ProteomeAccession ScentificName ProteinAccession ProteinName Category ConfidenceScore #NoLS Positions SegmentSeqs PSORT NLS UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W585 AA_permease domain-containing protein Low 5 1 540-562 LIYKFIWKRGKDKLKNPKIISFE plas(24),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAW4 Uncharacterized protein Low 7.4 1 1253-1273 ESDYVHKCVKQQIKEKKQLSL mito(16),nucl(7.5),cyto_nucl(5.5),cyto(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCT6 Nudix hydrolase domain-containing protein Low 9.7 1 872-892 LSILKKSSPPQQQQQQQKQTD nucl(17.5),cyto_nucl(12),cyto(5.5),mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFL9 Uncharacterized protein Low 8.4 1 22-42 ESTIRHTKKHTLEKRWNYFDV nucl(14),cyto_nucl(10.833),cyto(5.5),cyto_pero(4.666),pero(2.5),mito(2),vacu(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFT7 Uncharacterized protein Low 9.9 1 12-32 LSGGKRTSIPKAKKAFRLAKS mito(18.5),mito_nucl(13.5),nucl(7.5) KAKK (22-25, prob:0.633) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGU2 Uncharacterized protein Low 8.8 1 1-27 MGRKDKQRKRLRDFAKLKEKQRQLHLD plas(24),nucl(2) KDKQRKRLRDFAK (4-16, prob:0.751) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4J4 Uncharacterized protein Low 8 1 282-308 HSVPKALPPKLEKKTKKKGKKSKKSKK plas(21),E.R.(3),mito(2) ALPPKLEKKTKKKGKKSKKSKK (287-308, prob:0.999) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6K4 Transket_pyr domain-containing protein Low 6.1 1 829-850 ANLFHIIRRQQHRQFRKPLALF mito(20.5),cyto_mito(11.833),nucl(4.5),cyto_nucl(3.833) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8N6 Septin-type G domain-containing protein Low 9.1 1 7-28 INTDEIRRRRNAKKAIHLNVLL nucl(15.5),cyto_nucl(13),cyto(7.5),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8Z6 Uncharacterized protein Low 6.1 1 389-424 KEEKLQKLIKEQNKNSKIKIVHKTQFKRNDDYQKRN mito(11),plas(9),nucl(3),cyto(1),pero(1),golg(1),cysk(1),cyto_pero(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBE1 Uncharacterized protein Low 7.3 1 336-357 SMKSIRLGSRRNPKQAPRNTSD mito(14.5),mito_nucl(13.166),nucl(10.5),cyto_nucl(7.333) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WE12 Uncharacterized protein Low 9.8 1 412-437 KEIIRDRRCKHCGHKKDKNHYCSVGM nucl(18.5),cyto_nucl(12.5),mito(4),cyto(3.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WF28 Uncharacterized protein Low 6.1 1 142-167 IHQECVIKRKNEKKDKQSKDYDRLDG plas(16),E.R.(4),nucl(3),mito(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WH05 Eukaryotic translation initiation factor 2A Low 9.4 1 528-553 DKANGNNTNKTRRRRTKMNENGTTSD nucl(15.5),cyto_nucl(10),mito(6),cyto(3.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHH7 Ceramide very long chain fatty acid hydroxylase Low 6 1 331-357 LHHSKMPPPLRKLKKYHLEHHYKNYQL plas(12),cyto(5),nucl(3),cyto_pero(3),mito(2),E.R.(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7S4Q3 Arrestin_C domain-containing protein Low 8.1 1 629-649 PTYPPSKTKNSGKSIKRPANT nucl(12),cyto_nucl(11.5),cyto(9),mito(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3R6 Uncharacterized protein Low 8 1 1-25 MRAKWRKKRTRRLKRKRRKVRARSK AKWRKKRTRRLKRKRRKVRARSK (3-25, prob:1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAB0 DUF2439 domain-containing protein Low 9.3 1 2-23 PIYGPIKKKHKTWHDGKLKYFE nucl(14.5),cyto_nucl(9),mito(8),cyto(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WC59 Alpha-1,3-glucosyltransferase Low 5 1 9-32 KLLLQEKQDNNKNNHPKEKSRYSL plas(20),E.R.