ProteomeAccession	ScentificName	ProteinAccession	ProteinName	Category	ConfidenceScore	#NoLS	Positions	SegmentSeqs	PSORT	NLS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMF3	Uncharacterized protein	Low	5	1	284-311	GRTYYPSDSNRRRQYRRGHRRSLSPSYL	plas(24),mito(1),E.R.(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN90	Uncharacterized protein	Low	5	1	180-225	KTPASKAPPNKKMKQMPLNNTQKDIKAYVTRRKRGRHGVKVVCLRS	mito(13),cyto(9),mito_nucl(9)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQH0	Avl9 domain-containing protein	Low	8	1	736-755	GEEEKEKEKEKEKEKEKEKS	mito(22.5),cyto_mito(13.5),cyto(3.5)	KEKEKEKEKEKEKS (742-755, prob:0.81)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQM2	Uncharacterized protein	Low	9.7	1	59-78	LIPCNNKRCRPRWYHERCVG	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXR9	Uncharacterized protein	Low	5	1	1021-1048	SANKTRSPTTSWWKPKRKREGTSQELTT	plas(23),mito(1),E.R.(1),golg(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0E8	Stn1 domain-containing protein	Low	8.8	1	190-218	SSTEHKKIKHSIKSEKKKLHEYERRKAEY	mito(21.5),cyto_mito(12.5),nucl(3)	KKIKHSIKSEKKKLHEYERRKAEYEVKKEEHR (195-226, prob:0.904)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3I8	Uncharacterized protein	Low	7.7	1	117-140	LQEQAKKKKKEQLYRLQRQQPQND	nucl(9),mito(8),cyto(8),cyto_mito(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDD7	Uncharacterized protein (Fragment)	Low	7	1	1-23	MARNRYSQTRKNDRKPLRIFQAN	mito(20),nucl(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFW0	UBC core domain-containing protein	Low	8.7	1	920-941	AWLNIPQKHKRQKASGKSKYDP	nucl(10),cyto(8),mito(3),pero(3),cysk(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIB8	Uncharacterized protein	Low	9.9	1	1-22	MFLSRNSKPNRPKQLHTEHKHA	nucl(17.5),cyto_nucl(11),mito(4),cyto(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNI0	Uncharacterized protein	Low	8.8	1	293-314	RGEEKVRRRSRSRSQENHRDTL	mito(11),cyto(7),plas(3),nucl(2),pero(2)	VRRR (298-301, prob:0.642)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2E7	Uncharacterized protein	Low	9.4	1	147-166	PPPKGPPSRGGKKEKSEPRT	plas(11),nucl(4),cyto(4),cyto_nucl(4),mito(2),pero(2),E.R.(2)	PPKGPPSRGGKKEKSEPRTLNDRHHGRGRGRGR (148-180, prob:0.963)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3Z8	Glyoxalase I	Low	7.9	1	274-293	CARFEEKKVNWKKRLTDGRM	nucl(10),cyto_nucl(10),cyto(8),mito(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4S2	Uncharacterized protein	Low	5	1	1294-1315	SADVHRKKGSKDSAKRDRESRV	plas(15),extr(8),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5F8	Uncharacterized protein	Low	9.6	1	1284-1306	RNLGTMKKAKEEKRKEAQAEPND	nucl(16.5),cyto_nucl(10.5),mito(5),cyto(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE02	Uncharacterized protein	Low	5	1	55-74	DWESRWKPSHAKKDVKSDDE	cyto(7),extr(7),E.R.(7),golg(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ58	Uncharacterized protein	Low	6.8	1	652-674	VVNERENRRKKVSRGQLKPAQEG	mito(13.5),cyto_mito(9.333),nucl(7.5),cyto_nucl(6.333),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLW4	Uncharacterized protein	Low	8	1	596-617	AWRFSRAYSARRRQERLKWEEE	mito(15.5),cyto_mito(8.5),golg(6),extr(3)	EKKAGVRPGEGRGRWTDKR (625-643, prob:0.727)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNN4	Solute carrier family 40 protein	Low	5	1	474-494	HTDRCVRRIYKSKTGRYQVLP	plas(23),E.R.(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUA3	Uncharacterized protein	Low	8	1	387-411	GGDEKEGWRRRGRGKQNRNSWIEKE	plas(21),E.R.(3),mito(2)	RRRGRGK (395-401, prob:0.707)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S834	Chromo domain-containing protein	Low	7.9	1	8-33	GDKVYLRTKNLRTKRPSKGLNNVKVG	nucl(13.5),mito_nucl(13.166),mito(11.5),cyto_nucl(8.833)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9P8	Methionyl-tRNA synthetase	Low	9.8	1	577-607	KEEKARKAAAKKADKERKKAKKAGGPDKGVE	cyto(12.5),cyto_nucl(10),nucl(6.5),mito(4),E.R.(3)	ARKAKEEKARKAAAKKADKERKKAKKAGGPDK (573-604, prob:0.998)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHM1	Uncharacterized protein	Low	5	1	355-376	FTSPYLKEWRVRRRVKEWTAMS	extr(7),mito(5),plas(5),golg(5),E.R.(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLP6	Uncharacterized protein	Low	9.6	1	33-58	TDSPHPSKTAKPPKRAKKHHVKVLGP	mito(11),cyto(8),cyto_nucl(7.5),nucl(5)	KTAKPPKRAKKHH (40-52, prob:0.897)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ80	Uncharacterized protein	Low	9.2	1	27-48	FHCTCRFQPRSQPTLRRRRALI	cyto(9.5),cyto_mito(8.5),mito(6.5),nucl(4),plas(3),extr(2)	RKKKEAEEEAKKAKESKIK (403-421, prob:0.828)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5G9	Uncharacterized protein	Low	5	1	95-115	LSTSWKKHSHLSRKEKDTVRD	plas(26)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6W0	Zn(2)-C6 fungal-type domain-containing protein	Low	8.8	1	1-37	MDPLSSPRPRKRRAINACVNCRTSKVRCDGHRPCQRC	nucl(10),cyto(6),mito(5),plas(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8L8	Uncharacterized protein	Low	9.1	1	421-441	ADAKRRRLSTRSRSRTPYIKT	nucl(14.5),cyto_nucl(9.5),mito(8),cyto(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8V1	Amidase	Low	9.1	2	6-26, 397-421	QSPAKWQHVSQRKKDEQYARI, LSPWLSTRLKRKKHTDLKQAQQLHG	pero(9),cyto(7),nucl(6),cyto_mito(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAY1	Uncharacterized protein	Low	5.8	1	331-353	DAAKEKREMKIEKERNRQRIENG	mito(17),cyto(6.5),cyto_nucl(5),nucl(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCD9	Beta-hexosaminidase	Low	5	1	87-113	EPFPGATTKASRRKNRRQYNAAPAGNC	extr(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFX3	PseudoU_synth_1 domain-containing protein	Low	7	1	50-71	PTESKKPFAVRRATRPPPKAFD	cyto(8.5),cyto_nucl(8),nucl(6.5),pero(6),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLV7	Zn(2)-C6 fungal-type domain-containing protein	Low	7	1	45-71	YISIACNECKRRKIKCNGNTPCQRCGN	plas(18),nucl(5),golg(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ77	Uncharacterized protein	Low	8	1	508-534	GEVSKGKQAHPSNRKHAWKKNVQAVPI	mito(21),cyto(2),pero(2),cyto_pero(2)	KLARRRQIKAGRGRNGQGKVKG (131-152, prob:0.875)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ86	Rhomboid domain-containing protein	Low	5	1	13-44	QLRCFSHTRVQHNPQRKPPTYPHQQPQQQPGP	plas(10),mito(9),E.R.(4),extr(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRU8	Uncharacterized protein	Low	7.4	1	131-154	RQAVLDKRKSYKRKRGCAFFRNLT	plas(9),cyto(7),nucl(6),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZP5	Uncharacterized protein	Low	6.2	1	78-98	NVPYTRQQRERPDTAKRRDRS	plas(23),nucl(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZR9	Uncharacterized protein	Low	8	1	133-158	AQPRASPSLDKKRSRTKRALHRIASL	plas(24),mito(2)	KKRSRTKR (143-150, prob:0.663)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1E8	Uncharacterized protein	Low	8	1	935-958	SFYVKSRKCAFRPKFNRQESNAAV	cyto(11),nucl(8),cyto_mito(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8D4	Uncharacterized protein	Low	7.8	1	3-27	DKPETPKKVPETKPPVKKPPHIWMM	nucl(9.5),mito_nucl(9),cyto(8),mito(7.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S900	Uncharacterized protein	Low	5	1	277-299	IDIDRPRPTKPRRGYFRGTPKIE	extr(21),plas(2),golg(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE46	PNPLA domain-containing protein	Low	9.2	1	24-48	FDPKDRRKLPFKIRNGKVQPKYKTK	cysk(14),cyto(8),nucl(4),cyto_mito(4),cyto_pero(4)	RKLPFKIRNGK (30-40, prob:0.643)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM20	Copper-fist domain-containing protein	Low	8.3	1	63-84	VKQCEHCRGARKSKSHHAKCDC	nucl(11),cyto_nucl(9.5),cyto(6),mito(4),extr(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPF7	Uncharacterized protein	Low	6.9	1	15-37	VFKNQYQKAKRDNTTKNSKRSGS	mito(21),nucl(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUV9	Uncharacterized protein	Low	9.4	1	79-111	IACSNCAKTKTKCDKKFPCTRCAQRNLKCTLRP	nucl(12),mito(5),plas(3),pero(3),cyto(2),golg(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWD0	Formyltetrahydrofolate synthetase	Low	8.9	1	16-40	REKLGAKIKERQEKNPRYRPMGDRS	cyto(15),cyto_nucl(10),mito(7),nucl(3)	PKKGKR (471-476, prob:0.686)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXN7	t-SNARE coiled-coil homology domain-containing protein	Low	8	1	266-286	DGAIVKARSRNRKKWWCLLVL	nucl(10.5),cyto_nucl(10.5),cyto(9.5),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHY6	Uncharacterized protein	Low	5	1	104-130	EDQERVIYRRRSNRPHQKPPASYNNYA	plas(24),E.R.(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ13	Uncharacterized protein	Low	8	1	78-105	RMRVARSKLKRLRKQKRLLKRREQQVFD	mito(9),cyto(8),mito_nucl(8)	VARSKLKRLRKQKRLLKRR (81-99, prob:0.969)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNL4	YDG domain-containing protein	Low	6.9	1	157-179	LKRWARTCPDKIHPKRSHRLGDL	mito(10),cyto_nucl(10),cyto(9),nucl(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQK9	Uncharacterized protein	Low	5	1	33-57	CIIFYKVCSKQRKREKAMRRMQEER	mito(13.5),cyto_mito(9.5),extr(7),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUC5	tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase	Low	8.3	1	263-282	DAAARKQRKREEGLARQQAL	nucl(12.5),cyto_nucl(12),cyto(8.5),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0N6	Uncharacterized protein	Low	5	1	1-21	MGVVKRPRRRISARRLSNFWT	mito(23),cyto(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5X6	Uncharacterized protein	Low	5	1	270-291	AHFPWSEKGRERRNKVDNSVAR	plas(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S630	Uncharacterized protein	Low	8.5	1	2-24	AFNNWDKLRKAQRDYPKPNKIAE	mito(15),nucl(9),cyto(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7C9	Uncharacterized protein	Low	5.8	1	140-163	VKRQVKCKFCRKYISEKARRCVNC	plas(18),E.R.(3),nucl(2),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD98	2-oxoisovalerate dehydrogenase subunit alpha	Low	5	1	2-21	SFRFSSRRIQLQRLRSPRAC	mito(22.5),cyto_mito(14),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIL2	Uncharacterized protein	Low	7.1	1	274-296	IYIGGHKKPKTIKKMIKDKDPNT	cyto_nucl(7),nucl(6.5),cyto(6.5),mito(4),plas(4),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9L0	Uncharacterized protein	Low	8.5	1	288-307	CPFGDKCRRGHVRRAARMRT	nucl(13),cyto_nucl(11.5),cyto(8),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9L6	Uncharacterized protein	Low	9.6	1	85-108	PPTPTDKPLRSKRSHNRKGTPTLG	nucl(18),cyto_nucl(12),mito(5),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9Z8	LDB19 domain-containing protein	Low	5	1	55-76	DIFNRHKHDKHAKDKDDLKKSP	mito(20),cyto(4.5),cyto_nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFI5	Uncharacterized protein	Low	8	1	164-192	IPSRTLMERSRKTRRPKKPVRNITLNVGH	cyto(11.5),cyto_nucl(7),extr(6),mito(5),E.R.(2)	RSRKTRRPKKP (172-182, prob:0.866)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIA5	5'-3' exoribonuclease 1	Low	9.9	1	87-106	GVAPRAKMNQQRARRFRTAL	cyto(13),nucl(5),pero(5),mito(3)	GRGGRGRGRGRGGRGRGGPRGG (1367-1388, prob:0.985)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJU4	Uncharacterized protein	Low	5	1	150-169	QPQASKRQAKMEKRGGQKMQ	mito(26),cyto_mito(14.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKA3	Uncharacterized protein (Fragment)	Low	9.2	1	1-22	MAKKKSKRSQKPVEPADRPDNV	nucl(17),cyto_nucl(13),mito(5),cyto(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPF1	Cytoplasmic tRNA 2-thiolation protein 1	Low	6.4	1	362-382	ASGNKPKKGFTPKKTSKQVMG	mito(16),cyto(6.5),cyto_nucl(6),nucl(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPI8	Uncharacterized protein	Low	7.4	1	166-193	VHETKTDKPISKRQQAKNKKAKMQEAGQ	mito(14.5),cyto_mito(9),nucl(8),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVI1	Aldehyde dehydrogenase	Low	5	1	452-472	MSVRYPPYTAKKQKEFTKMND	plas(12),pero(5),mito(3),cyto(3),E.R.(3),cyto_mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWK7	Uncharacterized protein	Low	5.7	1	1439-1458	CNNPQTKEPKLDRARRQVPE	cyto_mito(8.333),mito(8),cyto(6.5),extr(6),cyto_nucl(5.166),nucl(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZG5	Mtf2 domain-containing protein	Low	5.7	1	245-264	TTTADSKKKQQQQQPPKFKS	mito(23),cyto_nucl(3),nucl(2),cyto(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6L3	Uncharacterized protein	Low	8	1	520-543	LLAYGKWYRRRATKKSKEGPGSEW	cyto(6.5),plas(6),E.R.(6),cyto_nucl(4),mito(3),extr(2),golg(2)	KKKK (10-13, prob:0.634)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDZ5	S5A_REDUCTASE domain-containing protein	Low	5	1	193-214	LQGKRWYEKKFGKEKLQGRKAI	cyto(7),pero(7),cyto_pero(7),cysk(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHH9	Uncharacterized protein	Low	6.6	1	18-39	GSPSPSTSPPPRVRRIPRATTA	mito(16.5),cyto_mito(11),nucl(6),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJY0	Uncharacterized protein	Low	6.6	1	65-86	FPSRYWTKQIKEHERKQNQSVI	mito(10),plas(6),cyto(5),nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV57	Arrestin_C domain-containing protein	Low	9.3	1	786-811	LERTSDRQYRFSKKRSVERWKGVANV	nucl(13),cyto(8.5),cyto_mito(6),mito(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYJ5	Uncharacterized protein	Low	8.5	1	1-24	MYSSQRQPRSLKRSNSKESQNSYG	mito(14),nucl(9),cyto(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5V5	Uncharacterized protein	Low	9.3	1	484-511	GQENMGRGERSKKKRRFRSLSPVGRGTP	mito(18),nucl(4),cyto(4),cyto_nucl(4)	RGERSKKKRRFRS (490-502, prob:0.917)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6S4	Zn(2)-C6 fungal-type domain-containing protein	Low	7.8	1	6-45	KPSRGCGMCKSRRIKCDEKRPTCGNCKKSSRPCPGYPDDF	mito(14),nucl(7),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9B7	Uncharacterized protein	Low	5	1	457-476	DKRNRFLMKAQKMQKTQFKK	plas(15),E.R.(4),mito(3),extr(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFP9	Uncharacterized protein	Low	5	1	320-340	ITKVNIVKNNPSPRKNRRIGA	extr(21),plas(3),E.R.(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGD0	WD_REPEATS_REGION domain-containing protein	Low	9	1	171-196	REDATENNKKRKRKSKQEGTESEQAQ	cyto_mito(10.833),mito(10.5),cyto(10),cyto_nucl(7.833),nucl(4.5)	KKRKRKSK (179-186, prob:0.85)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIJ5	Protein kinase domain-containing protein	Low	8	1	756-780	RKVIAAPKKEVKKETPKPKPAEEDE	cyto(18),cyto_nucl(10.5),pero(6)	TRKVIAAPKKEVKKETPKPK (755-774, prob:0.852)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRB3	Uncharacterized protein	Low	9.5	1	232-253	LLLPWVKRRQRVEHRRRAQIEL	nucl(15),cyto(9),mito_nucl(9)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S398	Uncharacterized protein	Low	5	1	455-475	QEETQRELKMRRKRSLPPPAV	extr(8),golg(8),E.R.(5),mito(2),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S857	Uncharacterized protein	Low	8.3	1	1-22	MGFRSEKIKKTRSNRKSSWVML	mito(13),nucl(9),cyto(2),extr(1),pero(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFA5	Uncharacterized protein	Low	8.4	1	14-33	SPTFPAPLRRRSRQTLNSIE	mito(14),nucl(10.5),cyto_nucl(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLM5	Uncharacterized protein	Low	5	1	50-73	DVSPKCRPSPERKVSKHIEFRKYL	plas(24),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPN2	Uncharacterized protein	Low	9.3	1	219-249	IMQQTPPRRRPPPPKKKMKRGGPGRGRKRVI	mito(12.5),mito_nucl(9.833),cyto(8.5),cyto_nucl(7.833),nucl(6)	PRRRPPPPKKKMKRGGPGRGRKR (225-247, prob:0.999)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY05	TLC domain-containing protein	Low	8	1	67-96	MDFKSERAMRRSKRRTTRRYLSRAKRMCIR	plas(19),mito(3),golg(2),cyto_mito(2)	AMRRSKRRTTRRY (74-86, prob:0.807)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1D2	Uncharacterized protein (Fragment)	Low	8	1	309-333	LLFFCLRKRKPKPVRWNEKRQEGPK	extr(14),plas(8),E.R.(3)	RKRKPKPVRWNEKRQ (315-329, prob:0.855)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Y9	Uncharacterized protein	Low	6.2	1	375-397	APNARALRKAYKKMTKWQRSLLA	cyto(11),mito(6),pero(6),nucl(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGQ2	Uncharacterized protein	Low	9.2	1	12-32	PSDQDEKKPTPHQRKDSYQDD	nucl(15.5),cyto_nucl(11.5),cyto(6.5),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH35	Uncharacterized protein	Low	8	1	368-396	QQTRTPHHSPRKHASPRKQHPKTNSPNAT	nucl(10.5),cyto_nucl(10.5),cyto(7.5),mito(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMB6	Uncharacterized protein	Low	9.2	1	107-133	AEEGRARRNRSRGRFSKRLNRIRHSLA	plas(8),cyto(5.5),cyto_nucl(5),nucl(3.5),mito(3),golg(3),pero(2)	RARRNRSRGRFSKRLNRI (111-128, prob:0.874)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQX2	AflR domain-containing protein	Low	8.7	1	4-31	CCNYSPSMRLGKPRKHRNPDGSIKRDVS	mito(12.5),nucl(12),cyto_mito(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRS8	Uncharacterized protein	Low	6	1	145-165	QDELHRKARQGFKPNPNYRYY	mito(6),cyto(5),extr(5),plas(4),cyto_nucl(4),nucl(3),cyto_pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY98	Rab-GAP TBC domain-containing protein	Low	5	1	363-391	RDLQREQARKRALKKFKYMRLRLWYYRRY	mito(15),cyto(4),plas(3),cyto_pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Y8	Rap-GAP domain-containing protein	Low	7.3	1	1538-1557	SSSSWRNRLREIKRLRERYG	cyto(10.5),cyto_nucl(10),nucl(8.5),mito(4),plas(1),E.R.(1),golg(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S487	Uncharacterized protein	Low	5	1	431-450	ENESAKKKEHEEKHKAEQKE	extr(10),golg(9),E.R.(4),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8X5	1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase	Low	8.5	1	79-105	KADNKGKKSNMNSTKPQNKKHNSFLDV	nucl(12.5),cyto_nucl(10.5),cyto(7.5),pero(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIV1	Uncharacterized protein	Low	5	1	47-69	GTNPWPEYPRPRLQRPDWKNLNG	extr(22),golg(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRZ7	Uncharacterized protein	Low	5	1	52-72	AVFPVFAKRRRHKLVPNWVFF	plas(21),E.R.(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6D6	Uncharacterized protein	Low	9.9	1	1033-1055	YLECKRIIPQRPTLPRRRNSYEP	nucl(18.5),cyto_nucl(12),cyto(4.5),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKD6	Glutamine amidotransferase type-2 domain-containing protein	Low	8.2	1	1625-1652	DKTRGFMKYQRRSEKYRNPKTRTRDWAE	nucl(11.5),cyto_nucl(11.5),cyto(10.5),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM49	alpha-1,2-Mannosidase	Low	5	1	2-21	PGFRRWGKSKFERNPESSFK	extr(10),mito(9),E.R.(3),golg(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQY1	COP9 signalosome complex subunit 6	Low	5.8	1	239-260	DTGTRNTRSKQKEKGREKEKDA	cyto(17.5),cyto_nucl(11.833),cyto_mito(11.166),nucl(4),mito(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYA1	Uncharacterized protein	Low	9.6	1	184-207	NKEFRRVGDCRRHMRKHNPVKAYS	nucl(17),cyto_nucl(12),cyto(5),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2R3	Uncharacterized protein	Low	9.5	1	166-193	PYSPAVSRSRSPRKRQRHVDSQSRSRTP	mito(10),cyto_nucl(5),nucl(4.5),cyto(4.5),extr(4),pero(2)	RSPRKRQRH (175-183, prob:0.737)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8H1	Adenylyl-sulfate kinase	Low	7	1	6-30	TWHPSLSRDERNKFRKQKGFTIWFT	mito(15),nucl(6.5),cyto_nucl(6),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8R0	Uncharacterized protein	Low	5	1	17-36	VSLVRMKKGKKRFEIACYKN	cyto_mito(12.833),cyto(12.5),mito(12),mito_nucl(7.833)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCJ2	Methionine aminopeptidase	Low	6.6	1	36-58	CSQDCFKRNWGEHKKEHKSQSSI	cyto(14),cyto_nucl(12),nucl(6),pero(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJA3	Uncharacterized protein	Low	5	1	182-201	GSMKRQARRRTEQRLQKRSC	extr(16),cyto(7.5),cyto_nucl(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM13	WD_REPEATS_REGION domain-containing protein	Low	8.7	1	508-546	SPSWWERTPAIRKKQPYPETGKYVKIVRMPRKETKQEDT	nucl(13.5),cyto_nucl(11.5),cyto(8.5),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSM5	Aspartate--tRNA ligase	Low	6.5	1	141-163	PMSRGQLRKHERQAQQEERHKQN	cyto(10.5),cyto_nucl(8.5),pero(6),nucl(5.5),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3Q3	Uncharacterized protein	Low	5	1	536-557	IEEEREEKRRWPKWKKVYKFLC	plas(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6N6	Uncharacterized protein	Low	8	1	253-274	AESNPRKRIKRSKKPLGNLSLE	plas(22),mito(3)	PRKRIKRSKKP (257-267, prob:0.868)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7B2	Deacetylase sirtuin-type domain-containing protein	Low	9.4	1	28-52	ISINIGRKHKGHRQQAQQDRPWRNA	mito(13.5),cyto_mito(11),cyto(7.5),nucl(5)	RKHKGHRQQAQQDRPWRNAEKGRKGTGKGKGKRGK (34-68, prob:0.988)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7C2	Uncharacterized protein	Low	9.2	1	558-585	PKSPSGKILRRLLRDREKEKRRQAGGKL	cyto(15.5),cyto_nucl(11.5),nucl(4.5),mito(3),pero(2)	SGKILRRLLRDREKEKRRQAGGKL (562-585, prob:0.923)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAP9	Uncharacterized protein	Low	7.3	1	15-39	TLKILQFVRQLRRRVKPRVLEGSRA	mito(16),nucl(6),cyto(2),plas(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFG3	Dolichyl-diphosphooligosaccharide--protein glycotransferase	Low	8	1	724-751	HQSAVSFDKGHKKKRSTKRKGPRVLRVE	plas(23),E.R.(3)	KGHKKKRSTKRKGPRVL (732-748, prob:0.977)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIK2	Uncharacterized protein	Low	5.9	1	203-222	ATRAALLTRKEKKTKKCLIL	cyto(11.5),cyto_mito(11.166),mito(9.5),cyto_nucl(8.833),nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU32	Reverse transcriptase domain-containing protein	Low	9.8	1	424-449	ETNPLRRNTSRMRKFRRQYRSPLFQV	cyto(11.5),cyto_nucl(9.5),nucl(6.5),pero(5),mito(4)	KRRVRARKPR (607-616, prob:0.848)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVS1	60S ribosomal protein L27	Low	9.6	1	48-72	PSKVTRRMSKTKQAKKSKVKPFVKQ	mito(21),nucl(4.5),cyto_nucl(3.5)	SKTKQAKKSK (56-65, prob:0.707)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWR7	Uncharacterized protein	Low	8	1	521-545	EVPKLQSGKIKRKLMKEWAKKDAEK	cyto(26.5),cyto_nucl(14)	GKIKRKLMKEWAKKDAEKMNRAK (528-550, prob:0.835)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX08	Uncharacterized protein	Low	8.4	1	112-133	SPLDDFRKSRRWPPKGYRSEDA	nucl(12.5),cyto_nucl(10),cyto(6.5),mito(4),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZW0	Uncharacterized protein	Low	6.3	1	67-87	FYVPKEYKKQMKLKGTRKYPV	mito(12),cyto(7.5),cyto_pero(5.5),nucl(4),pero(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REA4	Mitochondrial GTPase 1	Low	8	1	308-332	APSFNQAKKMERERRRERNKARGEK	cyto(26)	KKMERERRRERNKARGEK (315-332, prob:0.963)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ73	Uncharacterized protein	Low	7.8	1	11-34	IMPPRELKQYKKWQCLHTNTKPAE	nucl(15),cyto_nucl(11.166),mito_nucl(10.666),cyto_mito(6.166),cyto(6),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLC3	Thioredoxin domain-containing protein	Low	8	1	245-274	PNPDCPPPKEKKSKPKKDTKKESKSSSKFA	cyto(12),cyto_mito(10.166),cyto_nucl(9.166),mito(7),mito_nucl(6.666),cyto_pero(6.666)	PKEKKSKPKKDTKKESKSSSKFAKA (252-276, prob:0.983)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLV6	Uncharacterized protein	Low	7.3	1	1569-1591	IPDAPGVRSKHRRHLHRLYPLIV	cyto(8.5),cyto_nucl(8.5),nucl(7.5),mito(4),plas(2),extr(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQK6	Uncharacterized protein	Low	5.7	1	6-30	APANETPKTERKSNRFRGMFKHRPD	plas(17),mito(3),nucl(2),cyto_mito(2),vacu(1),golg(1),E.R.