cysk(7)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QD63	Uncharacterized protein	Low	5	1	25-52	GNPYPHGKPPKNSRGWKGNNRVKRQTGA	extr(19),mito(4),cyto(2),plas(2),mito_nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QH01	Uncharacterized protein	Low	7	1	586-608	ASQPARLRTPKRRTTQNTVTEKE	plas(18),nucl(6),cyto(3),mito_nucl(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QHB1	Copper-transporting ATPase, putative	Low	5	1	1369-1389	PSIYRFIHKRHHKWIIPTPYA	plas(25)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2V1	ATPase synthesis protein 25, mitochondrial	Low	8	1	172-192	GRNELKIKLRRKARRARLASS	mito(22),cyto(2),extr(2)	KIKLRRKARRAR (177-188, prob:0.886)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4P7	26S proteasome regulatory subunit RPN1	Low	6.5	1	28-48	KKDAKDDKTKAGKKEDKNDEL	plas(18),nucl(4.5),cyto_nucl(3),pero(1),E.R.(1),golg(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAP4	Uncharacterized protein	Low	8.8	1	51-72	EEKEGRERYKRQAKAQDRNPFV	nucl(14),cyto_nucl(11.5),cyto(7),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QI63	HTH CENPB-type domain-containing protein	Low	9	1	545-569	LATPSAPKRAKKQVSKQVKVKAQPE	nucl(15.5),cyto_nucl(11.5),cyto(6.5),pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QJA0	Lysophospholipase	Low	7.5	1	45-65	HRFTGKIRKFWDKKVKPAFPE	pero(10),nucl(8.5),cyto_nucl(8.5),cyto(7.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QK68	Chloride channel protein	Low	5	1	50-75	DSEPSKTRISFKRKQKQPSRFSLSNV	plas(25)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKS9	Uncharacterized protein	Low	5.7	1	245-267	QQQPNPQRPKFHRRSKTSPLLPT	extr(20),mito(3),nucl(2),plas(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLH4	Amidohydro-rel domain-containing protein	Low	5	1	6-30	NVGTLRPQTPFRRRRGCRLGRLLLP	plas(11),mito(9),cyto(3),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QN40	Aspartate--tRNA ligase	Low	5	1	60-84	DSSGPMSKNQQKRLARQQARQAKSR	mito(14),cyto(5),pero(5),cyto_pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QW47	Uncharacterized protein	Low	7.8	1	202-230	CVYFRTRPHYQPHHRHHHRRRNQEEGKIW	nucl(10),cyto_nucl(9),cyto(6),cysk(5),mito(3),pero(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	H9CNS7	Intron-encoded GIY-YIG endonuclease	Low	5.8	1	8-32	GLSNSPKWHKQNYSYKNNNNLHKKY	mito(20),cyto(4),nucl(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q2Z1	Phospholipid-transporting ATPase	Low	5.4	1	18-43	RPTNSEVSKPTRRQRWATRRLGNSSG	plas(22),nucl(1),cyto(1),cyto_nucl(1),E.R.(1),golg(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q463	Mitochondria protein Fmp29, putative	Low	9.1	1	501-521	VFFPVRKHPSTSKRDFVRRVY	nucl(15.5),cyto_nucl(11.5),cyto(6.5),pero(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q4E9	C6 finger domain protein, putative	Low	9.1	1	87-115	DQSARRKRSKVSRACDECRRKKVRCDATS	nucl(15.5),cyto_nucl(10.5),cyto(4.5),mito(3),plas(1),pero(1),cysk(1),vacu(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q824	CBS and PB1 domain protein	Low	9.9	1	73-99	MEADLNKKRHHVQRPRHNRKAPPGTVL	plas(11),nucl(5),cyto(5),cyto_nucl(5)	RRKMEADLNKKRHHVQRPRHNRKAP (70-94, prob:0.868)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8C5	Sulfite reductase, putative	Low	8.2	1	1226-1249	MLVQRDHGDRKNRKHARLKYTIDD	cyto(10.5),nucl(10),cyto_mito(6.5),extr(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAH3	Ribosome biogenesis protein Urb1, putative	Low	8.2	1	1-27	MAPAFSPEHRNKRRKINNGENQPPSNG	plas(13),nucl(9),pero(2),mito(1),cyto(1),vacu(1),cyto_mito(1)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAL2	Glutamate decarboxylase	Low	8.5	2	158-178, 488-508	ALLAMKRRWQNKRKAEGKDWH, VSSHKARHNHPMYKKEKHSLQ	cyto(13),cyto_nucl(10.333),cyto_pero(9.333),nucl(6.5),pero(4.