(4),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCY6 Phosphatidylserine decarboxylase proenzyme 1, mitochondrial Low 6.6 1 114-147 DEPDREQKQNQENNNNNKKRYKRIKIFNNNWLFF mito(10.5),cyto_mito(7),nucl(5),golg(3),cyto(2.5),pero(2),E.R.(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WD46 P/Homo B domain-containing protein Low 5 1 708-731 IYSMFFVKSRRRIRRSRAEAYEFD extr(23),golg(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEJ5 GPI ethanolamine phosphate transferase 3 Low 5.7 1 15-36 ADEKRIYKSRIQKFSKSHKLYV plas(18),nucl(2),pero(2),E.R.(2),mito(1),cyto(1),golg(1),cyto_mito(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WH67 Mitochondrial import inner membrane translocase TIM40 Low 9.6 1 127-152 AIYFVTNPSKKKKKKKEVKQQEAVDA mito(10),mito_nucl(8.833),cyto_mito(6.833),nucl(6.5),E.R.(3),golg(3),cyto(2.5) SKKKKKKKE (135-143, prob:0.952) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7SB57 Uncharacterized protein Low 7.9 1 62-85 NKNVSNKTKKSKIHSLTDKKEKST nucl(11),cyto_nucl(11),cyto(9),cysk(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4X5 Uncharacterized protein Low 9.5 1 24-56 REKEDISRKINKTKTKSQRKKTCGVSLKYPQVK nucl(17.5),cyto_nucl(14),cyto(7.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9N2 26S proteasome regulatory subunit RPN1 Low 8.1 1 21-41 IDESVKKTKKKDGKTEEEELS nucl(11.5),cyto_nucl(11.5),cyto(8.5),mito(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9Z4 UBC core domain-containing protein Low 8.5 1 5-25 RQLQEQKKKALENKNKAQPTT nucl(13),cyto_nucl(10),mito(5),cyto(5),plas(1),E.R.(1),golg(1),cysk(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCB6 DAO domain-containing protein Low 9.6 1 163-186 GNNNGEGRHRHRRHRHLKEGILEH golg(8),E.R.(7),nucl(4),pero(3),vacu(3) RHRR (172-175, prob:0.627) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCU6 Uncharacterized protein Low 7.2 1 159-178 RAPYCILKKRRNNRDGYKTL mito(9),nucl(6),cyto(5),pero(2),vacu(2),extr(1),E.R.(1),golg(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDN3 Rhomboid domain-containing protein Low 8 1 330-359 AYGWYIKTKLEKQREERRRRIVRSRGGGGF mito(13.5),cyto_mito(8),plas(6),golg(4),cyto(1.5) KQREERRRRIVRSR (341-354, prob:0.787) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W496 Uncharacterized protein Low 8.5 1 16-35 SQRILRNKETYRQRNRTFQI plas(13),nucl(9),mito(2),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W726 Uncharacterized protein Low 9 1 553-572 VSSVKPLKIKWKLNYMKSGC nucl(14.5),cyto_nucl(10),mito(7),cyto(4.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9V4 SMI1_KNR4 domain-containing protein Low 8.8 1 354-373 LEVLKKRTIKKYQQEQQREN nucl(16),cyto_nucl(13.833),cyto(7.5),cyto_pero(5.332) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAX0 Uncharacterized protein Low 8.9 2 373-399, 408-437 LNKKQDSKKTTIPKQEHKRNSPDEPKM, GRAAWKKYMIDKKRNDNKKNENPKDTTKEN pero(7),nucl(5),cyto(4),E.R.