(1),pero(1),cyto(1),cyto_pero(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT35	Uncharacterized protein	Low	8	1	571-598	AVSSRAFSRRSKKVRIRLNPKQGWRVSG	plas(17),E.R.(5),mito(2),vacu(2)	KK (582-583, prob:0.612)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXE0	Uncharacterized protein	Low	6.1	1	416-439	FWGTPDDKKMYNRRLRRSAQDSAE	cyto(12.5),cyto_pero(9.5),pero(5.5),mito(5),nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S903	WSC domain-containing protein	Low	5	1	235-255	ILFLLWRKRRRQQDQENGGGD	extr(21),plas(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFI3	Uncharacterized protein	Low	7.6	1	118-138	TWYNGKKSPYGYKKKHEQGTN	extr(10),nucl(8.5),cyto_nucl(6.5),mito(4),cyto(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFW2	Uncharacterized protein	Low	5	1	782-805	DLSRSKRKADYDEKKKTEKKVYKE	plas(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG15	Cutinase	Low	8	1	225-247	QIKATQTKIKARKAKREAEKAAA	extr(20),golg(2),vacu(2),mito(1),cyto(1),E.R.(1),cyto_mito(1)	IKARKAKREA (233-242, prob:0.789)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHQ9	MFS domain-containing protein	Low	5	1	509-528	QELAEKKSIQKEQKEKEVRE	plas(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN13	Uncharacterized protein	Low	7.9	1	41-64	SSSAVTNSKRKRDQNDESGNKRLR	nucl(12.5),mito_nucl(10.333),cyto_mito(7.333),mito(7),cyto(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTA2	Uncharacterized protein	Low	9.5	1	33-57	PEPASKPASKPRPQRRSPRKTLAAA	mito(22),nucl(4)	KPASKPRPQRRSPRK (38-52, prob:0.841)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYB0	Uncharacterized protein	Low	5.7	1	281-305	AQRPCACCVKRGRKCRVWHPEIKEE	cysk(11),cyto(8),nucl(2),mito(2),extr(2),pero(2),mito_nucl(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ79	SEC7 domain-containing protein	Low	7.3	1	1299-1321	YDQAARRNKGQKTKKPENSEVVV	cyto(12.5),cyto_nucl(12),nucl(8.5),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1U5	Uncharacterized protein	Low	8	1	327-350	DNEIWKRRKARSSRRRERLSKLDE	plas(20),E.R.(5)	KRRKARSSRRRERL (332-345, prob:0.928)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5Q7	Uncharacterized protein	Low	9.4	1	1-30	MDAHNGAVHPRKRRRRRRLDRPPISARLLL	mito(13.5),cyto_mito(10.833),cyto_nucl(7.333),cyto(7),nucl(6.5)	PRKRRRRRRLDRP (10-22, prob:0.977)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6L4	Glycerophosphocholine acyltransferase 1	Low	5	1	143-165	QLDKYKKRMRHSVDRLNRRWKES	plas(20),E.R.(2),golg(2),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJF4	Uncharacterized protein	Low	8.8	1	107-127	DSTPSKKKKTVTPKNNSTPKT	nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(3),extr(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP92	Uncharacterized protein	Low	9.9	1	37-62	TEHAVQPRRRRKTIWRRAKGYRWMLD	plas(13),nucl(5.5),cyto_nucl(4.5),cyto(2.5),mito(2),pero(2)	RRRRKTIWRRAK (44-55, prob:0.798)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR61	RRM domain-containing protein	Low	7.5	1	51-70	FTIFRWKADRTARQKRTNIC	cyto(9.5),cyto_nucl(9.5),nucl(8.5),pero(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV28	Uncharacterized protein	Low	7.6	1	2-32	SSTTDDPRASNKNRKNNRRYRSSSQKNSYIA	mito(10),nucl(8),cyto_nucl(6.5),pero(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2J8	Flavodoxin-like domain-containing protein	Low	6.7	1	1239-1262	MLVQRDHGDRKNRKHARLKYTIDD	cyto(16.5),cyto_nucl(12),nucl(6.5),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3C4	H/ACA ribonucleoprotein complex subunit CBF5	Low	9.9	1	441-499	AADADSKKSKKRKSRGDGEEEADEDKAERKKKKKEEKAAKKAAKKDKRKSKGGDDSNSD	cyto(21),nucl(5)	KKSKKRKSRGDGEEEADEDKAERKKKKKEEKAAKKAAKKDKRKSKG (447-492, prob:0.999)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4I7	HET domain-containing protein	Low	8.1	1	36-55	QYCSLQPKERRIRLLRIHAS	cyto_nucl(12.5),nucl(12),cyto(11),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5V7	Uncharacterized protein	Low	9.2	1	275-296	GELERKREEKREEKREEKRGMS	plas(13),mito(6),nucl(3),E.R.(2),vacu(2)	RKREEKREEKREEKRGMS (279-296, prob:0.871)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFR3	Uncharacterized protein	Low	5	1	33-54	ASQHAAQRQRRHSWHTRPCMHE	plas(18),mito(3),E.R.(3),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKP0	Uncharacterized protein (Fragment)	Low	5	1	36-60	KETGNRPRYYFPRHVKRQVVRANET	extr(24),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKR8	Enhancer of mRNA-decapping protein 3	Low	8	1	237-256	DEAGKKTRRGGKSRKKELAA	mito(11),extr(7),cyto(4),pero(3)	GKKTRRGGKSRKKELAAQERKN (240-261, prob:0.975)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWL7	Uncharacterized protein	Low	7	1	307-330	GMVYQFWKKKVRQRLTDSKKQALM	pero(8),cyto_nucl(6.5),nucl(6),mito(5),cyto(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4K0	Dihydrolipoyllysine-residue succinyltransferase	Low	8	1	198-217	QKPQPTKESKPQPPKKESKP	mito(26.5),cyto_mito(14)	QKPQPTKESKPQPPKKESKPQDEPKPATPGSREERRVKMNRMRL (198-241, prob:0.921)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAB2	Uncharacterized protein	Low	5	1	504-523	IAYVKEKKVRYKWVKEVEFI	cyto(20),cyto_nucl(11.5),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAI8	Hydrolase_4 domain-containing protein	Low	9.1	1	426-468	EEHRPERHEKPEKPEKPEKESKEKKEKKSSSRRKHGGSHTGSS	cyto(12.5),cyto_nucl(8.5),mito(8),nucl(3.5)	RPERHEKPEKPEKPEKESKEKKEKKSSSRRKHGGS (429-463, prob:0.997)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDV1	Uncharacterized protein	Low	9.6	2	220-247, 263-286	RLSKSITLRRRNFKYWKRHRDKLGAATG, SDTFYHYKTRRTKSKDWQDFSIRD	mito(12.5),nucl(9),cyto_mito(9),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REG6	Xanthine dehydrogenase	Low	5.8	1	255-279	EFKPLAFGNKKKKWFRPTTLQQLLE	cyto(22),cyto_nucl(13.5),nucl(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHM6	Uncharacterized protein	Low	6.6	1	1-25	MAPIKHKGRPKKTTQPKYGDLRTYF	mito(10.5),cyto_mito(10.5),cyto(9.5),nucl(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ82	Uncharacterized protein	Low	9.9	1	1823-1842	HATVRAKSPKTRPKSTSKLG	nucl(17),cyto(9),mito_nucl(9)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9M3	Uncharacterized protein	Low	8.1	1	875-904	DSWHLVKRVYQRTKQHENRKKASTKTKFSS	mito(10),nucl(8),cyto_mito(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFZ6	Uncharacterized protein	Low	8	1	331-352	IAVPKAAKRAKKGWRASKRNTM	plas(20),E.R.(5)	PKAAKRAKKGWRASKR (334-349, prob:0.939)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGF9	Telomerase reverse transcriptase	Low	9.1	1	42-65	LLSRLPSSSKTRHRRISQLGPSPM	nucl(14.5),cyto_nucl(10.5),cyto(5.5),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM71	Uncharacterized protein	Low	8	1	172-201	REVHRSRHGHRSRSPRYSHRSQSRSRRSYV	plas(21),E.R.(3),mito(2)	RSRHGHRSRSPR (176-187, prob:0.694)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMN0	Glutamate decarboxylase	Low	9.4	1	518-544	IEKQHANKGLKKEHKHKAQRPSSDGVY	cyto(15),cyto_nucl(11),nucl(5),pero(4)	LKKEHKHK (527-534, prob:0.666)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPG9	Uncharacterized protein	Low	9.4	1	73-94	LVSKWRDEVKKKQQPKKDGAVK	nucl(15.5),mito_nucl(10),cyto(6),mito(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS29	26S proteasome regulatory subunit RPN2	Low	9.7	1	927-951	STTAQDKRRRMVKERQKRRESMDVD	cyto(14.5),cyto_nucl(11),nucl(6.5),mito(2),pero(2),cysk(2)	RRRMVKERQKR (934-944, prob:0.694)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW42	Uncharacterized protein	Low	5	1	48-70	HFVTSKMYPKKKDPNAKPKILGF	cyto(8),extr(7),mito(5),plas(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWA2	Integrase catalytic domain-containing protein (Fragment)	Low	7.9	1	193-213	CDACGRSKSKRQIRRALRLND	cyto_nucl(10.5),nucl(10),cyto(9),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S374	Uncharacterized protein	Low	8	1	205-229	GTDPSKAPPTRKKRKIPRSGMPATI	plas(19),E.R.(4),golg(2),vacu(2)	KAPPTRKKRKIPR (210-222, prob:0.907)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S871	DUF1996 domain-containing protein	Low	8	1	461-488	VITYVTVNSKRRRHAHKHRREHGVLGRH	extr(21),mito(3),cyto(2)	KRRRHAHKHRREHGV (470-484, prob:0.895)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S890	SPX domain-containing protein	Low	8.2	1	640-663	FPSFSTSKYARKQQRKIQLPPGIR	plas(10),nucl(9),mito(3),cyto(3),cyto_mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAH2	Uncharacterized protein	Low	9.4	2	526-545, 1098-1126	QMSKVIKRCKRCSRFRSYDS, AWYDIKEKELWQRNRRSHRKTDKNYSRYY	plas(10),nucl(7.5),cyto_nucl(6),mito(4),cyto(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCJ9	Autophagy-related protein 1	Low	9	1	903-924	MRSRQRALKKKLDILKTQKRAS	nucl(15.5),cyto_nucl(12.5),cyto(6.5),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFM8	Uncharacterized protein	Low	8	1	215-240	RAIFGKKRINKIKIWRSKNKPVANML	cysk(11),cyto(8.5),cyto_pero(7),pero(4.5)	KKRINKIKIWRS (220-231, prob:0.674)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJW5	Uncharacterized protein	Low	9.3	1	194-223	SEPLRIEEKTKRRQRHTKHVKSKLHFTVLK	mito(23),nucl(3.5)	KRRQRH (204-209, prob:0.66)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLG0	Uncharacterized protein (Fragment)	Low	9	1	29-51	YSNVSLRRRKSSRRLFKDTLNYS	nucl(10),mito(9),cyto(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPB8	Fungal_trans domain-containing protein	Low	9	1	46-67	VNSLSKEHSKSRRQSRLENSSS	nucl(13.5),cyto_nucl(10),cyto(5.5),plas(3),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR26	Uncharacterized protein	Low	8.9	1	45-64	GQYQQAPPPKQKKDRGCLAA	nucl(15),cyto_nucl(11),mito(7),cyto(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRA1	Uncharacterized protein	Low	7	1	250-269	TQLWTKKMSAKWRLTPHRRH	mito(13.5),mito_nucl(11),nucl(7.5),cyto(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSI2	Uncharacterized protein	Low	5	1	288-309	AVYYMKSWWRRNSSRTRRSRSD	plas(19),E.R.(5),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY58	Zn(2)-C6 fungal-type domain-containing protein	Low	8.7	1	125-157	LDKRKRTETSCDKCKSRKQKCRKEPGHDACRYC	plas(14),nucl(10),mito(1),extr(1),E.R.(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZL0	Glycogen [starch] synthase	Low	7.3	1	557-582	DYMYDFTKKSKRQRINQRNRTERLSD	cyto(12),nucl(6),pero(6),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3K6	Uncharacterized protein	Low	7	2	233-252, 560-579	ADPEHKPDPKKTKNLDKWKF, HPTTSKDTKMQKRRLEAPNW	extr(14),mito(5.5),cyto_mito(3.5),E.R.(3),golg(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S953	Alpha-galactosidase	Low	5	1	71-90	DDCWQDPKGRDKKGKLQPAL	extr(20),mito(3),cyto(2),pero(2),cyto_pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAY9	Uncharacterized protein	Low	5	1	470-490	ASTRRSLKFPRGHLHRRHGAS	extr(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFM1	Uncharacterized protein	Low	6.1	1	10-39	HLWNYVSPRKTQQKREKPFAFKKPAIPIRN	mito(16.5),cyto_mito(11.5),cyto(5.5),nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH72	SET domain-containing protein	Low	8.7	1	11-35	TEDGTSLTKKRKQQKQQEVGTVSKK	nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHG6	Zn(2)-C6 fungal-type domain-containing protein	Low	9.1	1	31-50	CDQCRVRKIKCNGKRPVCLE	mito(16),nucl(11)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN41	Uncharacterized protein	Low	5.5	1	182-201	LSPRPQQASARNQKKKCTIL	cyto(17),cyto_nucl(10.5),mito(6),nucl(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUY6	Uncharacterized protein	Low	9.1	1	715-734	VRLNIYKKTRHRHTGKIMTL	nucl(15.5),cyto_nucl(12),cyto(7.5),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S945	Uncharacterized protein	Low	9.4	1	63-83	ESLYRKMGKLERKPNNCKPLS	nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9G0	Flavoprotein domain-containing protein	Low	5	1	145-166	NPMSRKQISKIRRKWNWIRVLP	mito(19.5),cyto_mito(13.5),cyto(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REE1	Uncharacterized protein	Low	9.4	1	4-27	KASTLVGKKRKKASSPFTHAWKNH	plas(15),mito(5),nucl(4),cyto_mito(4)	KKRKK (11-15, prob:0.673)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIU9	Uncharacterized protein	Low	7.4	1	294-313	LLVHRRQKLLQYLRRKERGG	mito(19),nucl(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ38	MFS domain-containing protein	Low	5	1	474-496	RMGPVWRGRRESREREREEREAE	plas(26)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ80	Uncharacterized protein	Low	7.6	1	20-43	LRHLSDMKYKDRRQRGPDQPVEFL	nucl(11),cyto_nucl(8.833),mito(6.5),cyto_mito(6.166),extr(5),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLS8	Uncharacterized protein	Low	9.1	1	775-794	GEAYERKTLRRRLDEARKIL	mito(12),nucl(11),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR39	Uncharacterized protein	Low	5	1	556-579	ESLRGRAWSRARRLPRRETFGRDT	plas(21),vacu(3),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSI0	Uncharacterized protein	Low	9.4	1	239-260	DSSGHSKRSRNRPSKSERMRTY	nucl(16),cyto_nucl(12),cyto(6),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWM5	Uncharacterized protein	Low	9.1	1	107-132	YQEVDEKMDKRRRARREAREQQERDE	mito(16.5),cyto_mito(11),cyto(4.5),nucl(4)	KRRRARR (116-122, prob:0.718)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWP4	Uncharacterized protein	Low	5	1	6-29	YLMPRYRSYSFRRRPRSYAFQLLA	plas(11),mito(9),golg(3),cyto(1),extr(1),E.R.(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXX0	Ribosomal_S17_N domain-containing protein	Low	7.9	1	20-43	FLNHKVGGPRKNTRNRRWYKEVGL	nucl(10.5),cyto_nucl(9.5),mito(9),cyto(7.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1A7	PPPDE domain-containing protein	Low	5	1	1-22	MSSSTRPKPSRKTSGQHHRSTL	mito(24),cyto(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S730	Uncharacterized protein	Low	8	1	91-111	SDPDKRARAKSRRPGGQRIAS	plas(18),mito(7)	KRARAKSRRPGG (95-106, prob:0.8)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJI0	ADH_N domain-containing protein	Low	7.3	1	28-47	QDEFQRRRSVPRPPERQHAL	mito(8),nucl(6),cyto(6),cyto_nucl(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJR1	Uncharacterized protein	Low	8.6	2	4-28, 37-62	PSLFAKSSKKSSKTREIPNLAPRPA, PPSPDKQSSHTRVKDRERSTRRSSSY	mito(18.5),mito_nucl(13.333),nucl(7),cyto_nucl(4.833)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S086	Uncharacterized protein (Fragment)	Low	8	1	148-171	GDEGSGKRRGKEKKDKEKARFKPY	cysk(14),cyto(10.5),cyto_nucl(7.5)	EGSGKRRGKEKKDKEKARFKP (150-170, prob:0.988)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S568	Uncharacterized protein	Low	8.4	1	101-121	LSLLRLKKRFARDKNNNEAVA	nucl(14.5),cyto_nucl(11.333),mito_nucl(8.666),cyto(6),plas(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5J8	Uncharacterized protein	Low	8	1	580-600	FLCVVARHIRRPKWMKRNKAE	plas(21),E.R.(4)	RRPKWMKRNK (589-598, prob:0.714)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5K0	Uncharacterized protein	Low	5	1	24-48	GVYPLRSRSRTRPPKRSSVDAKISE	plas(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S697	U3 small nucleolar RNA-associated protein 22	Low	9.2	1	1079-1101	ISSKYSLKSNKSRKSVPQFKNLD	nucl(15.5),cyto_nucl(11.5),cyto(6.5),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCR0	MCU domain-containing protein	Low	9.1	1	485-516	EKDEKVQHALKKERKRKEDKKKEKDEVDEDEP	mito(19.5),mito_nucl(13.166),cyto_mito(11.833),nucl(5.5)	LKKERKRKEDKKKEK (494-508, prob:0.969)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH37	4-alpha-glucanotransferase	Low	6.3	1	1474-1495	RALLKFDLKRRKTPEERIESYQ	mito(11),cyto_mito(8.833),mito_nucl(8.833),nucl(5.5),cyto(5.5),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPD1	Uncharacterized protein	Low	8.8	1	388-407	NESKWPSKRKGQQSGRDEKR	plas(22),nucl(2),E.R.(2)	SPRAEARKRRSIHIPAPP (440-457, prob:0.826)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ25	DDE-1 domain-containing protein	Low	7.4	1	9-32	GLVSRSKRIFSRRQWEKKEIQASL	cyto_nucl(10.333),nucl(10),cyto(8.5),cyto_mito(7.666),mito(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQN1	T5orf172 domain-containing protein	Low	8.3	1	379-401	HVPATSKKQQKTPTKVIQKPATG	nucl(9),mito(6),cyto(6),cyto_mito(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVT0	Succinyl-CoA:3-ketoacid-coenzyme A transferase	Low	5	1	442-461	TMEHTDKKGRPKILKQCEFP	mito(26.5),cyto_mito(14)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S301	Peptidase A1 domain-containing protein	Low	8.9	1	461-484	GIFFLWKKRRASKKSIKQTPNSSD	extr(14),nucl(3),mito(3),cyto(3),cyto_nucl(3),cyto_mito(3),mito_nucl(3)	KRRASKK (468-474, prob:0.69)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4E8	Phospholipid-transporting ATPase	Low	8.4	1	724-754	DLQSAKQKKKPIHKTRKKGKQPAKSRKSFRS	plas(24),nucl(1),cyto(1),cyto_nucl(1),golg(1)	KQKKKPIHKTRKKGKQPAKSRKSFR (729-753, prob:0.997)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S543	Leucine carboxyl methyltransferase 2	Low	7.9	1	4-30	TGSTPLKKGTSKPKGNQKTLRERRDVD	nucl(8),mito(7),cyto_nucl(7),cyto(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJI1	Bac_luciferase domain-containing protein	Low	8	1	12-33	AAKNGRRKSGRGKPGKKLIINA	mito(12),cyto(9),pero(4)	KRKRESGSEAAKNGRRKSGRGKPGKK (3-28, prob:0.989)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK94	Zn(2)-C6 fungal-type domain-containing protein	Low	8.8	1	14-57	GQSPPDPQFRVVRKRNRVPLSCGACRHRKLKCNRGHPCDNCTKR	plas(16),nucl(10)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKC8	Dolichyldiphosphatase	Low	8	1	251-273	SGWARWEDRRKRQTFQVQGKKRR	plas(18),mito(4),E.R.(3)	KKRR (270-273, prob:0.659)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ65	Uncharacterized protein	Low	8.7	1	5-41	SNTSNDFTRKRPYRSLRRACWECKKRKVHGHGMQTNA	nucl(10),plas(8),cyto(5),mito(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSW5	MFS domain-containing protein	Low	5	1	469-491	MHFALKRENKLRKEGKRDIWIQG	plas(23),E.R.(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5A6	Uncharacterized protein	Low	5	1	49-75	TYDNKKWNGFAKKRVNKNKIECKNGRV	extr(13),cyto(8.5),cyto_nucl(5),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REK5	Anaphase-promoting complex subunit 2	Low	9.6	1	630-652	PDARNTRTSQPRRPTRSTRKTTM	nucl(18),cyto_nucl(12.5),cyto(5),mito(1),plas(1),extr(1),pero(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHI1	Uncharacterized protein	Low	8.1	1	10-51	NSKPAPPRKSSDEQRRQSAALEGVGSRPRRAQRRPTKETSYE	mito(11.5),nucl(11),cyto_mito(8.5),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ21	GlcNAc-PI synthesis protein	Low	9.1	1	487-512	GEERGTLPRKRSSRHRKPKREESDES	cyto(9.5),plas(8),cyto_nucl(7),nucl(3.5),mito(2),pero(2)	PRKRSSRHRKPKR (494-506, prob:0.946)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK93	Fe2OG dioxygenase domain-containing protein	Low	5	1	26-45	SEEARRVHEQRTKRARRAEI	mito(22),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKN9	Uncharacterized protein	Low	9.7	1	177-201	WLQANKKGGCMEKKKKKKKKKKKKK	mito(15.5),mito_nucl(12.166),cyto_mito(9.833),nucl(7.5)	EKKKKKKKKKKKKK (188-201, prob:1)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUN5	Nascent polypeptide-associated complex subunit beta	Low	8.8	1	203-222	VSGKGTPRRKVKKVHKSAGT	extr(14),cyto(8.5),cyto_nucl(6),nucl(2.5)	KGTPRRKVKKVHK (206-218, prob:0.857)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZX4	Abhydrolase_3 domain-containing protein	Low	5	1	521-544	RCNEKSFSNKDKKSKINIKLTDKE	mito(8),extr(5),cyto(4.5),cyto_nucl(3.5),E.R.(3),golg(3),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S337	Deacetylase sirtuin-type domain-containing protein	Low	9	1	316-342	KEEIASKPTRKRKRASNGNGSRKKRSS	cyto(18.5),cyto_nucl(11.5),nucl(3.5),pero(3)	KPTRKRKRASNGNGSRKKR (322-340, prob:0.959)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4S1	DUF3669 domain-containing protein	Low	9.4	1	492-517	ACLIRPYLGRRRRHRQEETSKSRFQS	nucl(12),mito(7),cyto(5),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9Q6	PKS_ER domain-containing protein	Low	5	1	320-341	AADKKIKPWVQKRPMKEANKAV	cyto(16),pero(4),plas(3),mito(1),extr(1),E.R.(1),cysk(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAA5	Tyrosine--tRNA ligase	Low	9.6	1	389-419	EQKAYPPPPAVKKEKKVKNKGTFHPKRNVEA	cyto(18.5),cyto_nucl(13.333),nucl(7),mito_nucl(4.333)	PAVKKEKKVKNKGT (397-410, prob:0.848)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD77	Uncharacterized protein	Low	7.8	1	433-462	RKFLRASSTQRKHSKDRKLQRKQAEQGWIE	mito(11.5),nucl(10),cyto_mito(9),cyto(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGH1	Nickel/cobalt efflux system	Low	5	1	360-384	LSVLLYKPWRRRIDKKRVSNAHFEP	plas(23),E.R.(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKV3	Uncharacterized protein	Low	9.9	1	5-29	IHYLTGNKARKRQKRSTQLKEYFDD	nucl(19),cyto_nucl(13),mito(4),cyto(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMP8	Uncharacterized protein	Low	6	1	9-29	LSPYAPRPWATPKRRRGSVGS	mito(17),cyto_mito(11.833),cyto_nucl(5.166),nucl(4.5),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNP7	Uncharacterized protein	Low	9.9	1	176-199	VMQSVPRKGKHHNRAQKNKICLGE	nucl(19),cyto_nucl(13.5),cyto(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSX7	Fungal_trans domain-containing protein	Low	6.5	1	233-252	ITPRCSRSDKQQRRKLWQAI	mito(9),cyto(7),mito_nucl(7),nucl(5),cyto_pero(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT30	Uncharacterized protein	Low	9.7	1	37-63	STPAGPSVKRPSRKAKLPKDITERAKA	cyto(10.5),cyto_nucl(9.666),cyto_mito(8.333),nucl(7.5),mito(4),extr(3)	KRPSRKAKLPK (45-55, prob:0.747)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTZ2	WW domain-containing protein	Low	9.7	1	12-41	DYITKQIHKYEQQKRGRRSPPRANGYRQMP	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0P8	Uncharacterized protein	Low	8.1	2	70-93, 322-344	IESRPLRPSTKSHRRNPSKPTVSA, SQRCLEKNKGRFQKQRKNQGNSF	mito(8),plas(7),nucl(3),cyto(3),cyto_nucl(3),golg(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1B8	Uncharacterized protein	Low	8	1	368-388	EKESAKRRAFEKKQNEKADGK	cyto(11.5),mito(9),cyto_nucl(7),plas(2),pero(2)	KRRAFEKKQNEKADGKAAAPGKA (373-395, prob:0.766)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2S9	Uncharacterized protein	Low	8.6	1	23-51	NTHALGARRKQHREWRREEQQHIRHRLRS	nucl(12.5),cyto_nucl(11),cyto(6.5),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4K5	MYND-type zinc finger protein samB	Low	5	1	240-274	LLTCSKCKKRSYCSVECQKKAWKVHKKVCDSPKVS	cyto(13),cysk(8),cyto_pero(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5S1	Uncharacterized protein	Low	9.1	1	51-76	TGYGSRRWYKSRRAEKETGRRLLRRN	mito(11),cyto(9.5),cyto_nucl(7),nucl(3.5)	KSRRAEKETGRRLLRRN (60-76, prob:0.746)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Y6	Ribosomal_L30 domain-containing protein	Low	9.5	1	87-109	EVAYPKTKEQMRRERRPDRGYYV	nucl(16.5),cyto_nucl(11),mito(5),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFH0	Uncharacterized protein	Low	5.8	1	6-29	ACVPIPQRKPRLSPQQRREQLAQR	mito(17),cyto(7),nucl(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFX7	Uncharacterized protein	Low	8	1	457-476	GAGGGRSAKDRRKRTKMSEQ	plas(24),E.R.