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAN9	MFS transporter, putative	Low	5	1	528-549	FYFWGKHCRKWTAKSNVHQLSD	plas(23),E.R.(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QDD4	Mitochondrial genome maintenance protein MGM101	Low	7.3	1	267-287	EHVVNKRKSKIWIRKDEEVAY	mito(15),nucl(6),cyto(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QN96	Uncharacterized protein	Low	9.7	1	66-86	IGWNRRPRRYHLDRLNPIRSR	nucl(17.5),cyto_nucl(12),cyto(5.5),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QPP1	Cytochrome P450, putative	Low	8	1	19-42	ALQFLRKSIKRKGAKRLIKSSQVF	mito(7),plas(5),extr(5),E.R.(4),cyto_mito(4),mito_nucl(4)	KSIKRKGAKR (25-34, prob:0.803)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QQM5	C6 finger domain protein GliZ	Low	9.7	1	41-64	SNRLGRPKGTTKYKAQRQRAVNTS	nucl(16.5),cyto_nucl(11),cyto(4.5),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q8V4	Protein kinase, putative	Low	9.1	1	5-29	GSLPNTRQRTSPKSPSKRVLNISSD	nucl(15.5),cyto_nucl(12),cyto(7.5),mito(3)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QAG0	Pentatricopeptide repeat protein	Low	5	1	101-121	DSDWRQFQFKRRIGWKPKDDV	mito(21),cyto(4)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBC0	Uncharacterized protein	Low	5	1	629-650	SLEPPPSKTKKDRKAISRIAEG	plas(21),mito(3),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QE34	Fungal specific transcription factor, putative	Low	9.9	1	7-41	NAETISHKRKHARRACEQCRRGKRRCTHTLSLDPH	nucl(17.5),cyto_nucl(11),mito(4),cyto(3.5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QH75	Glutamate decarboxylase	Low	8	1	510-539	QTQAHRTRVERRRNRSGKHGQQAQNKSPRW	nucl(11.5),cyto_nucl(11.5),cyto(10.5),pero(5)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QH81	Pre-rRNA-processing protein IPI1	Low	9.9	1	1-34	MGSSTKRKKEKQKDFQKPKLKVGKAKPKPANFTD	mito(15),cyto(6),nucl(5)	KRKKEKQKDFQKPKLKVGKAKPKP (6-29, prob:0.968)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QK33	Uncharacterized protein	Low	8.5	1	49-70	ISTIRRLRKDAGKRLRNLRTSL	nucl(12),cyto_nucl(10.5),cyto(7),mito(3),golg(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QKF4	Vezatin domain-containing protein	Low	8.1	1	601-621	LETVIKHRPTLKNKPQRITSI	plas(13),nucl(8),E.R.(3),cyto(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLC4	3-beta hydroxysteroid dehydrogenase/isomerase family protein	Low	7.1	1	344-382	GNVASRPKQRKPANRRTLSCYPCRKHKLKCDRQIPCQSC	cyto(9),cyto_nucl(9),nucl(7),plas(5),pero(2),E.R.(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QLU1	Uncharacterized protein	Low	8	1	289-315	HMYGRRIQVKGKPKKYYRRRDMADELI	plas(20),E.R.(5)	GKPKK (299-303, prob:0.643)
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6Q7V5	C6 finger domain protein, putative	Low	9.7	2	6-44, 59-81	THRNEAMSHPRPKHRIRHTKSRNGCYTCKQRRVKCDEEL, YPSPGGTRDQRPRQRPISRERPS	plas(17),nucl(7),cyto(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QBW7	UDP-glucose,sterol transferase, putative	Low	9.5	1	1150-1172	LNESKRDHDNRLRREQREKDEMD	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(2),pero(2)	
UP000001294	Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)	B6QUR4	Uncharacterized protein	Low	5	1	260-279	SPSWVHKRNEMKKPIIHRVL	extr(23),cyto(2)