(4),golg(3),cyto_mito(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBL2 Uncharacterized protein Low 9.7 1 132-154 LGVFCSKRPAKKMKTIPKQKSNG cyto(11),cyto_nucl(10.833),cyto_mito(8.999),nucl(7.5),mito(5.5) RPAKKMKTIPK (139-149, prob:0.685) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WC77 Uncharacterized protein Low 8.9 1 362-387 RFDFKQRCSEFKKWKLQQSNLKKPDM nucl(20),mito_nucl(13.833),cyto_nucl(10.833),mito(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WD96 AA_permease domain-containing protein Low 5 1 1-22 MKNPLRNSFHKRNSSNNNNSTN plas(27) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDQ7 Uncharacterized protein Low 6.5 1 34-58 RNNAQFRKNLKTNLKKQQKETKLKE mito(5),cyto_nucl(5),pero(5),nucl(4.5),cyto(4.5),golg(3),extr(2),E.R.(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WF48 Uncharacterized protein Low 5.7 1 17-40 KPGTSGLRKKTRVFKDKPHYTENF cyto(21.5),cyto_nucl(12.5),nucl(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WH36 C2H2-type domain-containing protein Low 9.6 1 22-41 QRYHMKTEWHRYNLKRRVAQ nucl(22),cyto_nucl(13.833),mito_nucl(11.833) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHL0 Uncharacterized protein Low 6.5 1 1-21 MSSSTSIQPKKRKINFSNIIL mito(20),nucl(4),cyto(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHP2 Uncharacterized protein Low 9.4 1 257-278 RKEYLRKEKELKAKNKNILERP nucl(17),cyto_nucl(12.5),cyto(6),mito(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3V6 Importin N-terminal domain-containing protein Low 8 1 841-861 QSTKNNARWAREQQKRQLSFR cyto_nucl(14.333),nucl(13.5),cyto(10),cyto_mito(6.665) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5E1 Eukaryotic translation initiation factor 3 subunit B Low 9.2 1 636-656 LLSNAEKKKVRKNLKEWSAQF nucl(16.5),cyto_nucl(13),cyto(6.5),mito(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5T7 CCHC-type domain-containing protein Low 6.8 1 86-110 FVRTSHPKRSFNKRGRNFNANKKGD mito(12),cyto(8),cyto_nucl(8),nucl(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8H2 Uncharacterized protein Low 9.7 1 290-314 FHYHCIKSWIKKKEHQLKESPQPNG nucl(20),cyto_nucl(15.5),cyto(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9Q4 Uncharacterized protein Low 5 1 293-313 NLSRVYTKKRGVRPKFDDPLV cyto(22),cyto_nucl(12.833),mito_nucl(2.666) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WD99 Uncharacterized protein Low 8.6 1 481-505 AKVQDSRVSKKPSFKKRNSFIKLSL nucl(13.5),mito_nucl(13),mito(11.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDN4 Uncharacterized protein Low 9.7 1 776-797 DADSAKKEQKKKKYESILANVA nucl(14),cyto(8),mito(4),cyto_pero(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7REP1 Tr-type G domain-containing protein Low 6.5 1 45-68 YAKGYPKNKLSRYMKNNKPKELDF mito(10.5),cyto_mito(9.833),cyto(8),cyto_nucl(7.833),nucl(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W648 Uncharacterized protein Low 9 1 30-53 SSSINSLKKYSKKYLNRNQPTEIV mito(11),nucl(10),cyto(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W826 RING-type E3 ubiquitin transferase Low 8.3 1 405-431 TPSSNHYLNIKKKKKPKKLPCGHFLHF plas(11),E.R.(8),mito(4),nucl(1),cyto(1),cyto_nucl(1),pero(1),golg(1),cyto_pero(1) KKKKKPKK (415-422, prob:0.916) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8R5 Gluconokinase Low 9.4 1 95-114 SCSSLKKKYRDRIRNVWPNG nucl(11),cyto(8),mito(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAF0 Uncharacterized protein Low 8.3 1 121-147 DWDTVTSYNKKKNRKNNKYVCLNPLLK nucl(16),mito_nucl(12.999),cyto_nucl(10.833),mito(8.