(2)	GGGRSAKDRRKRTK (459-472, prob:0.846)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJP1	TPR_REGION domain-containing protein	Low	5	1	28-47	LSPVKTWRPVQQQLARRHRS	mito(16.5),cyto_mito(10),plas(5),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM18	Carrier domain-containing protein	Low	6.1	1	50-69	RLPVTWSKKVDRKRLREIGA	cyto(6.5),cyto_nucl(5.5),extr(5),mito(4),nucl(3.5),plas(3),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPL3	Cyclin-dependent kinases regulatory subunit	Low	8.6	1	4-28	ELDIDFTRRNKKPRPLSEHEKEKLD	nucl(12.5),cyto_nucl(10.5),cyto(7.5),mito(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS10	Uncharacterized protein	Low	5	1	239-262	IAGLLLWRRKRNNKSNPYKPANAH	extr(26)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWS4	Uncharacterized protein	Low	5	1	367-391	GVKLCASCKKNWRRYIKTLPERAVE	mito(12),cyto(8.5),cyto_nucl(5.5),pero(3),plas(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3S3	Uncharacterized protein (Fragment)	Low	5	1	241-269	ECADAQTQRQRQQRRRQQRKQLDQHVLFL	extr(21),mito(2),cyto(2),pero(2),cyto_mito(2),cyto_pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCX2	Uncharacterized protein	Low	5	1	96-120	GNNVSKKTETKTRRKWTPNVLTKSL	mito(22.5),cyto_mito(13),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPY4	Rad51 domain-containing protein	Low	6	1	38-57	HANISKSKNKTNRLKTDVKS	cyto(17),cyto_nucl(12.833),mito_nucl(5.332),nucl(4.5),mito(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVU1	Transket_pyr domain-containing protein	Low	5	1	13-39	RYLLRPQTPFRPRCKRHAQLRQYSAAA	mito(22),cyto(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZS6	Uncharacterized protein	Low	7.4	1	197-217	AKCVIKIKKMSKEQQEKQKEA	cyto(11),cyto_nucl(11),nucl(9),mito(3),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5U1	MFS domain-containing protein	Low	5	1	524-548	AWPFIPWRSLKTKEKKDQKEEGMTE	plas(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S702	Uncharacterized protein	Low	8.6	1	37-58	PSTSREPVTRHCRRNRTKVYAT	cyto_nucl(15),nucl(14.5),cyto(10.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8X0	Brix domain-containing protein	Low	8.4	1	259-278	RSDLRKSKASRFNRRTDAQR	nucl(16.5),cyto_nucl(13.333),mito_nucl(10.166),cyto(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDQ6	Golgi apparatus membrane protein TVP38	Low	5	1	13-37	SGMMDPSQQKQKKKRDNGPPEETEY	plas(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMT2	Uncharacterized protein	Low	9.4	1	266-290	LGGIFFWRKRKQRKSAQDERRKEVE	extr(16),nucl(4),mito(4),mito_nucl(4)	KRKQRK (274-279, prob:0.695)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP22	Uncharacterized protein	Low	5	1	78-98	LEEKSRFTKPKTKPSPPNFTP	mito(21),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPL4	Zn(2)-C6 fungal-type domain-containing protein	Low	8.9	1	46-74	SVSNIRSRRERPCDACRRRKSRCVIHEGA	nucl(13),mito(9.5),cyto_mito(7),cyto(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSI9	Uncharacterized protein	Low	8	1	379-403	IWKNLTLDPKKRRWRRIVNNFWITL	plas(24),vacu(2)	KRR (389-391, prob:0.619)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTE7	tRNA-dihydrouridine synthase 3	Low	9.2	1	384-405	LPESDNKAPREKRKEREDEQPD	cyto(13),mito(9),nucl(3)	KRARVKEGALPESDNKAPREKRKER (375-399, prob:0.822)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXY7	J domain-containing protein	Low	8.9	1	486-518	AEAAAKKDAKHDKHDKHHHDKKEKEKKEKKEKA	cyto(10),cysk(10),cyto_nucl(7.5),nucl(3),pero(3)	KKDAKHDKHDKHHHDKKEKEKKEKKEKA (491-518, prob:0.994)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S347	3-hydroxyisobutyryl-CoA hydrolase, mitochondrial	Low	5	1	384-406	GVTARLIERKKERPNWKPNTIED	mito(17.5),cyto_mito(11.5),cyto(4.5),cysk(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7K6	Mannosyltransferase	Low	5	1	405-427	EQVKKVLPPCRTRKPPQVQGRGA	plas(24),E.R.(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGV1	Reverse transcriptase domain-containing protein	Low	9.5	2	16-37, 1203-1230	DTASKPKPKLAWARPPRSMKLD, NFGLSQFNKIKNKKQYQFPRKQEEGKKV	nucl(8.5),cyto_nucl(8.5),cyto(7.5),plas(6),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI87	Uncharacterized protein	Low	9.6	1	456-485	GYGGKKVTPEQARKKKKEEDYEVERRRRFE	cyto(8.5),cyto_nucl(7.5),mito(7),nucl(5.5),plas(5)	ARKKKK (467-472, prob:0.787)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIN6	Glyco_hydro_64 domain-containing protein	Low	5	1	2-28	KAFRSFISKRRQSYQSRKKANAPAPAS	mito(15.5),cyto_mito(10),pero(4),cyto(3.5),extr(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKT1	Uncharacterized protein (Fragment)	Low	7.3	1	81-102	FQNPNGLSRKQKRKNLQNLAAI	mito(8.5),nucl(7),extr(7),cyto_mito(6),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP63	Uncharacterized protein	Low	8.4	2	513-532, 576-598	FLSRSKSIHKLKSRLNKTRL, CTVSLKPNQHKLHKSPRLQRSDM	cyto(12),cyto_nucl(9.5),cysk(6),nucl(5),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWM2	MFS domain-containing protein	Low	5	1	587-612	FSAYYRKKLPWYVRKHVLRKNVEPME	plas(26)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0B0	Uncharacterized protein	Low	5	1	50-72	YPNDRNWCCMRRKRRPEPESMLT	plas(15),E.R.(5),extr(4),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5H6	MFS domain-containing protein	Low	5	1	414-433	SFIYKKSEKKDNFHRSHRII	plas(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Z3	Uncharacterized protein	Low	9	1	341-363	ATWTCERYKAHLRKTRRNEKLLD	nucl(13.5),cyto_nucl(10),cyto(5.5),pero(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REU1	ANK_REP_REGION domain-containing protein	Low	8.7	1	14-43	NDGERRRTQNRLAQRRFRNKQKSAGRPVDD	nucl(10),cyto(9),mito(4),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGM8	NADH:ubiquinone reductase (non-electrogenic)	Low	5	1	151-170	DENPENKKLKHKPKLVILGT	mito(14),plas(5),extr(4),cyto(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL32	Uncharacterized protein	Low	5	1	12-35	GCYRLPVQGVPRRKKHPSPSYYAG	mito(20.5),cyto_mito(12.833),cyto(4),cyto_nucl(3.333)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT36	Uncharacterized protein	Low	5	1	541-566	SSTWNSTKETKKVRIRLNPKTGWRVS	plas(15),E.R.(5),mito(2),extr(2),pero(1),golg(1),vacu(1),cyto_mito(1),mito_nucl(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTC8	Uncharacterized protein	Low	9	1	17-42	QGEQNEPKRNRQSRLSPPPPNSRLKQ	nucl(15.5),cyto_nucl(11.5),cyto(4.5),mito(3),plas(1),pero(1),cysk(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYD4	DNA replication licensing factor MCM7	Low	7.2	1	651-671	AYVRMRQQQKRDDGNKKAFTH	cysk(12),nucl(7.5),cyto_nucl(7.5),cyto(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYW3	Uncharacterized protein	Low	5	1	236-256	ARHVRQWWSNRQNKKRIDKIF	plas(23),mito(2),E.R.(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Y9	Uncharacterized protein	Low	7.3	1	152-176	PSVASRPLSQRKSARKRAGSTNSQW	mito(13.5),cyto_mito(9.5),nucl(8),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8E9	tRNA(Ile)-2-lysyl-cytidine synthase	Low	7.4	1	615-637	HVDVRDMKKRDRRLDKLQALGKA	mito(7),nucl(6),cysk(6),cyto_mito(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD74	Methionine aminopeptidase 2-2	Low	9.9	1	58-88	IDLKTNDGAKKKRKRNKKKSKKLSVVQQTSP	cyto(18.5),cyto_nucl(14.5),nucl(7.5)	AKKKRKRNKKKSKK (66-79, prob:0.997)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHR3	HET domain-containing protein	Low	5	1	410-437	AYMPSKVAKYRRVQKKQTSRTVARPYLQ	mito(10),extr(7),cyto(5),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIU4	Uncharacterized protein	Low	5	1	3-29	INSVYERWWRRGKRSSRPDSQRLESRS	plas(19),mito(4),E.R.(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP40	Proteasome endopeptidase complex	Low	5	1	213-239	TLMRNYKTPNTRQPKQRNYRFQRGTTA	cyto(20),mito(4),pero(2),mito_nucl(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S303	Fungal_trans domain-containing protein	Low	7.1	1	90-109	DIYKQQQQQQQQHQQHHPHE	mito(7),cyto_nucl(7),nucl(6.5),cyto(6.5),pero(2),golg(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5Z6	Uncharacterized protein	Low	8.8	1	5-27	DMTFICKKCKKAFRKDAREFEDA	nucl(13.5),cyto_nucl(9.5),mito(8),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S712	Uncharacterized protein	Low	8.8	1	256-276	TYIQTRKKYILNKKNRPVPLK	nucl(13.5),cyto_nucl(11),cyto(7.5),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7T0	Uncharacterized protein	Low	9.8	1	363-383	ERITREFKRMRVKPRPEVEEI	nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RC97	Na_H_Exchanger domain-containing protein	Low	5	1	3-22	LDPAKDARRRRSSSLVYKEP	plas(26)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGF5	Diphthamide synthase	Low	5	1	634-655	SDTTRLRHRASSHKLRHCREMW	extr(20),mito(2),E.R.(2),cyto(1),pero(1),golg(1),mito_nucl(1),cyto_pero(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGQ6	A_deaminase domain-containing protein	Low	7.6	1	629-650	DDGEARWKSYEKKRSNKKYLEL	cyto(13),nucl(7),mito(4),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR27	Uncharacterized protein	Low	9.7	1	12-41	TKKAIGPKSKVTKKPWTYKKYRNGKLDLMK	mito(15),nucl(5),cyto(5),cyto_nucl(5)	PATKKAIGPKSKVTKKPWTYKKYR (10-33, prob:0.855)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2N0	Uncharacterized protein	Low	5.9	1	458-477	AWKVGVKRRWWKGIKNGDVC	plas(9),mito(7.5),cyto_mito(7),cyto(5.5),nucl(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REA6	Uncharacterized protein (Fragment)	Low	8.8	1	95-114	GLKLHRAWKKREREDPHSAG	nucl(13.5),cyto_nucl(10),cyto(5.5),mito(4),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFV9	Uncharacterized protein	Low	7.5	1	290-316	EEKQREQEKEKDRNKDRAQQKPARSSS	cyto_nucl(11.833),nucl(11.5),cyto_mito(8.165),mito(7.5),cyto(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIM7	Uncharacterized protein	Low	5	1	265-286	EDKEGKKPFAKAKQRVTKCWVD	mito(15.5),cyto_mito(10.833),cyto(5),cyto_nucl(4.333),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKH7	AA_permease domain-containing protein	Low	5	1	401-420	IFWKVFKKTKWLKPHEVDLV	plas(23),E.R.(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM89	Uncharacterized protein	Low	9.9	1	528-551	RLDTEYRKFRTRRRITADGGKSKL	nucl(18.5),cyto_nucl(13),cyto(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPG8	Ubiquitin carboxyl-terminal hydrolase	Low	9.9	1	603-629	LEKAAKQKRKEMEQKRRENYRKQEEEL	mito(19),nucl(5),cyto(2)	GKGKEEKERKAHEKELEKAAKQKRKEMEQKRRE (588-620, prob:0.976)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRW8	RING-type domain-containing protein	Low	8	1	526-552	YVLLLLRSRIRRRRWRAPKSVVERLPV	extr(14),plas(9),mito(2),E.R.(2)	RIRRRRWRAP (534-543, prob:0.791)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSC0	Uncharacterized protein	Low	5	1	38-57	NGSTPEKKHGHRHARSEMNG	plas(18),E.R.(5),extr(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTU1	Uncharacterized protein	Low	8.7	1	427-450	ANEAATRCRSHKRKRVQAEGTLIV	nucl(12.5),cyto_nucl(10),cyto(6.5),pero(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU99	MFS domain-containing protein	Low	5	1	460-482	QMLQWTRKQRSNKGNMINERREA	plas(26)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVN5	Uncharacterized protein	Low	7.5	1	41-60	RSPKNPSNRLWVQKQQRRVF	nucl(7.5),cyto_nucl(6.5),plas(6),cyto(4.5),mito(3),golg(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAR4	ANK_REP_REGION domain-containing protein	Low	6.4	1	118-137	ETPEKKKKSGVQANTALRRR	mito(15.5),mito_nucl(11.333),nucl(6),cyto_nucl(5.333),cyto(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFC4	MFS domain-containing protein	Low	8	1	259-281	SGSDWLKHKRKRRSLFDKTALQD	plas(27)	KRKR (267-270, prob:0.643)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL20	MFS domain-containing protein	Low	5	1	578-599	LTPTASRSQGRRNTVRKRSSVP	plas(23),E.R.(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMA8	Uncharacterized protein	Low	8	1	312-333	VENPMAKPAKKRRPNWGPFITV	plas(18),E.R.(5),vacu(3)	PAKKRR (319-324, prob:0.68)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPS2	Uncharacterized protein	Low	6.7	1	1060-1081	GSTFCFCVKSRRAKPPPSLTLS	cysk(10),cyto(6.5),cyto_nucl(6.5),nucl(5.5),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUL6	Uncharacterized protein	Low	8.1	1	1-23	MPTLGFLKKKRTKDSNGSRDLDS	nucl(11),cyto_nucl(10),cyto(7),pero(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYR4	Uncharacterized protein	Low	8	1	389-417	HEVFPISKKIKKAKKSKKLPKSPIEAESG	cyto(15.5),cyto_nucl(11.666),cyto_mito(11.499),mito_nucl(6.499),mito(6)	KKIKKAKKSKKLPKS (396-410, prob:0.983)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6J7	Glutathione reductase	Low	6.1	1	82-101	FDWPYFKKKRDDYVKRLNGI	cyto(20.5),cyto_nucl(15),nucl(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7W8	Uncharacterized protein	Low	8.8	1	29-52	LERSSPKRSFCKKAIKNAPPPATH	mito(9),cyto(7),plas(4),nucl(2),extr(2),pero(2)	RGGPKSTWRKPESRGFKRRVGGKGP (91-115, prob:0.92)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9D3	Protein FYV4, mitochondrial	Low	8	1	222-241	RRKAEVRAKRRAAENKEKAR	mito(26)	RRGHKVDGGERRKAEVRAKRRAAENKEKAR (212-241, prob:0.985)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCX8	Mitochondrial intermediate peptidase	Low	5	1	27-49	HSSWICQRCLQQSQRPRRFNSTF	mito(21.5),cyto_mito(13),cyto(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF24	Uncharacterized protein	Low	9.7	1	41-66	VAPNARKEEVRRRRNPFNDMLRHKNG	nucl(17),cyto_nucl(11.5),mito(4),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLV3	Uncharacterized protein	Low	8	1	1-23	MAKTKPADRRSDRNAKNGTKKAG	plas(19),mito(5),cyto(1),E.R.(1),vacu(1)	PADRRSDRNAKNGTKKAGATKESKKPK (6-32, prob:0.91)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTD5	Uncharacterized protein	Low	6.9	1	606-631	VCLYAFRWRIRQRVWRWRTRREVWAV	plas(10),mito(6),nucl(5),E.R.(3),cyto(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY20	Uncharacterized protein	Low	8.8	1	206-231	VDNHKKPNPTRIKWFKKVGEKVHKSL	mito(21.5),cyto_mito(12.5),nucl(3)	IKWFKKVG (217-224, prob:0.637)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5H7	3-phytase	Low	6.9	1	60-79	LNTKDFSKWDQLKYRRRLET	cyto(8),nucl(6),mito(6),pero(6),mito_nucl(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6G6	Uncharacterized protein	Low	5	1	223-242	FPVKNKREEHLQRVRQKQNM	mito(16.5),cyto_mito(12),cyto(6.5),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE79	NADAR domain-containing protein (Fragment)	Low	9.8	1	1-20	MGKRKPHRAGRPQKTLPTEE	mito(13.5),mito_nucl(11.333),nucl(8),cyto_nucl(6.833),cyto(4.5)	KP (5-6, prob:0.606)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNW9	Nicotinamide-nucleotide adenylyltransferase	Low	9.3	2	23-47, 229-248	LENYTFPKERLKKRLSNPKKQPIVL, VSSTKIRLFRKRGKSIRYYI	cyto(10),nucl(7),pero(5),cysk(4),mito_nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZU1	Fn3_like domain-containing protein	Low	8.7	1	47-75	DPLAFDSKIRRKKSKGDLKIRRTSYRDRD	plas(20),nucl(2),cyto(2),cyto_nucl(2),pero(2),cyto_pero(2)	IRRKKSKGDLKIR (55-67, prob:0.846)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4E7	MYND-type zinc finger protein samB	Low	6.4	1	216-245	WEEYTRQFAKCRRCRRTKYCSKECQKSAWV	cyto(13),cyto_nucl(10),nucl(5),mito(4),cysk(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6F4	Uncharacterized protein	Low	6.8	1	390-417	YPTGPHQCSTKKPNNPPPRPQPKPYPTG	cyto(10),cyto_nucl(9),nucl(6),mito(5),plas(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPV8	MFS domain-containing protein	Low	5	1	456-480	AWVAKICFMRKNKKLREDSDNQTFF	plas(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQY8	Delta 8-(E)-sphingolipid desaturase	Low	5	1	496-517	IHHLYPRIPRHNLRKTQKLVQD	mito(16),cyto(4),cysk(4),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSW7	Uncharacterized protein	Low	6.1	1	471-496	TNRNLLQPTKENKRRRRSQIQDIQAS	plas(18),nucl(3),vacu(3),cyto(2),mito_nucl(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVI9	Uncharacterized protein	Low	7	1	345-365	GAYLKSVWRNHRQSKERMIPY	cyto(8.5),cyto_nucl(8),nucl(6.5),plas(4),pero(4),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWG2	Uncharacterized protein	Low	6.5	1	196-221	PSVPSNRSPTRKKQTQKRVQRPTTAA	plas(16),nucl(4),E.R.(3),cyto(2),mito_nucl(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3I1	Uncharacterized protein	Low	8	1	556-580	AGELKKRDARRIGRPKTWKGGKRGL	extr(25)	KKRDARRIGRPKTWKGGKRGL (560-580, prob:0.972)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAE4	Uncharacterized protein	Low	6.8	1	74-94	VYRQHLRWKKNLSRVKPHYAV	cyto(14.5),cyto_nucl(13),nucl(6.5),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJT3	Peptidase_M14 domain-containing protein	Low	5.4	1	238-257	TSNRLWRKNRQPRPSINSTC	extr(21),mito(3),nucl(1),cyto(1),cyto_nucl(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RME9	Uncharacterized protein	Low	5	1	1-23	MPTPRRSKRTKTHHEPEKQPVEA	mito(13),cyto(9.5),cyto_nucl(6),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNP0	A_deaminase domain-containing protein	Low	6.5	1	76-95	QDSHDTLKSRKKNRMDNTEE	cysk(12),cyto(6),nucl(4),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPU9	Uncharacterized protein	Low	7.9	1	258-280	CPETPVAGRRKRTRDWRWTLGPL	mito(16),nucl(9),cyto_nucl(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVQ0	Uncharacterized protein	Low	9.7	1	150-169	TTVAPKKKPTPKKLITHYQI	nucl(16.5),cyto_nucl(11.5),mito(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY94	Uncharacterized protein	Low	9.3	1	335-356	QQYTNKRKIWHKLYRDYRQRYL	nucl(13),cyto_mito(6),mito(5.5),cyto(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0G0	Uncharacterized protein	Low	8	1	24-55	AKEPRVETKEPPKKSPKKSPKKSRGCLPAFLG	plas(25)	RVETKEPPKKSPKKSPKKSR (28-47, prob:0.973)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S483	MYND-type zinc finger protein samB	Low	6.6	1	28-58	GCRHSRYCSKDCQKKAWPDHKKVCKTLRGIK	cyto(11.5),cyto_nucl(9),pero(9),nucl(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4C2	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	Low	7.2	1	57-76	GERPGKRIKLDQPKEHKANF	cyto(13),cyto_nucl(11.5),nucl(8),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9H5	Mannosyltransferase	Low	5	1	549-578	SRSGQHWTRQDPKFKRNYRREWPQNLVFFE	plas(20),E.R.(3),mito(2),cyto(2),cyto_mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9P2	Uncharacterized protein	Low	5	1	65-84	LGKSWYKKERIKQITKEAGW	cysk(26)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RED0	Zn(2)-C6 fungal-type domain-containing protein	Low	9.8	1	4-29	VPKSTGCFICRKRKIKCDETWPTCLN	nucl(12),mito(9),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF06	Uncharacterized protein	Low	7	2	616-640, 735-757	PQPSEPPPPKWRARRFPHRPYEITP, AEAAKPEQWKKTQKEKQMLVNSS	plas(10),extr(7),E.R.(6),golg(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJH4	RNA_ligase domain-containing protein	Low	5	1	338-358	GEIKKIAKAWYKKRVRVEVGS	cyto(20.5),cyto_nucl(11),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN82	Uncharacterized protein	Low	6.4	1	22-42	AEMKTDRNTKKQKRAQGQYVS	cyto(8.5),mito(8),cyto_nucl(7),pero(5),nucl(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQD8	Uncharacterized protein	Low	5.4	1	21-44	NSTAGTCTRRRARLPQHNPWPTHG	mito(21),cyto(3),nucl(1),plas(1),pero(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSW2	Uncharacterized protein	Low	8	1	820-839	LEPCTPSRQHTRKVWNGDRG	cyto(9),pero(9),cyto_pero(9)	KARKEAETRKKR (63-74, prob:0.733)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW82	Uncharacterized protein	Low	5	1	76-99	LAPLLRRQQRRERRGYKPPQVWWG	mito(22.5),cyto_mito(14),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3C1	Uncharacterized protein	Low	7.1	1	62-84	CHEALIRRRWLRKSPSQRRDVLL	cyto(9),cyto_nucl(9),nucl(7),mito(4),pero(3),plas(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6B6	Uncharacterized protein	Low	9.3	1	36-55	SPPMLRPKRSSLKPSLKSSE	nucl(14.5),cyto_nucl(10),mito(9)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKR1	Aminotran_1_2 domain-containing protein	Low	5.8	1	635-654	DKEKMPKPPRWRLEEVLKRT	mito(12),cyto(4.5),plas(4),cyto_nucl(4),nucl(2.5),extr(1),pero(1),E.R.(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLM7	Uncharacterized protein	Low	8.7	1	1-24	MVPFRRLSQRSRRRSSENRDSYEW	nucl(13.5),cyto_nucl(9.5),mito(9),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMS6	Dolichol kinase	Low	5	1	20-47	QLLRRSPHPYLRHRDQVRRQSPNRSDDP	plas(24),E.R.(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP14	TPR_REGION domain-containing protein (Fragment)	Low	6.9	1	235-262	SDPDSKVCMKLRRREKNLEKDIQKVRKY	cyto_nucl(9),cyto(8.5),mito(8),nucl(6.5),extr(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ03	Acyl-coenzyme A oxidase	Low	5	1	77-100	ERALAREKRLRNLKKQHSWTTEEF	pero(13),cyto(9),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ27	Uncharacterized protein	Low	6.2	1	25-56	QASYLHWHKKPTKAFQKTTKHLKKSNVTHPHW	plas(9),cyto(6.5),cyto_nucl(5.5),mito(5),nucl(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0R1	Uncharacterized protein	Low	6	1	26-45	ALLFCWKRSQRRMRGFSLRA	extr(7),plas(6),mito(4),nucl(3),E.R.(3),pero(2),golg(2),cyto_mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5W4	Uncharacterized protein	Low	8.2	1	50-73	RVSNSPSSKRRHSRIVKIPPELQN	nucl(9),plas(7),cyto_nucl(7),cyto(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S966	Carrier domain-containing protein (Fragment)	Low	5	1	1277-1298	TLPVTWSKKIDRKRLREVGSTF	plas(11),mito(6),E.R.(3),cyto(2),pero(2),cyto_pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDJ7	Uncharacterized protein	Low	5	1	111-132	VGKFAVKKVKKRWDKSHGYGDE	cyto(17),mito(9),cyto_pero(9)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE26	DUF1713 domain-containing protein	Low	9.9	1	271-306	MYMISVKRQRKLKMKKHKYKKLMKRTRLLRRKLDRT	mito(20),nucl(5.5),cyto_nucl(4)	KRQRKLKMKKHKYKKLMKRTRLLRRKLDR (277-305, prob:0.995)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHW5	ABC1 domain-containing protein	Low	8	1	45-80	PLRPPNPADLPKPRKRKIKPPFTRRKWVRRLAVISA	mito(20.5),cyto_mito(13),cyto(4.5)	PKPRKRKIKPPFTRRKWVRR (55-74, prob:0.984)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIZ8	Uncharacterized protein	Low	9.1	1	901-946	MDMMMKKMKHFKPPNQQKPKASKPKSKSAKGKKNDSKSKKAATKEA	mito(15.5),cyto_mito(11.333),mito_nucl(11.166),nucl(5.5),cyto(5)	KKMKHFKPPNQQKPKASKPKSKSAKGKKNDSKSKKAA (906-942, prob:0.996)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJA9	RT_RNaseH domain-containing protein (Fragment)	Low	7.8	1	178-197	LEYFRSKRHLNRRQARWAEF	cyto(12),cyto_nucl(12),nucl(10),cysk(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJZ1	FHA domain-containing protein	Low	9.6	1	499-521	TRSTGLRSVRKTHKQYYWKKPRV	nucl(18.5),cyto_nucl(14.5),cyto(7.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRD0	Spindle pole body component	Low	8	1	727-749	KNAAWKHRSKNPRIEQWKRRAWT	mito(25)	PPAGSGERRTEKKEVRERETETRRTRSPLK (104-133, prob:0.78)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTA3	Dimer_Tnp_hAT domain-containing protein	Low	9.7	1	31-59	ASPEPASKPASKPRPQRRSPRKTLAAASQ	mito(18.5),cyto_mito(11),nucl(6)	KPASKPRPQRRSPRK (38-52, prob:0.841)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU07	Uncharacterized protein	Low	9.2	1	141-172	GEKGGKKPKVARRLLRPPKKVGKAGKEKRIEE	cyto(18),mito(4),nucl(3)	GEKGGKKPKVARRLLRPPKKVGKAGKEKRIEEEKARRSQAEKK (141-183, prob:0.999)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWM0	Uncharacterized protein	Low	5	1	546-567	AEWYSTCKNWNKWKNGSQHVWD	extr(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1F3	Non-specific serine/threonine protein kinase	Low	9.4	1	1-21	MAPHKTPKIKKHTPNASTPTG	nucl(15),cyto_nucl(10),mito(9)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S505	Prolyl-tRNA synthetase	Low	9.6	1	14-48	LSISETKKSKKDGNPQKAPKKPQQQKKKIEGSALI	cyto(10.5),pero(9),cyto_mito(7),nucl(5)	KKSKKDGNPQKAPKKPQQQKKK (20-41, prob:0.913)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAH4	Uncharacterized protein	Low	7.6	1	352-374	KSLLVKKKEAQSKRTQQPPTNTV	nucl(9.5),cyto_nucl(9.5),cyto(8.5),mito(5),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCD0	Uncharacterized protein	Low	5	1	1-20	MPPNAKPDERRTFRRRYVGA	extr(13),E.R.(4),golg(4),mito(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKI5	Mitochondrial import inner membrane translocase TIM40	Low	5.9	1	303-323	SLDSEKEKSKQKPKGETDTER	mito(21),mito_nucl(13.333),cyto_mito(11.833),nucl(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMD7	Uncharacterized protein	Low	5	1	606-628	VDRRGERRPARTKTTRTWEKNLE	plas(12),mito(6),extr(3),vacu(3),cyto_mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQR1	MFS domain-containing protein	Low	5	1	743-764	GMEWRSVKVKRPTRDEEKQGPS	plas(21),mito(3),E.R.(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSC3	PNPLA domain-containing protein	Low	9.7	1	497-518	LKPEDTRREPPKPEARKGSRAF	mito(18),nucl(5.5),cyto_nucl(5),cyto(3.5)	PPKPEARKG (506-514, prob:0.675)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVJ6	MFS domain-containing protein	Low	7	2	586-611, 642-662	MTTTITSDKHQRRKLQKRNSSSRASS, VPLQRSRPPSHQRTRSRSQGS	plas(22),mito(2),extr(1),E.R.(1),vacu(1),cyto_mito(1),mito_nucl(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1V1	Uncharacterized protein	Low	8	1	48-75	SLTRPSTAAKPIRNKKKRVTQDEDEDED	plas(19),E.R.(5),pero(1),golg(1),vacu(1)	RNKKK (60-64, prob:0.629)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1X3	Uncharacterized protein	Low	9.1	1	350-376	DKEQLAKKVKKGKKGGRRAHHDRFGSS	cyto(15),cyto_nucl(10.5),nucl(4),mito(3),extr(2),pero(2)	AKKVKKGKKGGRRAH (355-369, prob:0.975)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S523	DUF1681 domain-containing protein	Low	7.8	1	246-270	PPPPSAKSVKEERRRSRQNFDPSSV	cyto_nucl(14.333),nucl(13),cyto(11.5),cyto_mito(7.832)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5A9	Uncharacterized protein	Low	7	2	43-62, 82-105	TETKWQSWRNWVKWKTHWNW, IISMPFAKHTRRTRRQIRAFWLVV	plas(21),mito(2),E.R.(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S681	Uncharacterized protein	Low	7.7	1	44-65	MLGFIKQRQRRMERNRAQQVVL	plas(9),nucl(7),cyto(6),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKU6	Uncharacterized protein	Low	7.3	1	17-36	YPPYAPPQQQQQQQPPQQPN	mito(9),cyto_nucl(8),nucl(7.5),cyto(7.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPG7	Uncharacterized protein	Low	6.4	1	172-194	LQQSSEQPKKHRRTNSLPSKGRT	cyto(12),cyto_nucl(9.5),cysk(8),nucl(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ94	Uncharacterized protein	Low	9.2	1	157-177	LSNRFIERNRASRKNRKALEE	nucl(16),cyto_nucl(13.5),cyto(9)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUS0	Uncharacterized protein	Low	8	1	184-206	DLVLVEQKKRKRHCGQHREVIVL	cyto(13),cyto_nucl(13),nucl(11)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S046	Uncharacterized protein	Low	7.8	1	450-469	RSAKRSAKGKEKPTNTEPFK	nucl(10.5),cyto_nucl(10),cyto(8.5),pero(4),extr(1),golg(1),cysk(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2T3	Integrase catalytic domain-containing protein (Fragment)	Low	8.6	1	41-61	DPTVIRWPKNLRKQVRVPMID	nucl(13),cyto_nucl(11),cyto(7),mito(3),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4I0	Uncharacterized protein	Low	8.6	1	75-96	NESVDEKKRKRISRFREELDFE	nucl(17.5),mito_nucl(12.666),cyto_nucl(11.333),mito(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7D9	Carboxypeptidase	Low	5	1	545-566	QTQVDRLRKSHKHSYGQKKREL	extr(23),vacu(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDL7	Uncharacterized protein	Low	7.7	1	250-272	RKLGRTEKKWRMQWMPRSPRLKY	mito(15),nucl(8.5),cyto_nucl(6),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RED9	Uncharacterized protein	Low	5	1	32-55	QLPAQDRKRKDTYARKRNNSASSL	plas(19),mito(3),E.R.(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJD8	Uncharacterized protein	Low	6.1	1	439-467	EENKKLRAASQRQQRKQDQRRQYIARGGA	mito(19),nucl(3),cyto(3),cyto_nucl(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL75	Uncharacterized protein	Low	5	1	59-82	NYDPLARSRLRRRGNKQLPPSRYQ	mito(25.5),cyto_mito(14)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLF7	Cell division control protein 42 homolog	Low	8	1	180-199	EPPAAKKEGGERKKGKKCSI	cyto(27)	AKKEGGERKKGKK (184-196, prob:0.85)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPR7	Decapping nuclease	Low	8.5	1	8-35	TASTGLPPRSPPRKRPRTRAPPQAAASA	mito(19.5),cyto_mito(12),cyto(3.5),nucl(2)	RSPPRKRPRTRA (16-27, prob:0.84)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRP6	Uncharacterized protein	Low	8.9	1	15-43	SQDPARDEPKKAKSRRPPNTAFRQQRLKA	plas(19),pero(3),nucl(2.5),cyto_nucl(2.5)	KKAKSRRP (24-31, prob:0.723)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS94	Uncharacterized protein (Fragment)	Low	6.8	1	338-360	DLTYRNTRRIKKGPKPETDRYDP	cyto(13.5),cyto_nucl(11.5),nucl(6.5),mito(3),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZY2	Uncharacterized protein	Low	6.9	1	34-58	GLWERVADRRQQHRQKAKDSKQDGE	cysk(10),cyto(8),cyto_nucl(8),nucl(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1A0	Uncharacterized protein	Low	5	1	52-71	SSFPSWWHTRKQHRHLWMLS	extr(9),mito(6),cyto(5),plas(4),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5B6	Catalase	Low	6.9	1	523-546	ADPPTQQTRPKHNKKAKGLSQMDF	cyto(18),nucl(5),mito(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5M5	Uncharacterized protein	Low	8.7	1	98-122	GVDQAAQPKHKKKNRHAYHNIEGPG	cyto(12),nucl(10),mito(2),plas(1),extr(1),pero(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Y7	Uncharacterized protein	Low	8.5	1	265-292	KDLTVRIESKKQRNKNTKQTRVVKKTVP	nucl(14),cyto_nucl(14),cyto(12)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAG7	Chitinase	Low	8.2	2	1195-1216, 1579-1598	DACQWTPKQSTKKRRDSDDDDD, DTESEPGRRNHQRHFRHQMA	extr(11),nucl(3),mito(3),pero(3),vacu(3),mito_nucl(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCQ6	Uncharacterized protein	Low	7.8	1	25-44	TPTPSRPRELKPLRAARKAG	nucl(13),cyto_nucl(10.333),mito_nucl(10.333),mito(6.5),cyto(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD82	GPI inositol-deacylase	Low	8	1	105-128	TMVEGHNRKWRRRLRSPWAPSPYM	plas(26)	KRKKRP (1137-1142, prob:0.809)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGH9	DHHA2 domain-containing protein	Low	6.9	1	400-421	GNEWRRIWWQRQVQHSRKRVAP	mito(17),nucl(5.5),cyto_nucl(4),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHE9	Uncharacterized protein	Low	6.3	1	37-58	AYTLPRLPHPPHPQRPNPKTST	cyto(11),cyto_nucl(8.833),cyto_mito(8.833),nucl(5.5),mito(5.5),extr(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ47	Uncharacterized protein	Low	5	1	252-275	LIGYCCWWRQSRRKKREALYPSQQ	extr(24),plas(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL65	Uncharacterized protein	Low	9.5	1	315-340	GEWSTEKDVKPKKNHHHHHHHHDDDD	nucl(17.5),cyto_nucl(13),cyto(5.5),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPP5	Uncharacterized protein	Low	8	1	542-563	MGNGERWRKKSKKSMLGRTVFW	plas(23),mito(3)	RKKSK (549-553, prob:0.634)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRW7	Uncharacterized protein	Low	5	1	47-70	NDQEKACKKKCYHYKPMYKPCPVT	mito(11),cyto(7),extr(5),pero(2),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV66	Uncharacterized protein (Fragment)	Low	5	1	704-725	AMFFVARRYRNKRLAHQRSSSV	extr(18),mito(4),cyto(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S039	Uncharacterized protein	Low	9.9	1	7-28	PPPHLLIHKREKKKEESKKDMD	mito(15.5),mito_nucl(12.333),nucl(8),cyto_nucl(6.333)	KREKKK (15-20, prob:0.672)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1X5	Carn_acyltransf domain-containing protein	Low	9.9	2	77-96, 114-139	KLQKRLVERREDPKHKNWIY, YVSYFYSHRDDKKRRNPVKRAAAIST	nucl(10.5),mito_nucl(9),mito(6.5),cyto(6),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAH6	Zn(2)-C6 fungal-type domain-containing protein	Low	7.6	1	17-45	AQHTRTYQACIPCRRRKVRCDLGPVDNPH	plas(11),nucl(7),mito(3),cyto(3),cyto_mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIL0	MFS domain-containing protein	Low	5	1	586-608	ENRYEEVKRAKMQRKQSARSANG	plas(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSB8	Uncharacterized protein	Low	9.9	1	129-150	QQPPQQQQQQQQQQQRQPQPQY	nucl(19.5),cyto_nucl(13.5),cyto(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTE8	Uncharacterized protein	Low	5.8	1	135-155	DLQKHFQYAKKNENHNRRRIY	cyto(9),mito(7),pero(3),nucl(2),plas(2),golg(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUH7	Uncharacterized protein	Low	8.7	2	160-180, 203-224	QVNQAPKQRRRTYRAHGRINP, PQSLERRMNSRQRGRAVRKAIT	mito(14.5),cyto_mito(10),nucl(6),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWH5	Translocation protein SEC62	Low	8	1	316-338	PEDIKAKKAAKKEKKAAKLAAKA	plas(11),cyto(5.5),pero(5),cyto_nucl(4.5),E.R.(3)	KAKKAAKKEKKAAKLAAKAASGKQKK (320-345, prob:0.993)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4A7	Uncharacterized protein	Low	5.9	1	33-52	QPGAKGRMKNHCRKFWWCDC	extr(7),cyto(5),plas(4),cyto_nucl(4),cyto_mito(4),nucl(3),mito(3),mito_nucl(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAV8	Uncharacterized protein	Low	8.7	1	84-104	TANTKFCYRHRPDLLCRRQAD	nucl(12.5),mito(11),cyto_nucl(8),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCR4	Uncharacterized protein	Low	5	1	62-82	VLKANSKKRGTCNKNNVAVRR	extr(26)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLQ1	Septin-type G domain-containing protein	Low	8.5	1	48-72	FSTTIKNYADHKRRHHKQMDKTVEI	nucl(11),cyto(10),mito(5),cyto_pero(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQM5	Uncharacterized protein	Low	8.3	1	36-56	TTPSPPKANPAPRPKCRILRD	nucl(12.5),cyto_nucl(11.5),cyto(9.5),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUK1	Zn(2)-C6 fungal-type domain-containing protein	Low	8.9	1	1-39	MADPKPRQRKFAPRSRTGCLTCRTRRKRCDNAQPQCANC	nucl(11),mito(10),cyto(3),plas(2),cyto_pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVJ5	Translation factor GUF1, mitochondrial	Low	8	1	625-651	ASDLSRRRKLLEKQKEGRKKLRAVGSV	mito(19),cyto(5.5),cyto_nucl(4)	SRRRKLLEKQKEGRKKLR (629-646, prob:0.908)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0E1	Uncharacterized protein	Low	5	1	1589-1610	FLSPAARKQKKEMKSRQSGDAA	plas(22),E.R.(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2N3	Uncharacterized protein	Low	6.3	1	1-26	MAGAIPFRQNQRKQSRQLSTDPRNEL	mito(13),cyto_nucl(4.833),cyto_pero(4.833),nucl(4.5),pero(4.5),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAN5	F-box domain-containing protein	Low	8.9	1	46-69	KTLYLKHFDDPRRRRPQDREPDWA	nucl(11),cysk(6),mito_nucl(6),cyto(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF47	Mitochondrial genome maintenance protein MGM101	Low	8.7	1	280-303	WVEHVSTKKKRKIVLRKDDTAKYP	mito(22),nucl(2),cyto(2),cyto_nucl(2)	KKRK (288-291, prob:0.636)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS03	Uncharacterized protein	Low	9.3	1	166-185	GNSPIYRYRPQKRKASPLVW	nucl(16.5),cyto_nucl(13),cyto(8.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU37	Uncharacterized protein	Low	9.8	1	16-35	KDVSPPPSKRRQQSTTTSKA	nucl(13),mito(10),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUG9	SPX domain-containing protein	Low	6.9	1	777-799	PPPLQAFRKKSRRPYSDYPPPLK	plas(17),nucl(5),E.R.(2),cyto(1),golg(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4H3	Uncharacterized protein	Low	8	1	1-21	MAHPRPRKPRRYDTQPSILSH	mito(16),nucl(9.5),cyto_nucl(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6Z9	Uncharacterized protein	Low	9.6	2	433-454, 505-527	ACKNKKCVGKHPSPAQRQKFQS, CLNPRCLYKHEPGQKKNNTNVWV	cyto_nucl(12.333),nucl(11.5),cyto(8),cyto_mito(7.165),mito(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHZ6	Peptidase A1 domain-containing protein	Low	8	1	505-529	SPVSARRKSAKIDKHKDPRRGLVQD	extr(13),cyto(6),mito(5),plas(1),pero(1),golg(1)	RRKSAKIDKHKDPR (510-523, prob:0.715)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI64	Uncharacterized protein	Low	8.3	1	27-50	EEGSRGSYRFKNKRMRNGHAEQSK	cyto_nucl(15),nucl(13),cyto(11)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJE3	Uncharacterized protein	Low	6.9	1	4-27	LNTFPVPYRRPHTRPKPQFVSHGD	mito(15),nucl(5),cyto(4),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKV7	pH-response regulator protein palC	Low	5	1	336-357	PSGFSKLKKDWQEKREDRKIEK	cyto(20.5),cyto_nucl(11),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL93	Uncharacterized protein	Low	9	1	96-123	GLLVWRERRNYNRKRRARKASNGARTEV	cyto(11.5),cyto_nucl(8),mito(5),nucl(3.5),plas(3),pero(3)	RNYNRKRRARKA (104-115, prob:0.862)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RND8	Uncharacterized protein	Low	9	1	176-196	FSLGRVKKHIRWEQSKRLITG	nucl(14.5),cyto_nucl(12.5),cyto(9.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNK0	RNase H domain-containing protein	Low	9.6	1	6-42	AYQHQVRAGRPVRQRRRYLRNESRRRRRRIIAAMMGE	mito(17),nucl(5),cyto(5),cyto_nucl(5)	GRPVRQRRRYLRNESRRRRRRI (14-35, prob:0.958)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSX5	Uncharacterized protein	Low	5	1	356-378	RVARSQSQKGHPHRPNVERKGSP	plas(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVU2	Uncharacterized protein	Low	8	1	704-735	ESAHTGGKGASKKKRKKRGKKKKGGAGDSSET	plas(11),mito(5),E.R.(5),cyto(2),extr(2)	GKGASKKKRKKRGKKKKGG (710-728, prob:1)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX86	Biotin carboxylase	Low	6.5	1	2150-2170	WQNARRFFYWRLRRRLNEEYI	cyto(14.5),cyto_nucl(10.5),pero(6),nucl(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4T6	Uncharacterized protein	Low	8	1	327-353	AAISHARTEQKKRKQLARQKEDKDRGV	plas(20),E.R.(3),mito(1),cyto(1),pero(1),vacu(1),cyto_mito(1),cyto_pero(1)	KRK (338-340, prob:0.627)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4W5	Uncharacterized protein	Low	5	1	331-354	EEKGSKMSHLKEKMKNKLHIGKDK	cyto_mito(9.166),mito(9),cyto(9),cyto_nucl(8.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5T5	Beta-ketoacyl-[acyl-carrier-protein] synthase I	Low	8.6	2	1324-1345, 1559-1580	DLKLDLKYRRKQLDQRRNQIAS, KEAFEQYARKRQKRLQLACSSF	cyto(10.5),cyto_nucl(8.5),nucl(5.5),mito(3),plas(2),E.R.(2),cysk(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S724	Uncharacterized protein	Low	8	1	254-287	VLPAKLTKVKTEKARRKDGRKAAKGKRKTANGGL	mito(12.5),cyto_mito(11.833),cyto(10),cyto_nucl(7.833)	TKVKTEKARRKDGRKAAKGKRKTA (260-283, prob:0.995)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9Q8	Endonuclease	Low	5	1	298-319	EFATKLSPERRKRLCQEVNCSV	mito(11),cyto(6),extr(6),mito_nucl(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLY0	Uncharacterized protein	Low	7.2	1	1742-1768	SPTNENHYSNNRRRQSRRHRSVYTGGV	cyto_nucl(11.333),cyto(10.5),nucl(10),cyto_mito(8.166),mito(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM74	Uncharacterized protein	Low	9.9	1	65-91	DKLPSLFSWKNFRKRPRRNGYSTTLQD	nucl(17),cyto_nucl(11),mito(4),cyto(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RME0	HECT domain-containing protein	Low	8.3	2	164-185, 307-328	DAARDRKLTRHHSQSRRTVHED, VDFDSRRRTRRTKPMVNRSLFY	mito(6),nucl(4),cyto(4),cyto_nucl(4),golg(4),plas(3),extr(3),cyto_pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSE1	Uncharacterized protein	Low	9.2	1	287-306	FKDRELLKKIKKLYKDNNVQ	nucl(15),cyto_nucl(11.5),cyto(6),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVG3	Uncharacterized protein	Low	5	1	92-117	DYRQWDPEHSQKRKQRKTGEDWGHDY	mito(22),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0N7	Uncharacterized protein	Low	8	1	111-136	SDSDHLRNVSRKKRGKSRLAHSEPSL	plas(25)	RKKRGKS (121-127, prob:0.73)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0W2	Uncharacterized protein	Low	5	1	38-62	ECGYDFTRRQERRQRLNRGETQRPP	plas(11),mito(5),extr(4),cyto_mito(4),cyto(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Z5	Uncharacterized protein	Low	6.9	1	711-730	IRMNQFGKRRIRFRRAAGSK	cyto(9),nucl(5),mito(4),extr(3),pero(2),plas(1),E.R.(1),golg(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD27	Uncharacterized protein	Low	8.1	1	75-94	PEFPSDRKSRRSPRKCLQRF	nucl(10.5),cyto_nucl(8),mito(7),cyto(4.5),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDE4	Uncharacterized protein	Low	9.3	1	487-507	ESGKLQKELRRKSSARRRSTF	plas(6),cyto_nucl(5.5),cyto(5),cysk(5),nucl(4),mito(2),golg(2),vacu(2)	LRRKSSARR (495-503, prob:0.706)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFQ2	PepX_C domain-containing protein	Low	5.9	1	24-43	GFNPRKETLKKGHQSRDGTR	cysk(12),cyto(10),cyto_nucl(8.333),cyto_pero(5.999),nucl(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHU0	Myotubularin phosphatase domain-containing protein	Low	7	1	853-880	SDIVEKKVENRTRSRKPSHNPEAKKDIV	mito(9.5),cyto_mito(9.5),cyto(8.5),nucl(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI6	Uncharacterized protein	Low	5	1	361-382	EDQHEKKYGKLWRRFRRALIWK	cysk(22),cyto(2.5),cyto_nucl(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR04	Uncharacterized protein	Low	8	1	300-322	HSSNFPFKPKRARKAHKDSVISP	plas(23),E.R.(2)	PKRARK (308-313, prob:0.667)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT86	Uncharacterized protein	Low	5	1	41-61	ESDMHRIGKKQEFRRNFRLVS	plas(26)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ97	Uncharacterized protein (Fragment)	Low	8.1	1	19-39	RWECDRWERRRSEYRTQKKAL	nucl(10.5),cyto_nucl(10),cyto(8.5),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1C7	acidPPc domain-containing protein	Low	8	1	28-58	SALPSLIPHRVRRKWRATKSRIRSRQTPTSS	plas(25)	RVRRKWRATKSRI (37-49, prob:0.762)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6M4	Uncharacterized protein	Low	7.4	1	476-497	FDKCRNCREWYGRKDRNDHQLV	cyto_nucl(11),cyto(10.5),nucl(8.5),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF73	Uncharacterized protein (Fragment)	Low	7.7	1	8-27	SSSHEKRPTFRGNSRRLLRL	mito(14),nucl(7),cyto(3),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJL2	Uncharacterized protein (Fragment)	Low	6.7	1	15-34	VVHVKQKGRQQQDQKIRQVK	mito(15.5),cyto_mito(8.833),nucl(6.5),cyto_nucl(4.333),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL15	Uncharacterized protein	Low	9.4	1	47-74	GDHRRVYTQPSRGKKRKRNTKTEQDDST	mito(15),cyto(6.5),cyto_nucl(6),nucl(4.5)	RGKKRKR (58-64, prob:0.812)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM82	Uncharacterized protein	Low	6.7	1	490-509	AKARAQRLVQSRRTRKNIAR	cyto(10),cyto_nucl(9),nucl(6),mito(5),pero(2),plas(1),extr(1),E.R.(1),cysk(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1L9	Fatty acid hydroxylase domain-containing protein	Low	8	1	271-292	EAGAEASKKRRERKLAKARKAQ	plas(20),mito(3),E.R.(2)	SKKRRERKLAKARKAQ (277-292, prob:0.975)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6Q1	Eukaryotic translation initiation factor 3 subunit G	Low	7.2	1	43-65	GEDGRKYKTTRRIKKTVVKQIVN	cyto(12.5),cyto_nucl(12),nucl(8.5),mito(3),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S797	Uncharacterized protein	Low	8.6	1	24-49	FSPPKSPSKKSTSPVRKPLHERSNSQ	plas(14),nucl(9),cyto(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7F5	UBC core domain-containing protein	Low	6	1	212-232	VGDTCKTKKGNLRRGRWKFGA	cyto(12.5),cyto_nucl(8.5),E.R.(4),nucl(3.5),mito(3),extr(1),pero(1),golg(1),cysk(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8S7	Uncharacterized protein	Low	5	1	314-339	FTVTISSKGCPKKKPREHPDWQAITM	plas(20),E.R.(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAW7	Protein AF-9 homolog	Low	6.1	1	1-21	MPAPASNKRNKRISRNLIIGS	mito(19.5),cyto_mito(12),nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD96	HMA domain-containing protein	Low	5.3	1	1033-1057	IDYQKVEAPKRERRLRSRTDSSTDS	plas(21),E.R.(2),nucl(1),mito(1),cyto(1),cyto_nucl(1),golg(1),cyto_mito(1),mito_nucl(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFM9	Uncharacterized protein	Low	8	1	121-146	RAIFGKKRINKIKIWRSKNKPVANML	cyto(18),mito(4),pero(3)	KKRINKIKIWRS (126-137, prob:0.674)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM27	Uncharacterized protein (Fragment)	Low	5	1	21-41	AIRQSQSKEKREEHRARRCNL	extr(17),cyto(3),E.R.(3),mito(2),cyto_pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWC6	Fungal_trans domain-containing protein	Low	8.8	1	205-225	IRKMLYQKKKPEPKDDKHPWF	nucl(14),cyto_nucl(11.5),cyto(7),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0H8	Uncharacterized protein	Low	6.5	1	32-52	AIPKPCKPLRQWQQEQNINRD	cyto(13),pero(5),nucl(4),mito(2),extr(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2H2	Hydrolase_4 domain-containing protein	Low	5	1	285-304	IRHFESSKTKPQRRKYDITL	plas(19),E.R.(4),extr(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7W7	37S ribosomal protein S25, mitochondrial	Low	9.7	1	44-68	ARPVLRVPKMRKARKASKLFKPLPI	mito(14.5),cyto_mito(10),nucl(6),cyto(4.5)	VPKMRKARKASK (50-61, prob:0.829)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI47	Pex24p domain-containing protein	Low	8	1	487-516	AWEESKPSRKGEWRRRRWVRGVERMPWRDG	plas(20),mito(3),E.R.(2),vacu(2)	RAKLKKRGSSKGGSKDIGDQEREVLRRAWEESKPSRKGEWRRRRWVRG (460-507, prob:0.931)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIH1	Elongation of fatty acids protein	Low	5	1	280-301	FYFATYKKPVPKGRRRATSALV	plas(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIS1	Uncharacterized protein	Low	8.6	1	219-239	LYPSEKKTPVKQGQPKPFKPP	cyto(12),mito(9.5),cyto_nucl(8.333),mito_nucl(6.666),nucl(2.5)	PKPFKPPVESKK (233-244, prob:0.637)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK75	Uncharacterized protein	Low	5.4	1	113-135	FTQTRKRWEVARKWNQKRSRMGG	cysk(11),cyto(9),pero(4),nucl(1),mito(1),plas(1),mito_nucl(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTI5	Uncharacterized protein	Low	6.8	1	451-474	YVDYKGGQKRYPKKSAREISKIFE	cyto(14.5),cyto_nucl(11),nucl(6.5),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUQ9	GAT domain-containing protein	Low	9.5	1	420-439	EDDHRRPRTPETNKPHQQAH	nucl(17.5),cyto_nucl(11.5),mito(5),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV53	Uncharacterized protein	Low	5	1	32-51	TQTLKRVNRVKRPLNSVQQH	extr(21),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXJ1	Molybdopterin synthase sulfur carrier subunit	Low	7.8	1	208-231	GRACITTPPTRKRQKKADSRVAEL	nucl(9.5),cyto_nucl(8.5),cyto(6.5),extr(4),plas(2),pero(2),E.R.