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAQ5 Uncharacterized protein (Fragment) Low 5.9 1 114-134 VIPLYCKHKRTKYFYYKEESS cyto(10),cyto_mito(7.833),cyto_nucl(7.333),E.R.(6),mito(4.5),nucl(3.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAS5 Uncharacterized protein Low 8.5 1 29-53 VADELKKQRFIPKKKSTAKNVAIGS nucl(11),mito(4.5),cyto_mito(4.5),cyto(3.5),E.R.(2),pero(2),plas(1),golg(1),cysk(1),vacu(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBC1 Uncharacterized protein Low 9.3 1 1-23 MSTFIKTHKRKNSHKFLGPQATS nucl(12),mito(4.5),cyto_mito(3.5),plas(3),golg(3),E.R.(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W324 Endo/exonuclease/phosphatase domain-containing protein Low 5 1 39-59 NTWGLKYVSKHRKERLKAIAD plas(22),pero(2),mito(1),golg(1),vacu(1),cyto_pero(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3G4 DNA ligase Low 6.5 1 594-613 HYEPSKRSRNWLKLKKDYLE mito(16),mito_nucl(12.666),cyto_mito(10.166),nucl(8),cyto_nucl(6.166) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7C2 Uncharacterized protein Low 6.4 1 54-76 TKLVNYCKKSPKFRKLSPTDRFI plas(7),golg(6),nucl(4),mito(3),E.R.(3),extr(2),cyto_nucl(2),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8L6 Uncharacterized protein Low 7 2 70-90, 683-710 SDSRGPRYSKHYNNNNDRGSS, NNNNRRGNYGHSNNRRNNYNSNRRRTYD mito(17.5),mito_nucl(10),cyto(4),vacu(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W978 Putative transferase CAF17, mitochondrial Low 9.7 1 454-474 TSNAHIAKKLRKKRPVGSLIA mito(17.5),mito_nucl(13.166),nucl(7.5),cyto_nucl(5.833) KKLRKKR (461-467, prob:0.75) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9I1 Enhancer of mRNA-decapping protein 3 Low 8.6 1 320-340 DKSKNKNDKNFKNDKNNDKNP nucl(14),cyto_nucl(11.5),cyto(7),pero(2),mito(1),E.R.(1),golg(1),cysk(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAG3 Uncharacterized protein Low 8.5 1 38-59 NTTANDRKDNKKSQVTDKNDKT nucl(9),mito(4),E.R.(4),pero(3),golg(3),cyto_mito(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDL3 Uncharacterized protein Low 9.6 1 206-233 VEKNKKELEKYSKHKQQKGIKGFFNRLF nucl(19.5),cyto_nucl(15),cyto(7.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFA4 Uncharacterized protein Low 7.1 1 2-22 GLLTIIKKQKQKDKEVKCLLL cyto_nucl(10),cyto(9.5),nucl(7.5),mito(6),pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFJ5 Uncharacterized protein Low 5 1 243-269 GSSVFGKKKMFKKTKKQQGYQNNDATM plas(11),extr(9),E.R.(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFK4 Uncharacterized protein Low 9.2 1 1012-1031 LSNCFRSKNKIPKYLPNCVL plas(18),nucl(3),cyto(2),golg(2) RKIKGKGAHFKR (120-131, prob:0.719) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFR8 Inheritance of peroxisomes protein 1 Low 9.6 1 46-65 RETFKFKSSRKSTSSKKDPI nucl(22.5),cyto_nucl(14.333),mito_nucl(12.166) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7REC2 Uncharacterized protein Low 6.6 1 258-278 NKNNNNPKRLHNKRLSHKFSI cyto(15),cyto_nucl(11.5),nucl(6),mito(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7SBV2 Aspartate carbamoyltransferase Low 5 1 3-29 IVTTCLCYRNLKKQTNFKKNIQDFKMS mito(18),cyto(6),pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3A1 Histidine--tRNA ligase Low 6.6 1 102-127 QQPQHPKHGSSKKKSKLQVSLKTPKG cyto(7.5),cyto_nucl(7),E.R.