(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5Q5	Uncharacterized protein	Low	9.8	1	5-28	ATQERRNTNRYPSKRPKDQPLLGK	nucl(17),cyto_nucl(10.5),mito(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE22	Zn(2)-C6 fungal-type domain-containing protein	Low	9.6	1	1-22	MTTPRRKACVECRQQKIRCDVE	nucl(15.5),cyto_nucl(9.5),mito(6),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF38	Uncharacterized protein	Low	7.6	1	32-54	NARRKNPWSTSKHAAKQRKTASP	cyto_nucl(10.5),cyto(10),nucl(9),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJR8	Uncharacterized protein	Low	5.9	1	38-57	APKDVRVTARREKYQRNMMN	cyto(13),cyto_nucl(9),mito(7),nucl(3),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNY3	Uncharacterized protein	Low	5	1	54-79	AFLLPGKQDKKKHQQFVRRWQKRLLG	mito(24.5),cyto_mito(13.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRU1	Mediator of RNA polymerase II transcription subunit 14	Low	8.6	1	1056-1081	QAQHNQQQARRQQPPQQNQRGQQPNG	nucl(13),cyto_nucl(11.5),cyto(8),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S128	S4 RNA-binding domain-containing protein	Low	9.2	1	237-263	TSPFGGGRPGRVRRKKAKAAEKGGDDD	plas(6),mito(5),cyto(4.5),cyto_nucl(4.5),E.R.(4),nucl(3.5),golg(2)	GRPGRVRRKKAKAAE (243-257, prob:0.95)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1J3	Peptidase A1 domain-containing protein	Low	6.9	1	453-478	VLAFLFFLRRRRNKQQQQQQQHHELA	plas(7),nucl(5),mito(4),extr(4),cyto_nucl(4),cyto(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4S9	Uncharacterized protein	Low	9.9	1	281-304	NPKNQTQFSKLRKKIQDHGRQSST	nucl(18.5),cyto_nucl(11.5),pero(4),cyto(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S574	Protein-tyrosine-phosphatase	Low	6.1	1	635-657	YELLKWEEYQRQRRNEPLRRELE	mito(20),cyto(4),nucl(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5H8	Uncharacterized protein	Low	5	1	536-555	VNPPKTKNGVKKPKPLRNTC	mito(24),cyto_mito(14)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9T3	RING-type domain-containing protein	Low	9.3	1	93-116	SCKISDFKKFRERRKAQWAKQGVD	nucl(15),cyto_nucl(11),cyto(5),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGJ4	Uncharacterized protein	Low	8.1	1	183-202	APDFQPQTRKNKKEHIEIRD	plas(10),nucl(8),cyto(6),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH10	DNA helicase	Low	8.2	1	667-687	VVEDDRRKRRRTVRDPDAMST	cyto_nucl(14),nucl(12.5),cyto(12.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ70	Peroxin/Ferlin domain-containing protein	Low	8.1	2	406-427, 490-516	GQDGWGRYTRRRKWYRDAELVE, TDAASTRSKRSWFKKKTRTTSSSRSVS	plas(21),nucl(3),mito(1),cyto(1),E.R.(1),cyto_mito(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN32	PH domain-containing protein	Low	9.9	1	240-263	RSEPRYRSLPRRSRRQRILENVQF	nucl(20.5),cyto_nucl(15),cyto(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT74	Uncharacterized protein	Low	8	1	316-338	GSSVGGKRVRLHREKRHRILEFA	nucl(10.5),mito(9),cyto_nucl(9),cyto(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9E2	Uncharacterized protein	Low	9.3	1	303-326	KQQERDYRKQLKKEDLQRRKSETI	nucl(14.5),mito(10),cyto_nucl(9)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDE2	3-oxoacyl-[acyl-carrier-protein] reductase	Low	6	1	1704-1729	TYSYAKTSTQAPKKDKKAQETMKMVE	cyto(11.5),cyto_nucl(8),cysk(8),nucl(3.5),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF50	Uncharacterized protein	Low	9.6	1	287-308	AEAPNRRSRKKVSKPVDRMTPI	mito(11),mito_nucl(10.499),cyto_mito(9.499),cyto_nucl(8.666),nucl(8.5),cyto(6.5)	NRRSRKKV (291-298, prob:0.741)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI09	Uncharacterized protein	Low	9.5	1	598-623	EEEQAKRLAEKRKRKGKVVRRAVSAS	cyto(13.5),cyto_nucl(10),mito(7),nucl(5.5)	AKRLAEKRKRKGKVVRR (602-618, prob:0.969)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S002	Uncharacterized protein	Low	5.5	1	52-74	RSTFGHRRKHSPNLEWKQPWNKD	plas(21),mito(2),cyto_nucl(2),nucl(1.5),cyto(1.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0K9	Vezatin domain-containing protein	Low	9.8	1	258-277	EEKGHARRCQRLRRHLRATY	nucl(13),plas(6),cyto(5),mito(1),pero(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9V3	Uncharacterized protein	Low	5	1	424-444	EQSFKKSATKPGEKGKPQNAD	cyto(20),cyto_nucl(13),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKV4	MFS domain-containing protein	Low	8	1	594-615	EAEQNERRKKRASKGSLPIDTE	plas(27)	NERRKKRASK (598-607, prob:0.826)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ64	RING-type domain-containing protein	Low	8.4	1	168-188	TCPLDRKELLKKKQPPPPPAD	nucl(13),cyto_nucl(11.5),cyto(8),mito(2),extr(1),pero(1),golg(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXZ0	Uncharacterized protein	Low	6.3	1	97-117	GHSDKHGKKKEDKVEEKKDEQ	mito(13.5),mito_nucl(10.333),cyto(7.5),cyto_nucl(7.333),nucl(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY01	Uncharacterized protein	Low	8.6	1	80-101	AEESWRKRSKSHQRAPAIEKTA	nucl(12),mito(11.5),cyto_mito(7.5),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0Y3	UBX domain-containing protein	Low	9.4	1	337-358	ADREKARKKKEEAERKAREEKE	cyto(12),cyto_nucl(10.5),mito(6),nucl(5),pero(3)	REKARKKKEEAERKAREE (339-356, prob:0.942)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S272	Uncharacterized protein	Low	8	1	499-521	ALRSRRKTTKLPARQRNRVNTTS	nucl(9.5),cyto_nucl(8),mito(6),cyto(5.5),extr(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8W3	Chitinase	Low	5.7	1	834-860	VKTCNDDHKKKPKPTSYPKPQDKECKL	extr(21),nucl(2),mito(2),mito_nucl(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFX9	Isocitrate lyase	Low	6.6	1	17-36	EVKQWWSDSRWRYTRRPFTA	pero(11),cyto(8),cyto_nucl(7.5),nucl(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ59	Uncharacterized protein	Low	9	1	15-34	SDRQDYKTLAAKKRRGNQCE	nucl(13.5),cyto_nucl(10),cyto(5.5),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ89	Uncharacterized protein	Low	8.3	1	145-166	QVGPRHRRFRTIPQQRHRPWGF	nucl(10),cyto(10),cyto_nucl(10)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMF7	Uncharacterized protein	Low	8.3	1	612-631	CGEPCRRYYRSRRVGFGRYF	nucl(11),cyto(11),cyto_nucl(11)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPD2	Uncharacterized protein	Low	9.6	1	46-68	IVPKEDYRPKTKKAKTKSLDADS	nucl(12),cysk(7),cyto(4),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVQ2	Uncharacterized protein	Low	8	1	1629-1650	EETSQRRIAKRKEKLKQWQSEE	plas(23),mito(2)	KRK (1638-1640, prob:0.611)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0K3	Uncharacterized protein	Low	9.1	1	1060-1094	EGNKDDMKFRSRKKKKMTKKEVKDREVRRRLRYID	cyto(15),cyto_nucl(10.5),nucl(4),E.R.(4),mito(3)	KFRSRKKKKMTKKEVKDREVRRR (1067-1089, prob:0.988)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2X7	Uncharacterized protein	Low	7.8	1	493-516	EAPHTSNRKPHRPHGRKSLPDTRA	mito(14),nucl(9),cyto_mito(9)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3F8	TLC domain-containing protein	Low	8	1	24-48	DVTTAAAPRRRKPRAKANKVEDEGL	plas(23),mito(1),E.R.(1),golg(1),vacu(1)	PRRRKPRAKA (31-40, prob:0.873)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7G3	Trehalase	Low	7.2	1	509-532	ENSASWERRARKRRVQVDKYLWDE	mito(11),cyto(7),nucl(6),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Z0	Uncharacterized protein	Low	8	1	608-635	QKAAREESNRKKQNGKRKDAKWVFPKAV	plas(12),mito(6),E.R.(5),pero(2)	SNRKKQNGKRKDAKWVFPKAVEGAGVRVPKGDIRVRIRRREGLPASKIVRRI (615-666, prob:0.942)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REB2	HIT-type domain-containing protein	Low	7.8	1	30-50	RTCSLPCYKRHQSWAQCSGKR	mito(14.5),mito_nucl(13),nucl(10.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFT1	tRNA (guanine-N(7)-)-methyltransferase	Low	9.2	1	1-44	MPGEPAKRTRREEYKKSLQTDDQNAALPKKKFYRQRAHANPFSD	nucl(15.5),cyto_nucl(12.5),cyto(8.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHG0	Elongator complex protein 5	Low	9.2	1	51-76	ALLNDRPKSTRARRPRNGSSVNKTRS	nucl(15.5),cyto_nucl(12),cyto(7.5),cysk(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKD9	Nudix hydrolase domain-containing protein	Low	8.8	1	56-78	NEFDSPLPKRRRRSSAAKPTDEF	cyto(9.5),mito(7),cyto_nucl(6.5),plas(4),nucl(2.5),pero(2)	RRR (65-67, prob:0.626)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3C3	J domain-containing protein	Low	8.2	2	22-45, 210-229	IKKAYRKAALKWHPDKNKDNPQAL, NGTTKKLKIKRKTYDQSTGK	cyto(14.5),cyto_nucl(10),mito(7),nucl(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6R2	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	1	53-85	CLTCRVRRVKCDETRPVCKACGKKNRPCQWEEP	nucl(11.5),cyto_nucl(9.5),cyto(6.5),mito(3),plas(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6X1	Uncharacterized protein	Low	9.5	1	20-41	GPGPGPRRRRLPPPPPLARNIV	cyto(10),cyto_nucl(8.5),mito(8),nucl(5),extr(2)	GPRRRRLP (24-31, prob:0.717)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9J4	Uncharacterized protein	Low	7.7	1	915-940	PSIKTTTTTATKRCRRDRFKFIAAMR	cyto(13),cyto_nucl(12.5),nucl(10),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAA1	DNA-directed RNA polymerase	Low	8.1	1	408-427	EYSRKKDKGGKDITIRCRRC	nucl(11.5),cyto_nucl(11.5),cyto(10.5),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGC7	Uncharacterized protein (Fragment)	Low	9.2	1	213-232	INAHTKKKRLAALRRKHYGD	mito(13),cyto(6),nucl(3),pero(3)	KKKRLAALRRKHYGDGGGR (218-236, prob:0.823)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGS5	Uncharacterized protein	Low	9.9	1	455-482	TDTKTNTKGKSKPPPKPTKKPDSDNDDT	cyto(11.5),cyto_nucl(9.5),pero(7),nucl(6.5)	KGKSKPPPKPTKK (462-474, prob:0.777)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMS1	40S ribosomal protein S24	Low	9.1	1	97-126	MATKVEKASRQQRKQRKNRMKEFRGTAKTK	mito(17),cyto(6.5),cyto_nucl(5.5),nucl(3.5)	KASRQQRKQRKNRMKEFRGTAKTKGGAKKDKK (103-134, prob:0.989)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQM0	Fe-ADH domain-containing protein	Low	6.7	1	3-25	SFANYCRKKRTIQQLPTPARKGH	mito(16),nucl(5),cyto(3),pero(3),cyto_pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQU9	Uncharacterized protein	Low	5	1	488-508	LFCLHRRKKALKEKQAQADEP	extr(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM1	Uncharacterized protein	Low	9	1	57-111	KPRPGFWRRLRMSMRRRSCRSKGDDCCRQLRLSDEKPQSRRFRLKRKHAARACVI	plas(10),mito(4),nucl(3),golg(3),cyto_mito(3),cyto(2),extr(2),pero(2),cyto_pero(2)	RRFRLKRK (96-103, prob:0.69)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUX0	Copper transport protein 86	Low	8.4	1	1065-1086	QGQVMLRKRQPQPQPQQPLTSR	nucl(12.5),cyto_nucl(11),cyto(6.5),mito(4),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY68	Uncharacterized protein	Low	6.6	1	786-809	HFVQQIFRWKYNRKCNPMRDADHD	mito(7),cyto(7),cyto_mito(7),nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7C1	Uncharacterized protein	Low	9.1	1	84-105	LGKLQNKPKKGEKLKPPSPAET	mito(18),cyto(4.5),cyto_nucl(4.5),nucl(3.5)	KPKKGEKLK (90-98, prob:0.723)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7V8	Uncharacterized protein	Low	8.6	1	1-22	MPKPKWYPKRLLEVHPEKRNPR	mito(10),nucl(9),cyto(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCU3	Uncharacterized protein	Low	7.4	1	462-484	WELGWPCKFGRSRKRIGSRSVST	cyto(9.5),cyto_mito(9),nucl(8),mito(7.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSK1	RXT2_N domain-containing protein	Low	9.6	1	32-51	TALSNKKQDLRRKVHYARAS	nucl(17.5),cyto_nucl(13),cyto(7.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSV8	Uncharacterized protein	Low	5	1	560-586	ANDMRGRRQQWREEREQRNEKRREVDM	mito(17.5),cyto_mito(12.5),cyto(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZJ1	Uncharacterized protein	Low	5	1	1-22	MSSGNRKERRAKESKSNSKGSG	plas(22),mito(2),cyto(1),pero(1),E.R.(1),mito_nucl(1),cyto_pero(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0I8	PPM-type phosphatase domain-containing protein (Fragment)	Low	8.9	1	221-251	SKMKLMLRRKNTNAKKKEKKKRVYEEVDKIE	mito(11),extr(4),plas(3),cyto_nucl(3),nucl(2.5),cyto(2.5),E.R.(2)	KMKLMLRRKNTNAKKKEKKKR (222-242, prob:0.978)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2Q4	Phosphatidylinositol 3-kinase VPS34	Low	8.5	1	137-156	DNALHKGRQRCRIHRFKAAD	cyto(10),nucl(9),pero(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S417	Plasma membrane ATPase	Low	7	2	96-115, 894-918	EVLIRRKKYGENKMKEEKTN, FDNLMHGKLLKRKQKQRNLEDFVVS	plas(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9H3	Uncharacterized protein	Low	8.7	1	255-280	VKKEEEKKPAVKKGTKRKAADSKIPA	cyto(22),nucl(2),mito(2),mito_nucl(2)	KKEEEKKPAVKKGTKRKAADSKIPAEGTRKSSRTKKT (256-292, prob:0.988)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCW9	Uncharacterized protein	Low	6.5	1	200-221	ANTDTVSKKPQKPSRKRWEVVF	mito(17),cyto_nucl(5),nucl(4.5),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGL6	Uncharacterized protein	Low	8.2	1	269-291	MEAYLKRYKRKPFFVYRTKGQDG	nucl(12),cyto_nucl(12),cyto(10),mito(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ15	40S ribosomal protein S25	Low	8	1	1-27	MVSTGGKKQKKKWSKGKVKDKAQHAVV	mito(10),cyto(10),cyto_mito(10)	GKKQKKKWSKGKVKDK (6-21, prob:0.936)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKY7	Uncharacterized protein	Low	8.5	1	949-969	MKYTRDFKKKGFKGNSRGNSI	nucl(13.5),cyto_nucl(12),cyto(9.5),mito(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRF5	Uncharacterized protein	Low	5	1	324-354	NAENKDTKDNKKTKESKQTKETKQKSVDSQS	plas(19),E.R.(4),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSZ2	Uncharacterized protein	Low	9.1	1	252-273	LLIATAKKVKWRQCSSCKNMVE	nucl(15),cyto_nucl(13),cyto(9)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZE2	Chloride channel protein	Low	8	1	116-140	QDAAREQLRRKARRRARDSIGVRRD	plas(24),mito(2)	RRKARRRARDSIGVRRDGSSGRVFLGRGRGIWRR (124-157, prob:0.936)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0Y0	CRAL-TRIO domain-containing protein	Low	6.1	1	267-291	ALEKITTERRRYRKERWEKGGKMIG	cyto(17),cyto_nucl(11.5),pero(5),nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4U1	Uncharacterized protein	Low	5	1	228-249	FQQFRNARPKRGRSPLRHHLPI	plas(23),mito(1),cyto(1),E.R.(1),vacu(1),cyto_mito(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S643	AP-1 complex subunit gamma	Low	8	1	605-626	GEATKKRQSKIAKKKPAQAATE	mito(20),cyto(6)	KKRQSKIAKKKP (609-620, prob:0.809)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6D2	Uncharacterized protein	Low	5.4	1	15-35	SEPSPTKKTPRSRTSTPDPSA	plas(14),mito(6),cyto(2),E.R.(2),nucl(1),extr(1),pero(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7W0	Uncharacterized protein	Low	6.5	1	121-140	ESLFNMRKRKHHAHFRKIAA	mito(9),cyto(5),nucl(4),plas(4),cyto_pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKQ8	Ribosome assembly factor mrt4	Low	5	1	1-21	MPKSKRAKVVHLTKTDKKGKE	cyto(12.5),mito(11.5),cyto_nucl(9.333),mito_nucl(7.999)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RND6	DOMON domain-containing protein	Low	8	1	365-384	QSCIRKRGSAHARALRRRKP	plas(14),extr(8),E.R.(5)	KRGSAHARALRRRK (370-383, prob:0.752)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNU2	DNA polymerase	Low	9.8	1	25-45	QLSPRSSKKLKVENANEKSRA	nucl(17.5),cyto_nucl(12.5),cyto(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTK8	Uncharacterized protein (Fragment)	Low	9.5	1	65-85	DSESRSRSSKRSCRSRSSGRK	nucl(18.5),cyto_nucl(15.5),cyto(7.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9M4	Ribosome-releasing factor 2, mitochondrial	Low	7	2	5-25, 379-399	WVACARRVLRHNVKTPRRLLS, VGASKKPSKSGRKPQQQDKGL	mito(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA39	Uncharacterized protein	Low	8	1	48-67	EFEPYKIRRRQDKPAAANGD	cyto(17.5),cyto_nucl(10),cysk(7)	KKEKEKQEKANAKKKGGPAPQANK (328-351, prob:0.945)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAC7	Uncharacterized protein (Fragment)	Low	8.3	1	138-157	QKEHGWKSPKYRFTRRQREA	nucl(11.5),cyto_nucl(11),cyto(7.5),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG46	MFS domain-containing protein	Low	5	1	21-42	AKWDPNRQFREKYNQRHLHDQT	plas(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLV0	Uncharacterized protein	Low	5	1	424-443	VKNFKSKTKAMERPKGTWKL	cyto(14),cysk(10),cyto_nucl(8.333),cyto_pero(7.833)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMJ1	Zn(2)-C6 fungal-type domain-containing protein	Low	8.2	1	2-40	ARRSTGFVSKKPHRKSRGGCLTCKRKKVKCDETLPACEY	nucl(11.5),mito_nucl(11),mito(9.5),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNB9	Uncharacterized protein	Low	9.9	1	842-865	TPTSTSTHHKPKPTKTHPSDPVIT	extr(8),mito(6.5),nucl(6),cyto_mito(6),cyto(4.5)	KLGKGKGKGKGH (866-877, prob:0.841)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S087	DNA_LIGASE_A3 domain-containing protein	Low	8.9	2	15-38, 811-835	IENTTTRRPRLPEKKEKENTRVII, FEQPISPPKSKQRRLQRPLQPVSGN	cyto(9),nucl(5),cyto_pero(5),E.R.(4),mito_nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1S6	Nudix hydrolase domain-containing protein	Low	5	1	2-23	STPADHKPSKTQPKTPGVPRPS	mito(19),cyto_mito(13.5),cyto(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9A6	RING-CH-type domain-containing protein	Low	5.3	1	48-71	AGEKQSQKSRRTHWPPRQCRICLE	plas(21),E.R.(2),nucl(1),mito(1),cyto(1),cyto_nucl(1),vacu(1),cyto_mito(1),mito_nucl(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9L8	Uncharacterized protein	Low	5	1	58-80	AVYTHYVTPRRRKRSVLRLIYCT	plas(24),mito(1),cyto(1),E.R.(1),cyto_mito(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCP4	Uncharacterized protein	Low	5	1	471-490	EPSVHVTRRRMPRDRVQAER	mito(23.5),cyto_mito(13.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJN9	UDP-N-acetylglucosamine transferase subunit ALG14	Low	5	1	32-55	ILPNAARTKKTPFRKRPIATRVLI	plas(9),extr(9),E.R.(3),mito(2),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLS5	Probable endonuclease LCL3	Low	7	1	712-733	ADDQWYRARIRRNDRENKKAEV	cyto_nucl(13.166),cyto(13),nucl(12),cyto_mito(7.666),mito_nucl(7.166),cyto_pero(7.166)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM12	Uncharacterized protein	Low	8	1	1260-1280	VSGSTKHQKDCPRNIRRIAIG	nucl(10.5),cyto_nucl(10),cyto(8.5),mito(4),plas(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNY6	Uncharacterized protein	Low	6.5	1	3-26	FVEGKILKSRRSQRPKTTPTASVS	mito(16),nucl(4),cyto(3),plas(1),extr(1),pero(1),E.R.(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPE3	WD_REPEATS_REGION domain-containing protein	Low	8	1	99-123	ASSKAATKAKKEKKEGVIRARPTKT	mito(26)	TKAKKEKKEGVIRARP (105-120, prob:0.857)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQN3	Ankyrin repeat-containing protein AKR1	Low	5	1	423-446	VNCMVRKPLRSKHCKRCERCVAKS	plas(20),mito(3),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRS0	Uncharacterized protein	Low	9.6	1	273-295	DEAKAKKAKNKSRSVSRGKRASL	cyto(18.5),cyto_nucl(13.333),nucl(7),mito_nucl(4.333)	KAKKAKNKSRSVSRGKRASLFGGLLGKK (276-303, prob:0.951)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVM5	Uncharacterized protein	Low	8.4	1	642-666	SAKLSQRSRTLSQRRRNRNHSEGVD	nucl(14.5),cyto_nucl(12.333),cyto(9),cyto_mito(6.333)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S092	Uncharacterized protein	Low	7.7	1	12-36	QQPLNNLKINKKIPRRKVNLVTITV	plas(16),nucl(7),cyto(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5F0	Uncharacterized protein	Low	6.6	1	209-233	DWSCRGCGGKCKRGRCKTVSYEPPV	mito(11),cyto(5.5),cyto_pero(5.5),nucl(5),pero(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAH5	Tr-type G domain-containing protein	Low	9.1	1	1064-1088	RENVAKRYVDKVRRRKGLRVQGEKV	cyto(16),cyto_nucl(11),mito(6),nucl(4)	RR (1077-1078, prob:0.611)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDT9	Uncharacterized protein	Low	5	1	1-22	MGFLKKPKLRSRDDQRTRAAEL	plas(26)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REI0	Phosphotransferase	Low	6.1	1	449-472	DGSVANKHPKFKKRWARALGEVLD	cyto(15),cyto_nucl(10.5),nucl(4),pero(3),mito(2),cysk(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REJ9	F-box domain-containing protein	Low	7.4	1	489-516	ELEEEKKLRPCKTCKRRGFSLDRCRSLG	cyto_nucl(10.5),nucl(9),cyto(8),cysk(6),mito(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIV6	Lactase	Low	7.8	1	984-1004	ADHPHELRKKKREDVVLRLDA	nucl(9.5),cyto_nucl(9.5),cyto(8.5),pero(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLK5	Letm1 RBD domain-containing protein	Low	9.3	1	65-84	PSKASKPLPRQEQNTQQQSK	mito(17),nucl(4),cyto_nucl(4),cyto(2),extr(2),pero(2)	AKKEEAKK (133-140, prob:0.657)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN95	Arf-GAP domain-containing protein	Low	7.8	1	24-49	KLEGNKTCSDCKRNKHPRWASWNLGV	nucl(10.5),cyto_nucl(7.333),mito(6.5),cyto_mito(5.333),extr(5),cyto(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRS7	Uncharacterized protein	Low	5	1	228-253	SGRRLSTSSNTKQHRRRKSGSSTSSI	plas(21),extr(3),E.R.(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSK0	Uncharacterized protein	Low	9.7	1	266-292	VEYYRDLTKHARRKKNRGTIPPPTAPP	cyto(8.5),cyto_nucl(7.5),nucl(5.5),mito(4),plas(3),E.R.(3)	ARRKKNR (276-282, prob:0.716)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXR2	Uncharacterized protein	Low	5	1	341-360	ATPQKRSYFPRSRRNSSDRY	plas(20),mito(3),E.R.(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYQ6	Ras-GAP domain-containing protein	Low	8.3	1	660-683	NVRSQSEGKTRKQQKHQVLGPYKF	nucl(12.5),mito_nucl(12),mito(10.5),cyto(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2B1	Na_H_Exchanger domain-containing protein	Low	5	1	299-321	FPDIIDKRHKRRQKTVVQCTKAM	plas(12),extr(7),E.R.(4),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5D6	Uncharacterized protein	Low	8.8	1	62-82	YAFQPHRKRLGRFPHHKRLFD	nucl(13),mito(8.5),cyto_mito(7.5),cyto(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6F1	Atypical serine/threonine protein kinase BUD32	Low	8	1	60-81	VVKYRPPKPYRHPTLDRRLTKQ	cyto(20),cyto_mito(12.833),cyto_nucl(10.833),mito(4.5)	KGRKEKEKE (132-140, prob:0.699)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7U2	Methyl-accepting transducer domain-containing protein (Fragment)	Low	8.6	1	32-56	SGSQKFSRRLLPPRTQDNRRARNGD	nucl(16),mito_nucl(11.833),cyto_nucl(9.833),mito(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S917	SET domain-containing protein	Low	5	1	26-46	EERIKKCTEQHGNPKIPRDKV	cyto_pero(9.166),cyto(9),pero(9),cyto_nucl(8.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFV7	CDP-diacylglycerol synthase	Low	5.8	1	344-363	MVRRLPKKFREKVYFQYRGK	mito(22),nucl(2),plas(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGS9	tRNA wybutosine-synthesizing protein 4	Low	6.7	1	464-486	VELENKTKKSRGKWEQLTKGDEE	cyto(14),cyto_nucl(11),nucl(6),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJS1	Peptidase S53 domain-containing protein	Low	7	2	76-95, 592-615	SSPSNPKYGKHLKREELKDL, QLRRLSTMPQYGKRRVRRSLHGDM	extr(16),mito(5),cyto(2),plas(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0Y9	Uncharacterized protein	Low	7.4	1	298-319	LDSDRLRARAHKKEPKSDDQLF	mito(10),nucl(8),cyto(8),cyto_nucl(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5B7	Uncharacterized protein	Low	8.3	1	160-185	NSVSKVRYFNSRKRLPKPFVNRDPAP	nucl(12),plas(11),cyto_nucl(9),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE91	Uncharacterized protein	Low	8.4	1	647-670	VSSARYRFPRSRNRAKFVQRVFFR	nucl(12.5),cyto_nucl(11.5),cyto(9.5),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI73	Uncharacterized protein	Low	8.8	2	9-32, 566-585	AIVNSDKKCRQECKKSCPVVRTGK, RRDPNSFRPRINKDKSQLDQ	cyto(10),mito(9),cyto_nucl(9),nucl(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRR9	Uncharacterized protein	Low	5	1	632-654	DEIKESKALKWKKIRYDYREGAD	plas(26)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSE7	Uncharacterized protein	Low	8	1	414-438	MEKGVRCRCKCRYGLKNKQVKLEQG	nucl(12.5),cyto_nucl(10.833),cyto(8),cyto_mito(6.333),mito(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2C4	Uncharacterized protein	Low	9.8	1	363-382	RDGIQKKKSVRFDKDMEKPE	nucl(19),cyto_nucl(14),cyto(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3B9	Uncharacterized protein	Low	8	1	289-314	EEKEKDDDSKKKGKKEKKEREEDDEG	mito(10),plas(7),E.R.(5),cyto_mito(5)	KKKGKKEKKER (298-308, prob:0.94)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S539	Uncharacterized protein	Low	5	1	228-252	TLGLHSVKKPKKYNRRQADPFSRLR	plas(24),E.R.(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7J2	Uncharacterized protein	Low	5	1	71-97	IRLDREWQEKERQRKKRNASSLSLQRL	plas(18),E.R.(3),cyto(2),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHI2	Uncharacterized protein	Low	6.2	1	198-218	SWPPLFPRLKPPHKKLQQGNH	mito(12),cyto(6),cyto_nucl(5.833),cyto_pero(5.833),nucl(4.5),pero(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RID9	Uncharacterized protein	Low	8.8	1	40-64	EHTLNRVRENQRRHRARQRDHVASL	nucl(15),cyto_nucl(12),cyto(7),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVQ6	Uncharacterized protein	Low	9.8	1	43-62	EEPPLKKKSPLPSTNKLPDT	nucl(18),cyto_nucl(12.5),cyto(5),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0Y8	Uncharacterized protein	Low	9	1	62-81	QSLHERPRNRLQKRRPASLM	cysk(15),nucl(10)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Z0	Uncharacterized protein	Low	5	1	327-347	EEKAGAKSSQKVRRHPRAFRN	extr(24),cyto(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2U4	General transcription and DNA repair factor IIH subunit TFB4	Low	8.5	1	336-364	SAVTNPPALIPRKKKKKKKAGTESATPGG	extr(15),cyto(5.5),cyto_nucl(4),E.R.(2),nucl(1.5)	PRKKKKKKKA (346-355, prob:0.987)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S617	Uncharacterized protein	Low	9.2	1	449-470	AEALWRKIQKDKKKERALAENV	nucl(16),cyto_nucl(13.5),cyto(9)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAZ0	Uncharacterized protein	Low	5	1	1220-1242	EMRGTSLLTRRDRRKHLQSLGGT	plas(20),E.R.(3),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG18	HET domain-containing protein	Low	8.2	1	122-145	PDANSKSSRRWKPAFRKSKWFTRG	nucl(13),cyto_nucl(10.833),cyto(6.5),cyto_mito(6.166),mito(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGC3	Uncharacterized protein	Low	5	1	10-38	HTRRPTYPLAHAFRRKPRRIPLVLRFAKG	plas(23),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM76	Ubiquinone biosynthesis protein COQ4, mitochondrial	Low	8	1	261-286	PDLRAMRKAEREARKKEKEAKETMAR	mito(22.5),cyto_mito(13),cyto(2.5)	EKPPDLRAMRKAEREARKKEKEAKE (258-282, prob:0.953)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSA5	RHOMBOID-like protein	Low	8	1	126-151	YGMGVQPARKKSKKKKGWLSGRVTWV	plas(25)	ARKKSKKKKG (133-142, prob:0.938)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSA9	Uncharacterized protein	Low	5	1	239-259	AATKEKIRERKKEDYMRYRDW	extr(9),mito(5.5),golg(5),cyto_mito(4),E.R.(3),plas(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUU7	Flavin_Reduct domain-containing protein	Low	6.4	1	799-818	ETTAPRKPRHRSLVNLATRK	mito(19.5),cyto_mito(11.5),nucl(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW84	Uncharacterized protein	Low	5	1	499-521	ALNFCLKRSRKNKSSQPHMHEAG	extr(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYG7	ATP-dependent 6-phosphofructokinase	Low	7.7	2	239-259, 733-759	QKEMCRQIKKHRSLGKRKTIV, METVEKKETEWHRRRPKHEFWMALKET	cyto(14),cysk(5),pero(4),nucl(2),mito(2),mito_nucl(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1I7	RNA helicase	Low	5	1	34-58	QVAYRGATKRPPRKLGQFDPLRPNA	mito(24),cyto(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2W1	Uncharacterized protein	Low	6.3	1	430-449	RNENKRGLAHKKRIEAQQKK	cyto(9),pero(7),cyto_mito(7),nucl(5),mito(5),mito_nucl(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5K1	Uncharacterized protein	Low	5.3	1	39-59	IKKAYRTLSKKYHPDKNPGDD	extr(12),E.R.(8),plas(2),golg(2),nucl(1),cyto(1),cyto_nucl(1),pero(1),cyto_pero(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S656	Uncharacterized protein	Low	6.3	1	352-378	EKTRMRISDEIKKKRDNRKLWVALPDR	mito(21.5),cyto_mito(11.5),nucl(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6I5	LysM domain-containing protein	Low	9.6	1	234-255	LEAAKKGKSKDPQTSGRRKWGF	nucl(17),cyto_nucl(11),mito(6),cyto(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDU7	Uncharacterized protein	Low	5.7	1	1-20	MKFRRSIKTDKDNRPHHISI	mito(16),cysk(5),cyto(3),nucl(2),cyto_pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGY0	GH16 domain-containing protein	Low	5	1	546-565	TTEYIKKHPKAYKNANYTAW	plas(7),extr(7),mito(5),golg(4),cyto(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP76	Autophagy-related protein 27	Low	8	1	208-231	GDDKKEGKLRRREDKPKNKCEDSD	extr(11),mito(5),golg(4),E.R.(3),cyto(2),vacu(2)	KKEGKLRRREDKPK (211-224, prob:0.853)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPJ9	Uncharacterized protein	Low	9	1	309-335	WFIYQNTVKRARNRKIRAAREQERIAE	plas(17),nucl(3),mito(3),E.R.(3),mito_nucl(3)	RK (322-323, prob:0.611)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU27	Integrase_H2C2 domain-containing protein (Fragment)	Low	7.7	1	74-94	TNNCTTCRRSKVNRHAKHGLL	mito(10),nucl(8),cyto(7.5),cyto_pero(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUF6	ABC transporter domain-containing protein	Low	5	1	685-704	SSIIRPKGKRRTSIKQQQER	plas(13),E.R.(5),vacu(4),extr(2),mito(1),pero(1),golg(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S386	Uncharacterized protein	Low	5	1	43-62	SSDPHEKPDRHSRHRSTYSD	plas(8),mito(7),cyto(5),mito_nucl(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKH6	MFS domain-containing protein	Low	5	1	560-580	FYVFGKKIRRASKWSRKSVFD	plas(26)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMA3	SMC hinge domain-containing protein	Low	5.6	1	110-129	FLFRMKDTRRRIRYPIHAVF	plas(10),mito(7.5),cyto_mito(4.5),pero(3),nucl(2),extr(1),E.R.(1),golg(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNK6	Uncharacterized protein	Low	6.6	1	9-32	GNIPAKTKMSQREKKRQQQIASAT	mito(21),nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRT0	Uncharacterized protein	Low	5	1	111-130	SSGSCCSRGRRPQSRKAAPC	plas(12),extr(11),E.R.(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSQ2	Alpha-1,3-glucosyltransferase	Low	8	1	1-23	MASPAAHKPRRRRKIEEGSLAQV	plas(19),E.R.(6)	KPRRRRK (8-14, prob:0.785)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXY9	Squalene synthase	Low	6	1	345-366	CEVFRRYARKIAKRNNPHDPSF	cyto(13),cyto_nucl(9.333),cyto_mito(9.333),nucl(4.5),mito(4.5),plas(2),E.R.(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYZ1	Uncharacterized protein	Low	5	1	25-50	LYCLLVRYLRYKRRDRTPHTLHYPDR	mito(12),plas(4),extr(4),cyto(3),E.R.(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S083	Uncharacterized protein	Low	5	1	356-377	SVSLNKYKKHYRDGQKEKIREV	extr(13),E.R.(5),mito(4),golg(3),cyto_mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REY2	Uncharacterized protein (Fragment)	Low	5	1	73-99	STSRPSSTSTPPRRPSRPPQPYSNRVL	extr(14),mito(5),cyto(3),E.R.(2),cyto_pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHG1	Uncharacterized protein	Low	5	1	2-29	TSSAQSSSSKPPRPKSPHFPPHNAPRVW	mito(18),cyto(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL52	Uncharacterized protein	Low	7.7	1	183-209	DEKIRIERQKSQPRLNKAKKVIQLRKT	nucl(12),cyto_nucl(10.333),mito_nucl(9.333),cyto(7.5),mito(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL87	Carboxylic ester hydrolase	Low	5	1	550-570	TSESTAWKKEKRQVRNSAMHY	extr(21),mito(3),cyto(3),cyto_mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPV9	HNHc domain-containing protein	Low	9.6	1	299-319	FRDLHDRKLRFRNNFRPRARY	nucl(17.5),cyto_nucl(12),cyto(5.5),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRD8	Uncharacterized protein	Low	5	1	457-481	LLVHRERRDEEKCRRKYGKDWDRYV	plas(22),E.R.(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTV8	J domain-containing protein	Low	7.6	1	34-59	LPLQTHKSCRHTFRRHYAQQQQQQDD	mito(8),nucl(7),cyto(4),plas(2),extr(2),pero(2),golg(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVI3	Uncharacterized protein	Low	5	1	279-301	DGSKWIDPKKRPTHKLKFLIGKK	plas(20),E.R.(3),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3E7	Carrier domain-containing protein	Low	6.2	1	2434-2453	HPVHTKVRLMSDKRNRVKAT	mito(10),extr(6),cyto(5),nucl(3),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6C2	ENDO3c domain-containing protein	Low	8.9	1	93-116	STLPTTSLPKKKRKSGPAAESPLK	mito(23),nucl(2.5),cyto_nucl(2.5)	KKKRKSG (102-108, prob:0.783)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Q3	Uncharacterized protein	Low	9.6	1	262-281	TSNFPAGGGKKKKRSGCKVL	mito(17),nucl(5),cyto(5),cyto_nucl(5)	GKKKKR (270-275, prob:0.763)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8X7	Uncharacterized protein	Low	8.9	2	31-56, 80-100	HLSSSPPPHRRTHRYRPHRPSFYTDA, DNPFPDRPTHRRRHQWTPDTT	mito(17),nucl(5),cyto(2.5),cyto_pero(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLB3	Uncharacterized protein	Low	9.5	1	1-43	MLPFLRRLRHPLRRPIHFYRIYEPSPTPRQLERQRERERQEAS	nucl(16.5),cyto_nucl(10.5),mito(6),cyto(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS95	Protein-tyrosine-phosphatase	Low	6.9	1	524-547	RTSSRSPARSPTHKEKQRRAFSTT	mito(15),nucl(5),cyto(4),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYZ7	Uncharacterized protein	Low	8.7	1	157-181	GRIKHSKDTGLRPKNQRKIAKAIRR	mito(23),nucl(2),cyto(2),cyto_nucl(2)	LRPKNQRKIAKAIRR (167-181, prob:0.765)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2H1	Uncharacterized protein	Low	8.3	1	376-395	DMRVCKRSVCWDCKERCKWE	mito_nucl(11.166),nucl(11),mito(11)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3Y3	Dipeptidase	Low	5	1	12-33	ADYTTTQRSRPQRRRLCGIDDV	extr(12),mito(5),golg(4),plas(3),cyto_mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4F2	Uncharacterized protein (Fragment)	Low	8.3	1	7-26	DDYDHRRYLRPKKPEPESFS	nucl(11.5),cyto_nucl(10),cyto(5.5),pero(4),mito(2),golg(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8D3	RING-type domain-containing protein	Low	7.2	1	105-124	RDTAHKYKYRKEDAPRDTRG	mito(12),nucl(6),cyto(5),plas(2),extr(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9Q2	t-SNARE coiled-coil homology domain-containing protein	Low	8.6	1	9-29	FISYRQSYSHHPQKKTRYAGP	nucl(14),cyto_nucl(11.5),cyto(7),mito(2),plas(1),pero(1),E.R.(1),golg(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9S6	Uncharacterized protein	Low	5	1	31-55	RFVLAKLRIRHNTRQKLSRREREEA	plas(18),mito(3),E.R.(3),pero(1),golg(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REW6	alpha-1,2-Mannosidase	Low	6.2	1	27-55	PYDPVPLQSRPRPKKVKNQKYKSFDWPSV	E.R.(7),cyto(6),mito(4),nucl(3),golg(3),cyto_pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT91	Uncharacterized protein	Low	9.1	1	27-48	DETATAILKKKKKPNSLIVTDA	nucl(15.5),cyto_nucl(13),cyto(9.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWG9	Uncharacterized protein	Low	9.6	1	222-243	IPEKQRCKKCKGKKVVETKNVL	cyto(14),nucl(12)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWT4	Uncharacterized protein	Low	8.6	1	1-22	MPSNRLTYRRRAPYNTKSQKVR	nucl(10),mito(9),cyto_nucl(9)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZY6	Uncharacterized protein	Low	8	1	277-296	AAKVAKTETKKPPAKKEDGL	mito(24),cyto(3)	KTETKKPPAKK (282-292, prob:0.706)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S135	WD_REPEATS_REGION domain-containing protein	Low	9.4	1	495-519	KDYFVRQEKKRADRAKVRAKKNMGL	extr(9),cyto(8),cyto_nucl(7.333),cyto_mito(6.333),nucl(5.5),mito(3.5)	KKRADRAKVRAKK (503-515, prob:0.804)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2E0	Arginyltransferase	Low	9.9	1	42-63	LPAASFKPSKDQRKAVNRWNDH	cysk(10),cyto(9.5),nucl(6),cyto_mito(5.5)	RRRK (291-294, prob:0.647)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S353	GPI ethanolamine phosphate transferase 3	Low	5	1	14-37	TGQTGTPRARKPKEQPAQQPRTAV	plas(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S856	Defect at low temperature protein 1	Low	8.8	1	133-156	TAESRKDKEKSHKKKGHHHAPDAT	extr(9),mito(7),nucl(2),plas(2),pero(2),E.R.(2),golg(2)	RKDKEKSHKKKGH (137-149, prob:0.846)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REF4	Uncharacterized protein	Low	5	1	19-39	SPPSKIDTSARPRPRPKLVSF	plas(26)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHI0	MFS domain-containing protein	Low	5	1	547-569	LFWWKGKTFRRWTKDSSVHRQNS	plas(24),E.R.(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJJ8	Uncharacterized protein	Low	6.7	1	45-65	LGTVHAHRKMQQKSRKPFPFL	mito(8),nucl(5),extr(4),cyto_nucl(4),cyto(3),pero(3),cyto_pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJL3	Uncharacterized protein (Fragment)	Low	6	1	766-787	AVVHVKQKGRQQQDQKIRQVKD	cyto(19),cyto_nucl(12.5),nucl(4),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLL9	Uncharacterized protein	Low	5	1	212-231	AAKQIQRKIKRREDGGHNPE	mito(21.5),cyto_mito(13.5),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLY4	Aminomethyltransferase	Low	5	1	37-59	YTTPALRPRKLTRKSYQQIRFAS	mito(23.5),cyto_mito(13.333),cyto_nucl(2.333)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ18	SWR1-complex protein 4	Low	7.9	1	67-86	YEEKKAYRAKRQSTGPAKKW	cyto_nucl(11),nucl(10.5),cyto(10.5),mito(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXQ1	Myb-like domain-containing protein	Low	6.9	1	57-76	KTPNACRKRHERLMERQNAE	mito(18),nucl(5),cyto(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4V7	Uncharacterized protein	Low	8	1	157-177	LGKAHKRKFSKTPRIRGNPDS	cyto(7.5),plas(7),cyto_nucl(5),extr(4),mito(3),E.R.(3)	KRKF (162-165, prob:0.65)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE52	acidPPc domain-containing protein	Low	8	1	18-40	TATGAHEKRSRPRRASRGAASSY	plas(25)	RSRPRR (26-31, prob:0.659)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRR2	Uncharacterized protein	Low	5	1	22-44	EVRNRLAKGRSRRKDLETPNSPR	extr(9),cyto(6),E.R.(6),golg(3),cyto_mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRS4	Acetyl-CoA deacylase	Low	8.3	1	6-25	ALKSRVRRPSYLKKIAKAED	mito(14),nucl(10.5),cyto_nucl(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVX9	Uncharacterized protein	Low	9.5	1	50-71	DSSRGSKPRWKKKCFVCQKEGC	nucl(16.5),cyto_nucl(12),cyto(6.5),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYN4	DWNN domain-containing protein	Low	8.2	2	441-463, 586-611	SDTDSTSSKKRKQPPTDIKPPTA, NDAYDRQPVNPRGRNRRSRAPDFRYL	mito(13.5),cyto_mito(7.5),extr(7),nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5F3	Uncharacterized protein	Low	7.6	1	251-272	RECDKPRDWSRVKCRNCNNYGH	mito(14),nucl(8.5),cyto_nucl(6.5),cyto(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9N3	MAP kinase kinase kinase	Low	8.6	1	166-189	NSNSHRPRNNSATRSRRNNPNAEY	nucl(13.5),cyto_nucl(10),mito(8),cyto(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE76	SUN domain-containing protein	Low	9.2	1	936-970	GEESHSPPRPKARDRGKKQKRSPLRRAQSNHESVT	plas(9),extr(7),nucl(3),E.R.(3),pero(2),mito_nucl(2)	PPRPKARDRGKKQKRSPLRR (942-961, prob:0.981)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPF9	Uncharacterized protein	Low	8.4	2	100-120, 335-357	NQQWQQRKPTRLRRGKVLSKG, RTTDYSAKKTRRKIFFKEKASQL	mito(18.5),cyto_mito(11),nucl(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR28	Uncharacterized protein	Low	8	1	21-42	ERTKVVKKKTGGNPHKNLRQGL	cyto_nucl(11),nucl(10.5),cyto(8.5),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSM9	Uncharacterized protein	Low	6.7	1	355-375	SQNVWRRAYRRDYERKQKEGL	cyto(10.5),cyto_nucl(10.333),cyto_pero(9.666),nucl(8),pero(7.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6Y1	O-acyltransferase	Low	5	1	20-39	ASVLRHRPSHDQKANGKAER	plas(19),E.R.(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAA9	Uncharacterized protein	Low	9	1	42-68	TTEQLQTLKQKGKHKKRRNVWVFGLGG	plas(18),nucl(3),cyto_mito(1),vacu(1),golg(1),E.R.(1),pero(1),cyto(1),mito(1),cyto_pero(1)	KGKHKKRR (52-59, prob:0.8)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REN8	Zn(2)-C6 fungal-type domain-containing protein	Low	9	1	1-35	MSDSGRKRKRPAISCTLCRRRKIRCNRENPCSSCI	nucl(10),mito(8),cyto(4),plas(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLC6	Uncharacterized protein	Low	9.4	1	510-541	TPEFRAKRRAINKARYKTRKRKRDADVANKAH	cyto(16),cyto_nucl(11.5),nucl(5),E.R.(3)	FRAKRRAINKARYKTRKRKR (513-532, prob:0.977)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN24	Uncharacterized protein	Low	5.8	1	47-67	SSTPSRPAKRRQLGTDKAQTK	mito(24),nucl(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPB3	Elongator complex protein 1	Low	9.1	1	1234-1266	TVNTTTTRKTSKNKRREERKRARGKKGTVYEEE	mito(18.5),cyto_mito(11.5),nucl(4),cyto(3.5)	KTSKNKRREERKRARGKK (1242-1259, prob:0.988)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPN5	Dolichyl-phosphate-mannose--protein mannosyltransferase	Low	8	1	12-46	GEKTSSRRSGRSKSRSPAPNGRKQQKSQQKVQGYT	plas(23),E.R.(4)	RRSGRSKSRSPAPNGRK (18-34, prob:0.749)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQN9	Uncharacterized protein	Low	5.8	1	623-642	TSDPKHPRLKVPPKVNSPID	plas(21),E.R.(3),nucl(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWJ5	Peptide hydrolase	Low	5	1	471-498	ATAAQKRSEKYRQFKKEFTKSKRYQRWV	extr(24),E.R.(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2W7	Uncharacterized protein	Low	5	1	74-93	ICFHRISRINRKKCRPPYAQ	cysk(14),cyto(6.5),cyto_pero(5.5),pero(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9A4	Uncharacterized protein (Fragment)	Low	7.4	1	534-557	PKNLKSFVQRRGRARRQRSRYLVF	mito(10),nucl(8),cyto(8),cyto_nucl(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9I0	BTB domain-containing protein	Low	6.9	1	236-256	AASNKEKRLKKELHNRCYREH	cyto(13),nucl(5),mito(3),pero(3),cysk(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REL9	Uncharacterized protein	Low	5.8	1	34-85	NKSDTKALTKSNRQRPRLSNTQRKTWPDPSTISLRPPTRVKRERKLLCWFDS	mito(6),cyto(5.5),extr(5),cyto_nucl(4.5),E.R.(3),nucl(2.5),pero(2),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGN3	DNA-directed RNA polymerase	Low	5	1	1241-1262	NSELSRKIIRWRYNNRRNSDTT	mito(23.5),cyto_mito(13)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH56	Elongation of fatty acids protein	Low	5	1	588-607	RSASNARKPNKKGSHMSLKS	plas(16),pero(4),E.R.(4),extr(1),golg(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKI2	Uncharacterized protein	Low	8.7	1	341-366	LYWLQRWTERRARKRRLKKGFSVADP	plas(17),nucl(2),mito(2),pero(2),vacu(2),mito_nucl(2)	RRARKRRLKK (350-359, prob:0.912)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLB7	Uncharacterized protein	Low	8	1	202-228	PNGDRRRSSFSKKNKRHSRSQSRTYAT	extr(16),plas(8),E.R.(2)	RSSFSKKNKRH (208-218, prob:0.704)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ37	CFEM domain-containing protein	Low	5	1	392-414	EKVVTRISYKPRKKDEDNFIPLV	plas(18),E.R.(6),golg(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5F1	Uncharacterized protein	Low	5	1	792-821	LAFLLYYRTQRQRRQEEERRRQQEQQQQLN	plas(10),extr(5),mito(3.5),E.R.(3),golg(3),cyto_mito(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA58	Ribosomal_L16 domain-containing protein	Low	8.5	1	1-29	MARRPARCYRYCKNKPYPKSRFNRGVPDA	mito(13),nucl(9),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REW9	Uncharacterized protein	Low	7	1	122-148	GSQAKQLRNKEYKKASRRTSNRQSLAT	mito_nucl(9.666),nucl(9.5),mito(9.5),cyto_nucl(9.333),cyto_mito(9.333)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH46	Uncharacterized protein	Low	5.9	1	7-30	RAFIPPLRRRCLPRQSTRRYAVQS	mito(21),cyto_nucl(3),nucl(2.5),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN02	Aspartate--tRNA ligase	Low	8.6	1	14-38	EAPSKNALKKAQKEKEKAEKKAAAK	cyto(19),cyto_nucl(11.666),cyto_mito(10.666),nucl(3),pero(3)	KNALKKAQKEKEKAEKKAAAKARELAERTK (18-47, prob:0.973)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNB0	Protein arginine methyltransferase NDUFAF7	Low	9.4	2	50-72, 80-103	GETKRESRWTPRKHAFPQERTEE, TADMLRSRRERPRRVKMLLRDFID	mito(15),nucl(6),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUN2	Uncharacterized protein	Low	7.4	2	41-64, 535-561	KDDDDDRRPPYKRRRWQLGMLMFV, EALGDWFKLKWWRKKWREDEDHDGRDE	plas(22),E.R.(2),nucl(1),extr(1),pero(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVF8	Peptidase A1 domain-containing protein	Low	5	1	483-505	CGIGWCFWRRRHNRKLEAIKAKY	extr(21),plas(3),mito(1),pero(1),E.R.(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVI8	HMG box domain-containing protein	Low	9.8	1	165-200	ETFTRQTTTPPPREKRRYRRHPRPDAHAPKKPRTAY	plas(17),nucl(5),mito(2),cyto(2),cyto_mito(2)	PREKRRYRRHPRPDAHAPKKPR (176-197, prob:0.959)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWH9	Uncharacterized protein	Low	7.7	1	10-35	AGGYLLHRHYRKKNEKEKLDQDTQHK	nucl(9),cyto_nucl(7.5),mito(7),extr(6),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1W4	Uncharacterized protein	Low	9.5	1	156-184	RYVGPRPPRRQEPKPKQRRGSKRASTRIS	mito(13),plas(6),nucl(4),cyto(3)	PRPPRRQEPKPKQRRGSKRASTR (160-182, prob:0.982)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S451	Uncharacterized protein	Low	9.6	1	188-208	RGEFRKNRKVWKKEERVKEGM	cyto_nucl(10.333),cyto(10),cyto_mito(9.999),mito(8.5),nucl(7.5)	FRKNRKVWKKE (191-201, prob:0.747)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5G8	Uncharacterized protein	Low	7.4	1	2-22	SCPTTRVYPLRKPPNHQPPIP	mito(14),nucl(8),cyto_nucl(7),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REY4	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial	Low	9.2	1	106-127	LDQQGRPKKRERIRPSGPWTVQ	mito(18),cyto(5),nucl(3)	PKKRER (112-117, prob:0.673)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH70	Uncharacterized protein	Low	6.5	1	1-20	MTHPKRTTKLTEKVRQAQLD	mito(13),cyto_nucl(5),nucl(4.5),cyto(4.5),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKD3	t-SNARE coiled-coil homology domain-containing protein	Low	5.7	1	16-39	SSYNRSASPSKTKHKPRPGAASSP	plas(13),mito(4),nucl(2),cyto(2),cyto_nucl(2),pero(2),golg(2),cyto_pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMR3	Phosphotransferase	Low	5.8	1	6-29	LHSVLPKLSPRKRTRDALRTYDRT	mito(15),cyto(5),plas(4),nucl(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNM1	Uncharacterized protein	Low	5	1	1-20	MAQKAPWKTNRRKLDITPLL	extr(13),mito(6),cyto(4),golg(3),mito_nucl(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVE1	Protein kinase domain-containing protein	Low	6.3	1	1-23	MAESSFKQKTMKRKNVKGLALSA	mito(19),nucl(4),cyto(4),cyto_nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXC7	Uncharacterized protein	Low	8	1	37-61	IVGKSRKMPTRAKPPKSNKTPSTST	plas(23),E.R.