(6),nucl(5.5),extr(4),mito(2),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W642 Histone acetyltransferase type B catalytic subunit Low 8.9 1 373-392 DYERITCSSKFKKRHAEEIE nucl(15),cyto_nucl(13.5),cyto(10) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6V0 Uncharacterized protein Low 6.2 1 88-113 SLLARKRQLRVETRKKIKQNNFLSQI mito(23),nucl(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W720 Uncharacterized protein Low 8.5 1 87-113 NDELKHNKLSKFNKKFKLNRLKDHILN nucl(13.5),cyto_nucl(12.5),cyto(8.5),mito(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8K3 Uncharacterized protein Low 5 1 33-63 GFFPPNKKNPLVRKFSRRSRPTDQRSFRSLG plas(22),mito(2),E.R.(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAU1 Uncharacterized protein Low 6.5 1 128-147 QEAIRQQRNKRRKQMASIIF mito(17),nucl(4),pero(3),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAW1 Uncharacterized protein Low 8.1 1 58-78 ITCPIYRRVKVFKRNFFKNVP nucl(10.5),cyto_nucl(9),cyto(6.5),E.R.(4),mito(2),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBF2 Protein kinase domain-containing protein Low 7.5 1 609-629 ALIKGLKNKTNKKHLLTKSCC plas(12),nucl(7.5),mito(6),cyto_nucl(4.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBH6 Uncharacterized protein Low 6.5 1 35-55 MENLRERKSKPKDYILKKDDY plas(18),nucl(4),E.R.(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBR8 Uncharacterized protein Low 9.9 1 423-446 NNNNNTKSNKKTKTSKSKQSSASI nucl(21),cyto_nucl(15.5),cyto(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCQ3 Uncharacterized protein Low 9.1 1 188-212 HNRSWKNTMDKYRKNNKRQFRDFHE nucl(17),cyto_nucl(12.833),cyto(6.5),cyto_mito(5.166) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WE15 Uncharacterized protein Low 8 1 515-546 VGGMTRKDVKKRKRQGRKRKRDKIFHRRTLSN plas(14),E.R.(5),mito(2),pero(2),golg(2),vacu(2) RKDVKKRKRQGRKRKRDKIFHR (520-541, prob:0.997) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEV7 Uncharacterized protein Low 5 1 119-138 QVMVLRKQKRYNVKKTLAKA mito(12),cyto(9.5),cyto_nucl(6),pero(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHX9 Uncharacterized protein Low 9.6 2 200-224, 377-401 ILDAQFWRRKKKQPKDDQDDKGKNE, TTTTDTKYKFKCKKVRKTVTDTLTK nucl(8.5),cyto_nucl(7.5),E.R.(6),cyto(5.5),vacu(3),mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WI48 Uncharacterized protein Low 7.1 1 208-229 DLPEFKKPKQYRLRNFNFKRSI nucl(6),pero(5),mito(4.5),cyto_mito(3.5),plas(3),E.R.(3),golg(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7S4K3 Uncharacterized protein Low 8 1 1003-1040 NKIAGGKKKKKLSSAELRKKKKERMKKKKELGDAYVSS cyto(23.5),cyto_nucl(13) KIAGGKKKKKLSSAELRKKKKERMKKKK (1004-1031, prob:0.999) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W692 Protein phosphatase PP2A regulatory subunit B Low 8.8 1 422-446 GATIPRTSLRNKRNNNNNNNDNNNN nucl(15),cyto_nucl(12.5),cyto(8),mito(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6A6 Ras-GAP domain-containing protein Low 7.1 1 111-135 ESHNTEKSKKSKDEHYEKKKNLFSG plas(12),nucl(6),E.R.(5),cyto(3),mito_nucl(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8I5 Uncharacterized protein Low 8.5 1 58-78 GPPSLKRKFSRLKYKSPEFID nucl(17),mito_nucl(13.333),cyto_nucl(9.833),mito(8.