(2)	RKMPTRAKPPK (42-52, prob:0.682)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXD0	Uncharacterized protein (Fragment)	Low	8.7	1	1-29	RMRVARSKLKRLRKQKRLLKRREQQVFDA	mito(22),nucl(2),cyto(2),cyto_nucl(2)	ARSKLKRLRKQKRLLKRR (5-22, prob:0.961)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0G4	Glucose-6-phosphate isomerase	Low	6.4	1	28-49	VLKEYFKKDPQRFEKFSRTFKN	cyto(15),cyto_nucl(11),nucl(5),pero(3),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S350	Uncharacterized protein (Fragment)	Low	7.6	1	14-35	AVVHVKQKGRQQQDQKIRQVKD	mito(16),nucl(9),cyto_mito(9)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6H4	Uncharacterized protein	Low	6.8	1	30-51	HAPGTSRTRRRHQSALIKRSIR	cyto(13),cyto_nucl(11),nucl(7),mito(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7T6	EngB-type G domain-containing protein	Low	8.2	2	3-28, 128-151	VWKQTPRYICRQCIRHYRKSPAAIRI, SSSLTTAKQRRRMLRHPEKEGKEM	mito(15),cyto(6),nucl(3),plas(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9N2	MFS domain-containing protein	Low	5	1	785-807	IPFALYKWGKQIRHKSKLARKDI	plas(21),mito(2),E.R.(2),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHM9	MFS domain-containing protein	Low	5	1	486-505	LRLVQHKDEKGRRREKESLT	plas(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMU2	Uncharacterized protein	Low	5	1	19-40	YVINRYVRSKRNRLPLPPGPKG	extr(6),mito(5),cyto(5),cyto_mito(5),plas(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPE8	Carboxylic ester hydrolase	Low	6	1	46-69	ALPPTGERRFRPPRKVQPSQDTID	cyto(12),cyto_nucl(8.833),cyto_pero(8.833),nucl(4.5),pero(4.5),mito(3),cysk(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPJ8	Uncharacterized protein	Low	8	1	120-142	EEVREMKRVKRRAERAAMRERGD	mito(11),plas(10),cyto(2),E.R.(2)	REMKRVKRRAERAAMR (123-138, prob:0.851)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUG7	KH domain-containing protein	Low	6.9	1	67-88	RPVRSRFDTDRRSRSPSRKESE	mito(15),nucl(6.5),cyto_nucl(6.5),cyto(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWH3	Adenine DNA glycosylase	Low	8.3	1	265-284	EAPRVPKKRKAATKQTNTLS	nucl(11.5),cyto_nucl(10.5),cyto(6.5),pero(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZM0	Uncharacterized protein	Low	5	1	51-73	AGYKNTKTSKKAKKTSPTFAQPD	mito(23.5),cyto_mito(13)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5K7	Uncharacterized protein	Low	5	1	10-31	GAEYRNYRSKRRKASKTFGAYY	mito(18.5),cyto_mito(11),cyto(2.5),golg(2),plas(1),pero(1),E.R.(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD02	YL1_C domain-containing protein	Low	9.3	1	22-50	IYAVPKPFRNPNWKPPQRRNKNLKQILGE	nucl(16.5),cyto_nucl(12.5),cyto(5.5),mito(2),plas(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDT7	Amino-acid acetyltransferase, mitochondrial	Low	6.8	1	42-61	TSVRRSSSSAKERQRAERQQ	mito(18),nucl(5.5),cyto_nucl(4.5),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLR1	Uncharacterized protein	Low	5	1	14-40	THRPLPPLPKLRVRRPNKPEMNPCLGA	mito(9),plas(8),cyto(6),mito_nucl(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMN7	Uncharacterized protein (Fragment)	Low	8.9	1	63-87	WAVERYRHKSFKRRKMAVIRERTRP	mito(20.5),cyto_mito(11.5),nucl(3)	RHKSFKRRKMAVIRERTRPLLRKGL (69-93, prob:0.886)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP41	Uncharacterized protein	Low	8.9	1	23-49	LGFKVLKQGKQGPKKVKILPRPWPVDA	nucl(14),cyto_nucl(12),cyto(8),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ63	Uncharacterized protein	Low	9.5	1	8-29	FTRPFSRRSMSPKKDSRPASPR	nucl(17),cyto_nucl(11.5),mito(5),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ89	Uncharacterized protein	Low	8.8	1	224-249	AQVKLSSKRAKSKIRWLEKRNYLSCQ	nucl(14),cyto_nucl(10),mito(9),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2D9	S5A_REDUCTASE domain-containing protein	Low	8	1	274-301	MGVWAWKKERRYRKEFGDKYKRKRYAIL	plas(19),mito(4),E.R.(2),mito_nucl(2)	KKERRYRKEFGDKYKRKR (280-297, prob:0.769)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Q7	Calcium-transporting ATPase	Low	5	1	1274-1297	GSQAPPTPNSRRRTRSRSNSAFGP	plas(21),E.R.(2),mito(1),pero(1),golg(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RES0	Uncharacterized protein	Low	5	1	476-495	IWYTRRLKKQRDFREKQLQN	extr(21),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF44	Uncharacterized protein	Low	8.4	1	2-26	SIDPTSPRQSRGKQRRSYRVEEEYS	nucl(12.5),cyto_nucl(9.5),cyto(5.5),mito(5),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU87	MFS domain-containing protein	Low	8	1	92-116	DSLEDGRPSKPRRHQKRARFASQDL	plas(22),mito(3)	PSKPRRHQKRA (99-109, prob:0.774)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S146	Lysophospholipase	Low	8	1	780-824	ERTKRTVRAVYERKKAQREQREKDERERRWRWKMRQGRIAGRRVG	mito(19.5),cyto_mito(13),cyto(5.5)	ERKKAQREQREKDERERRWRWKMRQGRIAGRR (791-822, prob:0.963)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S161	RGS domain-containing protein	Low	9.6	1	417-437	DSWKRVSSKLWPKKKSGGQLR	nucl(12),mito(10),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S933	Uncharacterized protein	Low	5	1	592-611	WFAWVGRRRGQERNKFRMPD	plas(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAX6	Uncharacterized protein	Low	5	1	205-231	IKASVKGKLEDRRQKKDKKMMMQTMGE	plas(21),E.R.(3),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCW0	WD_REPEATS_REGION domain-containing protein	Low	8	1	308-335	SPEEVRKSLVRKRKRKREKSKNETNGEA	cyto(11.5),cyto_nucl(6.5),mito(6),extr(4),E.R.(2)	VRKSLVRKRKRKREKSK (312-328, prob:0.99)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG16	DDE-1 domain-containing protein	Low	9.1	2	19-45, 369-395	VDNFVKHSPKLRTRPSRPYDRHRALCE, LEKANETATQRKSRKRKYIRTEETLTV	mito(11),cyto_nucl(7),nucl(6.5),cyto(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJN0	Protein kinase domain-containing protein	Low	8.2	1	22-42	SNPANGFPKKHKFIRKIQAGS	nucl(12.5),mito_nucl(9.5),mito(5.5),cyto(4),pero(4),cyto_pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJZ5	SGNH_hydro domain-containing protein	Low	8.8	1	224-243	IRAADTLKRKRSVRRVVKRD	extr(19),mito(5),nucl(2)	KRKRSVRRVVKR (231-242, prob:0.763)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL14	AB hydrolase-1 domain-containing protein	Low	5	1	38-57	QSTQATRKIHQHSPRKAQHA	mito(23.5),cyto_mito(13)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQG5	Ribose-phosphate diphosphokinase	Low	6.2	1	88-112	VMPYFPYSRQSKKKQHRGAITARMV	cyto(11.5),cyto_mito(10.5),mito(8.5),nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV42	CAP10 domain-containing protein	Low	5	1	739-761	GFSRNGGWRRQHRQRVVQRINAP	plas(23),extr(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY97	MMS1_N domain-containing protein	Low	7.5	1	1230-1251	RLGRGDIRPPWRRPNPNGKVTG	cyto(12),cyto_nucl(11.5),nucl(9),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYL3	Uncharacterized protein	Low	8	1	103-127	LLGPYLNKKKPSRKKQSNGFVKQST	plas(21),mito(3),E.R.(3)	KKKPSRKK (110-117, prob:0.695)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0A3	Terpene synthase	Low	5	1	14-36	GMDRSRRKLSNSKHPPEHKDAPF	mito(16),cyto(9.5),cyto_pero(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S266	Uncharacterized protein	Low	8	1	395-418	SITKRAYHGRVARPRRSGRRVVPN	cyto(10),extr(10),cyto_mito(8.833),mito(6.5),cyto_nucl(5.833)	ARPRRSGRR (406-414, prob:0.709)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S409	Uncharacterized protein	Low	5	1	199-220	ADWKRRWPNRVEHSKRYRRPEN	extr(23),cyto(1),plas(1),E.R.(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S628	Uncharacterized protein	Low	8.3	1	230-250	NVHVLKDKPKKKTQLEAEKAE	nucl(12.5),cyto_nucl(12),cyto(10.5),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7U0	S5A_REDUCTASE domain-containing protein	Low	5	1	204-227	ADRQKDKWVKEKKQKKHSEEFLTH	plas(11),extr(9),E.R.(4),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE42	Protein kinase domain-containing protein	Low	5.8	1	73-92	QTKNPKPCPRLIKEAKNLER	mito(19.5),cyto_mito(12),cyto(3.5),nucl(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFK1	Oxidored_q6 domain-containing protein	Low	5	1	211-230	VFQLQKKMRHTKITRMWYRK	mito(25.5),cyto_mito(14)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNE4	Uncharacterized protein	Low	5	1	96-118	EATSNTKPIRQRKSYRDEIKEKG	plas(13),mito(9),E.R.(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNT5	Pyr_redox_2 domain-containing protein	Low	8	1	55-81	RQQSNGAPKPKPKRFRVLRWTWRLAQF	mito(16.5),cyto_mito(11.5),cyto(5.5),pero(3)	PKPKR (64-68, prob:0.64)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ22	Fe-S cluster assembly protein DRE2	Low	5	1	214-236	QPLECQPKPGKRRRACKDCTCGM	cyto(18.5),cyto_nucl(10.5),mito(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQC7	Uncharacterized protein	Low	8	1	382-404	TDTVRKIKDFKRRIPGNGRPYFA	plas(17),E.R.(5),vacu(2),mito(1),cyto(1),golg(1),cyto_mito(1)	KGKMKAEEKANNKKSGTFGSLAKRIGFKKR (7154-7183, prob:0.74)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRG2	Uncharacterized protein	Low	9.4	1	235-256	VPIPAPLKRGHRDRNTNKTLNQ	nucl(17),cyto_nucl(11.5),mito(6),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXI3	Uncharacterized protein	Low	5.7	1	6-27	EYYQHTPSPRPQRQKYHSPESF	plas(19),E.R.(3),nucl(2),mito(1),cyto(1),pero(1),cyto_mito(1),cyto_pero(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0Q4	Uncharacterized protein	Low	8	1	150-176	AFTRIYMKRSVRKNKLRKYGRKLILEM	cyto(11.5),cysk(10),cyto_nucl(7),pero(4)	VRKNKLRK (160-167, prob:0.696)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6A6	Uncharacterized protein	Low	8.4	1	797-820	VDTGKTLKPKKMNLKKQSVEDLRR	mito(14),nucl(10.5),cyto_nucl(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S729	UBC core domain-containing protein	Low	8.8	1	131-152	RENTPEFKKRVRKCVRDSLEFE	nucl(12),cysk(8),cyto(6),mito_nucl(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGH5	Uncharacterized protein	Low	9.6	1	498-531	VETPQPAKANKRARNKKGSKKNKETEQRRFETKN	cysk(8),pero(7),cyto(6.5),cyto_nucl(6.5),nucl(5.5)	AKANKRARNKKGSKKNKE (504-521, prob:0.977)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGN6	Uncharacterized protein	Low	9.9	1	365-384	DNPRAVKRPRVRQTRTQPSA	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK38	Uncharacterized protein	Low	5	1	39-59	AHPYHPKKTCPESPPRSKTCN	extr(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKX5	Uncharacterized protein	Low	8	1	198-226	MQQKQKSDMRSSRKKRPTANLPRRFKNAL	plas(24),mito(1),golg(1),vacu(1)	SRKKRPTA (209-216, prob:0.75)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW41	Uncharacterized protein	Low	9.9	1	17-41	SSRDRDSSERGKKRARTQSMPPPEL	nucl(19),cyto_nucl(13.5),cyto(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWG5	IF3_C domain-containing protein	Low	5	1	252-276	VLKGKKMEGEDKKSKKNRQEETGVE	mito(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXG8	Uncharacterized protein	Low	8	1	50-74	GEEDGEKKKKKPSKLKTAWGKLGLD	plas(23),E.R.(3)	KKKKKPSKLK (56-65, prob:0.909)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0M3	Fe2OG dioxygenase domain-containing protein	Low	5	1	869-891	GAFKEIIGKKWRRREGNEPGKVV	extr(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1U4	Uncharacterized protein	Low	7.8	1	162-181	PPPVRPQQHQQQQHQQQPQQ	nucl(9.5),cyto_nucl(9.5),mito(9),cyto(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S212	Uncharacterized protein	Low	7.1	1	87-106	NTPHTEHRRTQKSKRFGAKG	cyto(9.5),nucl(7),cyto_mito(7),extr(6),mito(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFJ6	Uncharacterized protein	Low	9.2	1	210-237	TMNGQPSPYNNKKRTRDNENKPAKPCLC	nucl(14),cyto_nucl(9),mito(8),cyto(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ18	CNH domain-containing protein	Low	6.1	1	3-27	EATSQSQSVRRKPPQHGPYILRKLV	mito(15.5),cyto_mito(11.5),cyto(6.5),nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMZ0	Uncharacterized protein	Low	8.9	1	597-621	ILRPSRSRSLSKLKLKNDRPRVFDP	nucl(14.5),cyto_nucl(12),cyto(6.5),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPI2	Uncharacterized protein	Low	9.6	1	279-303	SVDRETLWQRRKKVHVRKRFDAESI	nucl(18),cyto_nucl(12),mito(5),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQQ3	Vacuolar calcium ion transporter	Low	5	1	34-61	RTVPPHSDDRRSRSRRRSSLPQYNHNGH	plas(24),E.R.(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZM7	Uncharacterized protein	Low	8.8	1	15-36	TEEMQARKRQRTTTRQNPFFEQ	mito(16),nucl(10)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZR3	Uncharacterized protein	Low	9	2	174-194, 419-439	GDRQRAYKRLDRRLRRRSLEF, CTDQILPKERREQRRQDAEDG	mito(10),cyto_nucl(7),nucl(6.5),cyto(6.5),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1E5	Uncharacterized protein	Low	5	1	32-54	LWYLYRHCPPQPVKRNWHFFAKL	plas(22),E.R.(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4S7	Uncharacterized protein	Low	5	1	30-54	GFVKVLYNRQKLKKAKKAELEAGPR	extr(23),mito(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S580	SUN domain-containing protein	Low	9.6	1	299-322	QPQSQSQSMRQPPRRRPHHKGVAE	nucl(12),mito(11),cyto(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5F7	BTB domain-containing protein	Low	7.6	1	195-216	GHVKSTKKRFCDKYHSHPWDRL	cyto_nucl(9.5),nucl(9),cyto(8),mito(4),extr(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5L4	Asparaginyl-tRNA synthetase	Low	8.9	1	73-97	MKKAVNYAKTQKKKAEKEQGQLASR	nucl(14.5),cyto_nucl(11.5),cyto(7.5),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6L2	Zn(2)-C6 fungal-type domain-containing protein	Low	8.1	1	16-37	LVSCDRCKIRRARCIRDNADVP	plas(15),nucl(8),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9I6	Uncharacterized protein	Low	9.5	1	11-34	KATRLKDKVVKRPARGYHKFKNGL	mito(13),cyto(6),nucl(4),pero(4)	VKRP (20-23, prob:0.63)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMY9	Uncharacterized protein	Low	9.4	1	635-654	VLRGGRGRGRGRRGRGRGGG	cyto(9.5),cyto_nucl(7.5),extr(5),nucl(4.5),mito(3),pero(3)	RGGRGRGRGRRGRGRGGGGGGGGGG (637-661, prob:0.992)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR42	Uncharacterized protein	Low	9.5	1	88-121	GQDSIQRKSKKHEQFKERNARKKQRLQESRAAKD	cyto(13.5),cyto_nucl(10),pero(8),nucl(5.5)	RKSKKHEQFKERNARKKQR (94-112, prob:0.839)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRN0	J domain-containing protein	Low	5.4	1	41-60	NPKPHPGSPRFIKHRRNILI	plas(9),extr(8),E.R.(5),mito(2),nucl(1),pero(1),vacu(1),cyto_mito(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUF0	Uncharacterized protein	Low	7	1	21-44	EVVPMPKQPKRRFVGRKTADKASG	cyto(11),cyto_nucl(10),nucl(7),plas(4),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXL0	WD_REPEATS_REGION domain-containing protein	Low	7.8	1	1-26	MATQYPPPSKRQKREQAEIARQQQDI	nucl(11),mito(9.5),cyto_nucl(8.333),cyto_mito(7.166),cyto(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S174	Uncharacterized protein	Low	8	1	333-359	LRVAKGNAKSKKDKGTPKKNKAKPSDS	mito(20.5),cyto_mito(13),cyto(4.5)	AKGNAKSKKDKGTPKKNKAKP (336-356, prob:0.967)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3D7	Uncharacterized protein	Low	7	2	1-21, 285-304	MPPIRTQKKHTSPPRGIPSLE, LVVRVEKYRKGRKVTVWQGW	mito(20.5),cyto_mito(12.5),cyto(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S467	Uncharacterized protein	Low	5	1	13-32	TFVLYTRYKNRPPPGKQAAP	plas(13),mito(7.5),cyto_mito(4.5),extr(3),E.R.(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4B6	Uncharacterized protein	Low	7.6	1	53-76	AIHGPFRPTTRQRQQQPELRPPQE	mito(13),nucl(9),cyto_nucl(8),cyto(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD35	Uncharacterized protein	Low	8	1	408-432	DIGLHQHHHRRRRHRSHEHASRLKA	plas(21),mito(3),E.R.(2),cyto_mito(2)	HHRRRRHRSHEHASRLK (415-431, prob:0.855)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ47	Uncharacterized protein	Low	8.2	1	129-148	YLYGYPKGPKKRFRSPVEFF	nucl(10),cyto(7.5),cyto_pero(6),mito(4),pero(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSL5	Uncharacterized protein	Low	8	1	358-383	SDGGPVYKKKKKKGPTQSVANCKRAC	extr(9),plas(7),E.R.(4),mito(3),golg(3)	KKKKKKG (365-371, prob:0.822)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW32	Uncharacterized protein	Low	9.8	1	14-41	EATEAARQLRQQRYQRQRRAQAPPEFIA	nucl(19),cyto_nucl(12.5),mito(4),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S388	RNase H domain-containing protein	Low	9.7	1	208-238	QETLQRIKSRKEKKAEKRKASWEKKNAARRA	cyto(8),cyto_nucl(8),pero(7),nucl(6),mito(6)	IKSRKEKKAEKRKASWEKKNAARRAGPKNVGERIAAKKAREEAARLLPP (214-262, prob:0.997)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S468	Uncharacterized protein	Low	8.7	1	224-243	EYRMRHTRDQGRHRNRHRLT	nucl(14),cyto_nucl(12.5),cyto(9),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA21	Kinesin motor domain-containing protein	Low	5	1	1073-1094	RSASPVKKMRILKTKKWEDPEG	mito(24.5),cyto_mito(13)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RC99	MRP-S28 domain-containing protein	Low	8.9	2	11-32, 308-328	QSRQCPPRIRARASPRHNTRAQ, DVPFDFRHHTPKKRTEFPKEW	mito(18.5),cyto_mito(10.5),nucl(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIN8	Septin-type G domain-containing protein	Low	9.7	1	1-24	MSSALNKTRRKKNVKKGIQFCLMV	mito(18),nucl(5.5),cyto_nucl(5),cyto(3.5)	RKK (10-12, prob:0.637)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK81	SMP-LTD domain-containing protein	Low	5	1	873-899	SESSTVPPPLPKRRQRQPSVNQRGGHN	extr(10),plas(3),E.R.(3),cyto(2.5),cyto_nucl(2.5),mito(2),golg(2),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLZ0	RNase H domain-containing protein	Low	9	1	299-326	MMKPPAPKYEKPTPKKPQRPWDTPDPLH	mito(10),cyto(9.5),cyto_nucl(7),pero(4),nucl(3.5)	RRKVGGSRRPRWR (350-362, prob:0.829)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLZ1	tRNA-dihydrouridine synthase 3	Low	9.8	1	369-392	DEEGPPKKKRKQMSKSEKKKEASN	cyto(11.5),cyto_mito(8),nucl(6),cysk(5),mito(3.5)	PPKKKRKQMSKSEKKK (373-388, prob:0.954)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM57	SF3b1 domain-containing protein	Low	9.9	1	181-206	VDGDKTPPVKKTRKRRRWDEAADEAE	plas(15),nucl(5.5),cyto_nucl(5),cyto(3.5)	PVKKTRKRRR (188-197, prob:0.857)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRR6	Uncharacterized protein	Low	5.8	1	65-87	PQPDKYRPPSHGKKPPNRNLENK	mito(22.5),cyto_mito(12),nucl(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTB3	Uncharacterized protein	Low	6.9	1	296-315	IMRSNKKKRMQAFQQRTPNP	plas(8),cyto(7.5),cyto_nucl(7.5),nucl(6.5),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTL5	Uncharacterized protein	Low	9.1	1	786-820	IRRFNWRNVKRMNPQFKNKCSRGFRYRKNPMCEDW	nucl(15.5),cyto_nucl(12),cyto(7.5),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ81	RNase_PH domain-containing protein	Low	5	1	30-51	QYIEKLRPTRSRGPNELRRIFL	mito(19),cyto(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4J5	Uncharacterized protein	Low	6.4	1	179-199	NQSARVCKGPKRYQKKTSIDL	cyto(11),cyto_nucl(10.833),cyto_mito(6.665),cysk(6),nucl(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJW0	Aminotran_1_2 domain-containing protein	Low	5	1	53-73	TANFRLKSHDHKPKAKQWSHI	cysk(18),mito(3),cyto(3),pero(3),cyto_mito(3),cyto_pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL12	alpha-1,2-Mannosidase	Low	5	1	81-100	ETEHNKAKRLQRQAAVKKAF	extr(14),E.R.(6),golg(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ53	Beta-ketoacyl-[acyl-carrier-protein] synthase I	Low	6.9	1	1537-1559	YALYTEKRQSREKKAVRRFHEAM	cyto(15),cyto_nucl(12),nucl(7),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWA0	Integrase catalytic domain-containing protein	Low	6.7	1	9-29	TNNCTTCRRSKVNRYAKHGLL	mito(19.5),mito_nucl(13.833),nucl(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY48	Uncharacterized protein	Low	7.1	1	8-27	SDDLTRPKKHVKSSTARGIV	mito(15),nucl(6.5),cyto_nucl(5.5),cyto(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S016	Protein-tyrosine-phosphatase	Low	9.9	1	497-516	RGLNKLKFKSRAKLNRATTF	nucl(19),cyto_nucl(13.5),cyto(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2V0	Uncharacterized protein	Low	9.6	1	1-21	MARKWKKSHAFPTKSNPNTKY	nucl(16),cyto_nucl(10.5),mito(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S513	Uncharacterized protein	Low	9.7	1	31-59	DYKRRNDPGFRKQLKKESKRTERQAKEEA	mito(7),cyto_nucl(6),nucl(5),cyto(5),E.R.(4),extr(3)	FRKQLKKESKRT (40-51, prob:0.738)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RER1	Uncharacterized protein	Low	5	1	279-300	GIIFWVFRKRRQQKANPYNDVA	extr(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH01	Uncharacterized protein	Low	5.7	1	398-418	IYNNEKTKEWLRSRRWEMKGW	mito(12),plas(5),golg(3),nucl(2),E.R.(2),cyto(1),extr(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIH5	Uncharacterized protein	Low	8.4	1	3490-3513	IFNGILAKRKESRRRNLQFHLPLI	nucl(11.5),cyto_nucl(9.5),cyto(6.5),plas(4),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIH9	DUF1115 domain-containing protein	Low	5.9	1	232-254	DIPAHHKKVSERHREKCEKRVFP	cysk(21),cyto_nucl(3),nucl(2.5),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKD5	Mitochondrial escape protein 2	Low	5.3	1	152-175	PVKPWWSPWKRMRAKVVRGRPWVE	mito(14),plas(9),nucl(1),cyto(1),cyto_nucl(1),pero(1),golg(1),cyto_pero(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPZ3	Probable lysosomal cobalamin transporter	Low	5	1	280-299	DLTRKLKRARHAKCRFENEW	plas(22),mito(2),extr(1),E.R.(1),vacu(1),cyto_mito(1),mito_nucl(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQE4	Zn(2)-C6 fungal-type domain-containing protein	Low	8.3	1	1-41	MTEQRVAKRKTHTKSRKGCFQCKSRHTKCNEARPRCGNCVR	mito(14),nucl(10.5),cyto_nucl(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS61	Uncharacterized protein	Low	9.4	1	321-342	QTFLSPNIKKRRRSETPPEEIG	nucl(18),cyto_nucl(15),cyto(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYC4	Histone deacetylase (Fragment)	Low	9.4	1	463-482	RAQPGTKKRRHITDYPNPHA	nucl(17),cyto_nucl(13.5),cyto(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S287	Uncharacterized protein	Low	5	1	578-601	ESSSSKRPTSRHSRKSSRERAAVA	plas(20),E.R.(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7U4	Uncharacterized protein	Low	9.4	1	274-298	PILGITRQKTAKKKNKKSVDDDADD	plas(15),nucl(4),E.R.(3),cyto(2),mito(1),golg(1),vacu(1),cyto_pero(1)	KKKN (285-288, prob:0.639)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S842	Drf_GBD domain-containing protein	Low	7	2	82-105, 831-856	TSPPSPRKSQSSPRKSLNKKTLSA, KGNVSPAKQSPKKKVEPPPQLQSPPQ	mito(22),mito_nucl(13.833),cyto_mito(11.833)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8J2	Uncharacterized protein	Low	8.5	1	299-320	TTTTQVRSRKPRKSKETWLDGT	mito(13),nucl(9),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA18	Uncharacterized protein	Low	7.8	1	185-206	DHYFNKKTKKAYPERDHRDHCL	nucl(7),mito(6),plas(5),golg(3),extr(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGQ8	Uncharacterized protein	Low	6.7	1	1-20	MPPKASKKRARSSNVPTTST	mito(16),nucl(5.5),cyto_nucl(5.5),cyto(4.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI63	S5 DRBM domain-containing protein	Low	8	1	25-52	HRTFHASAPRQARKKRPHYPSIKAEDLK	mito(23.5),cyto_mito(13)	PRQARKKR (33-40, prob:0.742)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPM0	Uncharacterized protein	Low	5	1	303-325	SENCNGEKYKRGRRAFRDTILRA	extr(20),mito(3),cyto(2),pero(2),cyto_pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPQ1	alpha-1,2-Mannosidase	Low	5	1	103-127	QSKHFPETRAQRRYREERRVAVRNE	mito(21.5),cyto_mito(12.5),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUH8	Glyco_hydro_cc domain-containing protein	Low	5	1	1-22	MSQFKQSTRHQRQRMRYMNLFA	extr(18),mito(4),golg(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4I9	DUF155 domain-containing protein	Low	7.6	1	66-88	PEETQQQPKRKAARKNATKTSSL	mito(11),nucl(9),cyto_nucl(8.5),cyto(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S502	MYND-type zinc finger protein samB	Low	7	1	267-290	LEKVAIRVKKRWDNRDKERWCGHC	pero(12),nucl(6),cyto(6),cyto_nucl(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S620	Peptidase A1 domain-containing protein	Low	5	1	435-463	VAWMRKKDERNLKRELKRNSQRKLEQMDI	extr(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Q0	tRNA 4-demethylwyosine synthase (AdoMet-dependent)	Low	8.9	1	97-126	VRIVSKAKKGPKTVKGRKIQKKNIVPVSTF	cyto(14),cyto_nucl(9.5),mito(4),nucl(3),E.R.(3)	KAKKGPKTVKGRKIQKK (102-118, prob:0.922)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE00	Vacuolar protein sorting/targeting protein 10	Low	7	2	1010-1031, 1236-1260	DEVNKGSKKKKQSRITHNDGAD, GHVAQYHRKKRDVKCRNGQRIDQMH	E.R.(7),extr(6),plas(5),golg(4),vacu(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF02	Tautomerase_3 domain-containing protein	Low	8	1	65-84	EDEEKKKKKSHQRPFVRITI	mito(12.5),cyto_mito(10.5),cyto(7.5),pero(4)	KKKKKS (69-74, prob:0.719)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ93	Non-specific serine/threonine protein kinase (Fragment)	Low	9	1	593-622	PAAPATPKKKKTHRGRRGGRRLSKNQQKEE	mito(9),cyto(8),cyto_nucl(6.5),nucl(3),E.R.(3),pero(2)	PKKKKTHRGRRGGRRLSK (599-616, prob:0.986)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKQ2	Uncharacterized protein	Low	7.4	1	38-57	YLTRCKGLRLRRPLVRRNGD	nucl(8),extr(7),mito_nucl(7),mito(6),cyto_nucl(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL35	Uncharacterized protein	Low	9.9	1	379-402	ASSSTSSKRKRAEKESPQQRKSAR	nucl(18.5),cyto_nucl(13.5),cyto(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPI1	DNA-directed RNA polymerases I and III subunit RPAC1	Low	7.8	1	354-375	LESVKLLKIKCQRIKRGLDEMM	cyto(12),nucl(7),pero(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTZ8	Uncharacterized protein	Low	5	1	3-26	DDTILKHTQRWRRSRYSARPFALT	plas(22),E.R.(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU20	Uncharacterized protein	Low	7.1	1	33-55	LHLVRGKQTKSSKAKKAEQNATA	mito(17),nucl(6.5),cyto_nucl(5),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYL7	Uncharacterized protein	Low	8	1	50-70	AQLPRRERRAHARAQSRSRSP	extr(15),plas(10)	RRERRAHARAQSRS (54-67, prob:0.716)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2K8	DUF2293 domain-containing protein	Low	9.6	1	11-39	QRNHVRDQSRATLRKKKNKNQYKIVLEAV	nucl(15.5),cyto_nucl(9.5),mito(9)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S450	Carrier domain-containing protein	Low	5.8	1	2463-2484	HLDYLRPHLKHHKTDRNATDTP	cyto(11.5),cysk(10),cyto_nucl(7.5),nucl(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCC1	Uncharacterized protein	Low	7.5	1	31-60	PPLSARPLAHLQKRRQKTNESQRQRQPVSS	mito(13),nucl(8.5),cyto_nucl(7.5),cyto(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REF6	Glycos_transf_1 domain-containing protein	Low	5	1	5-25	QVPTQRPMLRRQTTQERRQKS	mito(20),pero(3),cyto(2.5),cyto_nucl(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG51	Uncharacterized protein	Low	8.3	1	48-67	LAKHLHRPRRSRFKTICSYT	nucl(9),mito(6),cyto(4),plas(4),pero(1),golg(1),cysk(1),vacu(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG53	Aa_trans domain-containing protein	Low	5	1	47-69	THDPEDPLRHKNKKDSEKFDSSS	plas(26)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJT2	Protein kinase domain-containing protein	Low	6.9	1	894-914	QVKLCRYKKASNKKVVIKYVT	cyto(9.5),cyto_nucl(9.5),mito(9),nucl(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK19	MAGE domain-containing protein	Low	9.1	1	9-29	EEPEETPPVRRQQRRERDESP	nucl(15),cyto_nucl(11),mito(6),cyto(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUD0	F-box domain-containing protein	Low	6.5	1	83-102	ASKVKTLRIRTVRKNVAKLC	cyto(16.5),cyto_nucl(11.5),nucl(5.5),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUZ6	Histone domain-containing protein (Fragment)	Low	6.9	1	1-20	SARKTLPKVPSKRYKFKAGT	mito(18),nucl(5),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S282	Aspartate-semialdehyde dehydrogenase	Low	5	1	3-22	AEKFTSHTRNFPKKKCGVLG	cyto(14),mito(10),cyto_nucl(8.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2C3	Uncharacterized protein (Fragment)	Low	8.2	1	40-60	ATAPLRRRKNREQLPAAQPRL	nucl(12),cyto_nucl(11),cyto(8),mito(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4M5	Uncharacterized protein	Low	9.1	1	222-241	QDHERWHRGRQRVRESNANQ	nucl(14.5),cyto_nucl(9.5),pero(4),cyto(3.5),E.R.(2),golg(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S845	Uncharacterized protein	Low	9.6	1	433-471	ECELETKTKKKKKGLLGLGGDKAKDKKDHESKDKAHKSL	mito(11.5),cyto_mito(10.166),cyto_nucl(8.333),cyto(7.5),nucl(7)	KTKKKKKGLLGLGGDKAKDKKDHESKDK (439-466, prob:0.942)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S993	NET domain-containing protein	Low	9.5	1	140-163	GMRNKDAAKKKSRRDKNVDMEKLA	cyto(13),cyto_nucl(10.333),cyto_pero(8.333),nucl(6.5),mito(4)	AAKKKSRR (146-153, prob:0.752)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHF3	MFS domain-containing protein	Low	5	1	552-571	LCHGRFKKVFIDNNRRLRRE	plas(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ16	MFS domain-containing protein	Low	5	1	567-591	GSMRNRSKFCQYLRQKKREEEDARE	plas(22),mito(2),E.R.(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKZ9	Uncharacterized protein	Low	5	1	26-50	IAIWAFWRHSRKRKRAINQQSQLTS	extr(8),mito(6),plas(6),E.R.(4),mito_nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S109	DNA-(apurinic or apyrimidinic site) lyase	Low	8.8	1	376-419	AVAKVTIKKETTKRKRVKKEPEEEELAAVKVKQEPTRRSKRQRS	cyto(14),cyto_mito(10.833),cyto_nucl(9.333),mito(6.5),nucl(3.5)	KKETTKRKRVKKEPEEEELAAVKVKQEPTRRSKRQRS (383-419, prob:0.912)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKG7	Phospholipid-transporting ATPase	Low	5.4	1	1289-1315	MEQFQKAIRKVRQVQRMRKQRGYAFSQ	plas(22),golg(2),nucl(1),cyto(1),cyto_nucl(1),E.R.(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQF6	Alpha-1,4 glucan phosphorylase	Low	7.1	1	359-379	DIVRRFKKSKRAWKEFPNQVA	cyto(11.5),cyto_mito(9),nucl(7),mito(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTV1	Uncharacterized protein	Low	9.9	1	1414-1434	YQKSTEKKSRIWKTGRTEFFR	nucl(19),cyto_nucl(13.5),cyto(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVI6	Uncharacterized protein	Low	5	1	502-522	PDQPADKQSPLRKLRRQQPHH	extr(11),mito(10.5),cyto_mito(6.833),cyto(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYN2	TSPc domain-containing protein	Low	5	1	720-739	GSLGRHGKLRRDLHKRELTA	extr(24),mito(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7U6	Uncharacterized protein	Low	6.6	1	26-50	TCKQNASLRSPTRRGRRQLTTTACR	mito(16),cyto(5),nucl(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGQ1	Dolichyl-phosphate-mannose--protein mannosyltransferase	Low	7	2	2-28, 701-724	SSPPGTLRQRTGKDKKRPVSPNPDALS, TPGAVKGHRRTRSRPVRERVATSS	plas(26)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRW0	Uncharacterized protein	Low	8.1	1	34-59	GHTEKTQLTTRSRRSQRPRRTFTGAL	nucl(11),mito(10),cyto_nucl(10),cyto(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXA5	Proton-translocating NAD(P)(+) transhydrogenase	Low	5	1	39-59	LTTLCDDRSRHNKPHERTTVI	plas(14),E.R.(6),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4M2	V-type proton ATPase subunit H	Low	7.8	1	35-59	DEDLKKIKSIDKVRKEQRKQTIESD	mito(12),nucl(9),cyto_nucl(7.5),cyto(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S640	Uncharacterized protein (Fragment)	Low	8.4	1	33-55	IDEFSKSKVKYKQICIRDKLPNY	nucl(11.5),cyto_nucl(9.5),cyto(6.5),mito(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6D0	Uncharacterized protein	Low	6.6	1	544-569	RPSNYNKDPRMQRQSQRDTRVRKPVI	mito(21),nucl(4.5),cyto_nucl(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9V4	AMP-binding domain-containing protein	Low	5.8	1	714-733	TPTLKLKRPQTAKAFRQHID	cyto(18),cyto_nucl(11.5),pero(5),nucl(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA57	Autophagy-related protein 9	Low	5	1	779-804	GPTTSRQPNFQNKPPRHRPGARDDSF	plas(17),mito(4),vacu(3),golg(2),cyto_mito(2),mito_nucl(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCI2	PI3K/PI4K domain-containing protein	Low	7.3	1	149-170	SRSVRPVSPRPRDPKDLRKQMV	cyto_nucl(8),nucl(7.5),cyto(7.5),extr(4),mito(3),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGC6	Uncharacterized protein	Low	9.5	2	257-276, 338-359	ISAQRRPRRRFYKMGRRSSA, DLGALRRVRKQKERNELRNGTY	nucl(11.5),mito_nucl(10.666),cyto_nucl(9.833),mito(8.5),cyto(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGF7	Uncharacterized protein	Low	9.4	1	52-71	LMAMKKKKKKSPMAVCEEKK	mito(18.5),cyto_mito(11.5),nucl(5)	KKKKKK (56-61, prob:0.799)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJI9	Uncharacterized protein	Low	8	1	302-329	AGTITRDPRKVERKKPGHVKARKMPTWV	mito(19.5),cyto_mito(13),cyto(5.5)	RRAGTITRDPRKVERKKPGHVKARKMPTWVKR (300-331, prob:0.982)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJM7	DDE-1 domain-containing protein	Low	5	1	12-31	ASEGYGKKKRIQPGNREWVT	mito(17.5),cyto_mito(12.833),cyto(7),cyto_nucl(5.333)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPA9	Uncharacterized protein	Low	5	1	498-519	ALALHLRSRRKRAKLTPTTITT	extr(19),plas(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW47	Calpain catalytic domain-containing protein	Low	8.7	1	69-93	ADRIKKSEQWKPPHAPPPNSRNERI	nucl(13.5),cyto_nucl(9.5),mito(5),cyto(4.5),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZF5	p-aminobenzoic acid synthase	Low	9.7	1	852-880	STNRAFAPLPPPKPKKKGRRVEIIEPDDP	cyto(11),cyto_nucl(9.5),nucl(6),mito(5),plas(3)	PPPKPKKKGRR (861-871, prob:0.91)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZG4	E3 ubiquitin-protein ligase	Low	5.9	1	8-27	QELCRQLRELPRRHNYRFDS	plas(18),mito(3),cyto_nucl(3),nucl(2.5),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2E4	Malate synthase	Low	5	1	39-58	RTFNERRKALLQRRVIRQAE	pero(15),cyto(5.5),cyto_mito(5),mito(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFK3	Uncharacterized protein	Low	8	1	23-47	IDLFQDCLPNRKKRRWHFNTFMLDT	nucl(8),cysk(8),cyto(5),mito(3),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ09	Uncharacterized protein	Low	7.1	1	43-62	HFFGYEKKPARQQERPLSRG	plas(12),nucl(6.5),cyto_nucl(6.5),cyto(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJS2	Carboxypeptidase	Low	5	1	32-54	RPRLTRPLPSVQQHKRQSKQIIT	extr(21),mito(1),cyto(1),pero(1),E.R.(1),golg(1),vacu(1),cyto_mito(1),cyto_pero(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLD5	Uncharacterized protein	Low	5	1	446-467	LVPRKPGHGTQRKKQPYPVWRL	cyto(13),cyto_nucl(8),mito(4),pero(3),plas(2),E.R.(2),cysk(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSA6	C2H2-type domain-containing protein	Low	8.7	1	2-22	SFDTEKTMKNHKKNSDEHEYC	nucl(13.5),cyto_nucl(11.5),cyto(8.5),pero(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUE7	Aminotran_1_2 domain-containing protein	Low	5.7	1	68-87	DCNQYSPTKGRPRLKKAIAD	mito(14),cyto(9),nucl(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYI0	Uncharacterized protein	Low	9.8	1	1-26	MPPKGKSFLRPKPKGKAKTQEPQTEN	mito(9),cyto_nucl(8),nucl(6),cyto(6),pero(5)	GKSFLRPKPKGKA (5-17, prob:0.792)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1C2	Intu_longin_1 domain-containing protein (Fragment)	Low	9.9	1	327-355	AYGVRDNPTSDRRKRRRRDVKSIPQPEAG	mito(11.5),cyto_mito(10),cyto(7.5),nucl(7)	RRKRRRR (338-344, prob:0.83)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6Y7	Uncharacterized protein	Low	8.2	1	111-134	EKVTSVDGKKKKKNSVLSKNLHTW	nucl(12),cyto_nucl(12),cyto(10),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REL7	Uncharacterized protein	Low	7	2	33-54, 307-328	LFLVIRCCIRQKQKKFWYDDGV, NASAISRENKRRSKRNTTYMVE	plas(21),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFQ4	Zn(2)-C6 fungal-type domain-containing protein	Low	6.8	1	11-42	RVSRSCIECGRRKIRCDKKSPCQPCIRRNAAH	plas(13),nucl(5.5),mito(5),cyto_nucl(4.5),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR66	Uncharacterized protein	Low	9	1	180-200	SKANMLSRVRQRTKRISTIFR	nucl(15.5),cyto_nucl(11.5),cyto(6.5),mito(5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWP6	Uncharacterized protein	Low	9.2	1	115-137	LLTRGTRPHRRWFKKKGKLLTPY	cysk(9),cyto(6),mito(4),nucl(3),cyto_pero(3)	RPHRRWFKKKGK (121-132, prob:0.794)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZX7	Uncharacterized protein	Low	5	1	33-62	LVPTLARRSKRTFTSRKRRSQDEQTCPQSS	mito(22.5),cyto_mito(13.5),cyto(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S242	Uncharacterized protein	Low	5	1	465-487	VQRQVLIRLNKKKQEKWEQMTSE	plas(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9U4	Glyco_hydro_85 domain-containing protein	Low	9.4	1	1001-1025	KKKVEATAKKEKPTQKNTLNNYFGK	cyto(10),cyto_mito(9.333),cyto_nucl(8.333),mito(7.5),nucl(5.5)	KRKAEKGSSPSKPKKSK (590-606, prob:0.855)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD23	Metallophos domain-containing protein	Low	8.6	1	63-85	ITRTSDRIPRRIKRHSLKYLVIF	nucl(12.5),cyto_nucl(9.5),pero(7),cyto(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE12	Uncharacterized protein	Low	8	1	268-294	GLCCCCASRRDVRKGKKRGSEKAYHMD	plas(18),E.R.(5),mito(2),vacu(2)	RKGKKRG (280-286, prob:0.78)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH44	Photolyase/cryptochrome alpha/beta domain-containing protein	Low	9.5	1	606-627	MSPKQAKKTAVKSEKKVAHKRE	cyto(10.5),cyto_mito(10),mito(8.5),nucl(5)	KSEKKV (617-622, prob:0.641)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPW7	Uncharacterized protein	Low	5	1	1-23	MSSKQKTQKKPMAAKEAQKQTPR	plas(8),mito(6),cyto(5),pero(3),E.R.(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSU0	APH domain-containing protein	Low	5.8	1	45-66	LTDKDGKKYVLRKKPPGQLLSK	pero(12.5),cyto_pero(11.333),cyto(9),cyto_nucl(6.833),nucl(3.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU17	Uncharacterized protein	Low	8	1	196-218	VLALRRRATRKKELERERDRLRP	plas(21),mito(3),E.R.(2)	RRRATRKKELERERDRL (200-216, prob:0.792)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU73	B3_4 domain-containing protein	Low	9.9	1	1-20	MSRSGKKPTKPLAQNPQKTM	nucl(18.5),mito_nucl(13),mito(6.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWJ7	CBFD_NFYB_HMF domain-containing protein	Low	7.7	1	96-115	QDYKKQQQARPRPHKYPPPP	cyto_nucl(13.5),cyto(13),nucl(10)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWW2	Uncharacterized protein	Low	9.2	1	36-69	ATCAVWKRFPAPKKVKGRAKGRPAKAEENKENKG	mito(20.5),mito_nucl(13),nucl(4.5)	KRFPAPKKVKGRAKGRPAKAE (42-62, prob:0.978)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6V2	Uncharacterized protein	Low	8.2	1	4-26	AAPPARIPRFYRQRQNIPLNEQD	mito(11),nucl(9.5),cyto_nucl(6),pero(2),cyto(1.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAY0	Queuine tRNA-ribosyltransferase accessory subunit 2	Low	8.9	1	418-443	YQFKSESHAKKEKKNPKAFQKFSEEE	cyto(15),cyto_nucl(10),nucl(3),mito(3),E.R.(3)	KKEKKNP (427-433, prob:0.704)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVC5	Uncharacterized protein	Low	9.2	1	347-374	KELDVVKKRVQARKEKEKKAYKNAFNFD	cyto(19),nucl(3),mito(2),vacu(2)	KRVQARKEKEKK (354-365, prob:0.758)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S837	Uncharacterized protein (Fragment)	Low	7.1	1	24-43	QSSRHYKRPLPQTPNPCQKV	cyto(12.5),cyto_nucl(10.5),nucl(7.5),mito(3),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Y4	Uncharacterized protein	Low	9.2	1	471-506	EELSYFNTASKKKKKKKKKKKKKKTKRLVFLANVSW	mito(14),cyto(9),cyto_nucl(7.5),nucl(4)	KKKKKKKKKKKKKKTKR (481-497, prob:1)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHU4	Uncharacterized protein	Low	7.5	1	29-48	RFRPEKVPEGLKKPCRPRDA	pero(10),nucl(8),cyto_nucl(8),cyto(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIG9	Uncharacterized protein	Low	5	1	85-105	SDISRRLSRVQSRQSRKQGVS	plas(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIP2	Aa_trans domain-containing protein	Low	8	1	18-38	TSSTGSLRGRRKGRGKQDAGF	plas(26)	RRKGR (27-31, prob:0.677)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKN5	Uncharacterized protein (Fragment)	Low	8.4	1	1-28	STRPQYNDNTQRRNNKKCYVCNKPGCWS	nucl(11),mito(7),cyto(7),cyto_mito(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL80	Uncharacterized protein	Low	9.1	1	512-534	VERTLPARYRRRSRGFYDRRAVG	nucl(16),cyto_nucl(12.5),cyto(7),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLW2	Uncharacterized protein	Low	8.2	1	598-622	NHYFTTAIQKKRQRKHQAITKTAAQ	cyto_nucl(13),nucl(12),cyto(12)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT37	Uncharacterized protein	Low	5	1	320-339	NEQKTRPKFRLPFSKPQKSP	plas(22),mito(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU98	LCCL domain-containing protein	Low	8	1	62-82	GEWAKGPKPRHKKYAIHAWLE	plas(27)	GRKAGEWAKGPKPRHKK (58-74, prob:0.878)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUX6	Uncharacterized protein	Low	6.9	1	10-33	DQMKKALKGLFRKKSKNQPTATET	mito(11),cyto(9),cyto_nucl(9),nucl(7)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV29	Uncharacterized protein	Low	5	1	143-168	MAKLKFTQKQTKNQEKRQAKRSRQVA	mito(16),cyto(6),pero(2),vacu(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXJ5	TRP_N domain-containing protein	Low	7	2	20-47, 1014-1036	EIPPVQPTQTPPRSRRKPWTLPAVNPSS, PDAPSRAPSLPRKNSRRTNSTEV	plas(22),E.R.(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2P9	Mitochondrial Rho GTPase	Low	8	1	398-424	TTSALKVTKARKRRRKPGRVERNVFLC	cyto(9.5),mito(7),cyto_nucl(5.5),E.R.(4),plas(3)	TKARKRRRKPGR (405-416, prob:0.97)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4E6	MYND-type zinc finger protein samB	Low	6.5	1	37-56	RDCQKADWKTHKKICAQQAN	mito(14.5),cyto_mito(9.5),nucl(5),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5R0	Mechanosensitive ion channel protein	Low	5	1	879-901	ASSTQRERTHRNRFFSRNRYGND	plas(24),mito(1),cyto(1),vacu(1),cyto_mito(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5Y1	MICOS complex subunit MIC60	Low	9.6	1	132-159	SVAPDPIKPLPKKKRRRFRRFLLWLTIL	mito(21),nucl(4)	KPLPKKKRRRFRR (139-151, prob:0.958)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE38	Asparagine synthase (glutamine-hydrolyzing)	Low	5	1	77-97	IYNHRILRKSLKKPYNFKTHS	pero(9),cyto(8.5),mito(7),cyto_nucl(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE58	Uncharacterized protein	Low	9.8	1	3-23	GMLTRSKSLRFLKNNRNDQDN	nucl(17),cyto_nucl(10.5),mito(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGS2	Uncharacterized protein	Low	8	1	168-191	GLALFFVHRHRRNKKKALEQPPAV	extr(27)	RRNKK (178-182, prob:0.649)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLP3	Cation_ATPase_N domain-containing protein	Low	5	1	25-44	QEPHTAPKQRQPQPNPTDGD	plas(25)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMY4	Dimer_Tnp_hAT domain-containing protein (Fragment)	Low	7.5	1	55-78	HSAATAPLRRRKNREQLPAAQPRL	nucl(10),cyto_nucl(8.833),cyto_mito(6.166),mito(5.5),cyto(5.5),extr(2),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV21	Fungal_trans domain-containing protein	Low	5.5	1	145-164	PESAARKKEREQRERVQSKA	extr(10),cyto(6.5),cyto_nucl(4.5),mito(3),plas(2),pero(2),nucl(1.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWL8	MFS domain-containing protein	Low	5	1	556-575	SVDKRKYTSKTVAIQRRDRK	plas(27)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5A5	Uncharacterized protein	Low	9	1	391-410	LEESKAKRRKLAREGYEKES	nucl(16),cyto_nucl(14),cyto(10)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5C7	Uncharacterized protein	Low	7.3	1	278-297	GGIRKKKTPPTQPQQQQQST	cyto(13.5),cyto_nucl(12.5),nucl(8.5),cysk(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6B1	Uncharacterized protein	Low	8	1	838-861	SATDKLHKWSKGKKGRHWNDALPS	plas(24),E.R.(2)	RRRGSATDKLHKWSKGKKGR (834-853, prob:0.849)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHJ3	Uncharacterized protein	Low	8	1	423-442	ASTTPRKRGRPSKKAAANGA	plas(21),extr(2),E.R.(2)	RKRGRPSKKA (428-437, prob:0.801)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN59	WD_REPEATS_REGION domain-containing protein	Low	5.7	1	245-264	EETRKYTSTLRRNARNERVL	mito(15.5),cyto_mito(10.833),cyto(5),cyto_nucl(4.333),nucl(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSJ5	DNA_MISMATCH_REPAIR_2 domain-containing protein	Low	8.3	1	1-21	MPRKLPFKQPYRHRGSRSSAA	nucl(12),mito(12),mito_nucl(12)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUU1	Uncharacterized protein	Low	8.8	1	59-78	QPENEKKRPKFFHRLTSPFQ	nucl(12),plas(12),cyto_nucl(8)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWI8	Uncharacterized protein	Low	7.4	1	198-217	APPPKPPKPHEQSRHTPQPP	cyto_nucl(11),cyto(10.5),nucl(8.5),mito(4),pero(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX40	Peptidase A1 domain-containing protein	Low	6.2	1	57-82	GRMRTQYVLRKHKHHHHHHHASPPGN	mito(15.5),cyto_mito(9.5),nucl(4),extr(3),cyto(2.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1R8	Amidase domain-containing protein	Low	5.8	1	3-27	LLEYRQHKADCKRKQSERASKIATL	mito(13),cyto(7),pero(4),nucl(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REE8	TRP_N domain-containing protein	Low	8	1	595-621	NAIIICCKENPHRKKRKEAEKARDLDN	plas(19),E.R.(3),extr(2),golg(2)	HRKKRKEA (606-613, prob:0.798)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWK3	RRM domain-containing protein	Low	9.1	1	230-259	EVKAVTKRDDKHKQGKNKNSKNNKEKTTAT	mito(16),cyto(6.5),cyto_nucl(5.5),nucl(3.5)	KHKQGKNKN (240-248, prob:0.664)
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX36	Uncharacterized protein	Low	7	1	313-334	RQYQELKRLEEQKKKEQKCCVQ	cyto(9.5),cyto_nucl(8.5),nucl(6.5),mito(4),pero(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3Z3	RING-type domain-containing protein	Low	8.4	1	124-145	VGRVRCPMCRKGVKQRVRIHTG	nucl(11.5),cyto_nucl(9),mito(8),cyto(5.5)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4Z7	Adaptin_N domain-containing protein	Low	9.2	1	244-267	MMVYARKCFPRRTKKVKRAAGANT	nucl(16),cyto_nucl(12),cyto(6),mito(4)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5D8	Uncharacterized protein	Low	5	1	182-204	VATAGSKKSKSRKQQKTMTTTVS	plas(19),E.R.(6)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK55	Serine/threonine-protein kinase Tel1	Low	7.4	1	61-82	DEHANFLRNRHKPKPAPHLPLA	cyto_nucl(9),nucl(8.5),cyto(8.5),mito(6),plas(1),pero(1),E.R.(1),golg(1)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMK4	Uncharacterized protein	Low	6.2	1	362-381	VRFCEVKQRKSGRCRLCSVR	cysk(22),nucl(3)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS23	Uncharacterized protein	Low	5	1	218-237	SSGMRRSRSTKSNRNRGSFL	plas(17),mito(4),E.R.(3),extr(2),cyto_mito(2),mito_nucl(2)	
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXY6	Uncharacterized protein	Low	5	1	731-750	SEQQHPKQKKSSKVSSRYGH	plas(20),E.R.(4),vacu(3)