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WB94 Uncharacterized protein Low 7.8 2 16-40, 106-125 LWKIPWRLSSHQKYRQRNRLKHVDE, KKVKGYRKGIHKVPKWTKIS mito(22.5),mito_nucl(13.333),nucl(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCD5 AAA domain-containing protein Low 7.6 1 24-43 TGTKNKSTTMRRKQQDLSKE mito(14.5),mito_nucl(12.5),nucl(9.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WD17 Non-specific serine/threonine protein kinase Low 8.7 1 274-294 VDCIRRFFKKKLKYEPKSDST nucl(16.5),cyto_nucl(13.333),cyto(9),cyto_mito(5.833) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDB0 Arf-GAP domain-containing protein Low 9 1 22-41 SSSSKSPSIPNKAIRRNSNF nucl(12),cyto(8),mito(5),cyto_pero(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WF08 Mto2_bdg domain-containing protein Low 9.8 1 235-262 QIPKLRKSLTPWRNKDKQKRTDNYNNTA nucl(20),cyto_nucl(14.5),cyto(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WF34 AAA domain-containing protein Low 6 1 773-793 LNASETKRLRNQEKNGQNEKP mito(17),plas(4),nucl(3),cyto(3),cyto_nucl(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WH18 Elongation of fatty acids protein Low 9.6 1 298-331 FISFYINSYKKKKKTKKINSKKQKSTIDNSKSTS plas(12),E.R.(7),nucl(4),mito(2) KKKKKTKKINSKKQK (307-321, prob:0.965) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4C1 Uncharacterized protein Low 9.9 1 294-318 DTPQSTFDKWKQKIKRNIDKFNEAL nucl(18.5),cyto_nucl(13),cyto(4.5),mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4Y0 Uncharacterized protein Low 8.8 1 49-75 SSSANRRQFNRNKRKLDDNNRGQQRFD nucl(14.5),cyto_nucl(11),cyto(6.5),mito(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4Y2 Uncharacterized protein Low 8.8 1 34-60 EDNDTSQKPKTNRRKRKIHLSKFDELP mito(11),plas(10),E.R.(3),nucl(2) KTNRRKRK (43-50, prob:0.771) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5T0 Thioredoxin domain-containing protein Low 6.1 1 661-686 KSKSLVHIYRSKRKYQAKRDTRGLLG E.R.(10),golg(6),pero(4),nucl(3),mito(1),cyto(1),plas(1),vacu(1),cyto_mito(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7E5 Uncharacterized protein Low 8 1 364-386 IGKVSEMKKFRKMKNHRYDELPS cyto(7),mito(5),E.R.(5),golg(5),extr(3) KKFRKM (371-376, prob:0.641) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WA41 Mitochondrial genome maintenance protein MGM101 Low 8.9 1 267-294 DKFVEHVVTKKKKKIWLRKDRQVEYPFK mito(20),mito_nucl(12.999),cyto_mito(11.499),nucl(4.5) KKKKKIWL (276-283, prob:0.737) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WB12 Diacylglycerol O-acyltransferase Low 8.8 1 19-38 DTNSTKNSIRRKNSITIKKP nucl(12.5),cyto_nucl(9),cyto(4.5),mito(4),pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBT1 Uncharacterized protein Low 6.6 1 747-766 KTWTKLKKVLEKKKNVKSQL E.R.(10),nucl(4.5),extr(4),pero(4),cyto_nucl(3.5),golg(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHJ6 Uncharacterized protein Low 5 1 38-57 QINTSPKQKQSKQPTFLPPA plas(23),mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WI12 Uncharacterized protein Low 5 1 254-275 IAARKIVKNLLHKNKTKKNDIL mito(25),mito_nucl(13.833),cyto_mito(13.333) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W352 Uncharacterized protein Low 5 1 122-141 APKQRRRTYRAHGRINKYES mito(22),cyto(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3U6 Formyl_trans_N domain-containing protein Low 8.1 1 350-370 EPAQVFMKKLNKRTNNSRLPI mito(18),nucl(8) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W488 Required for respiratory growth protein 8, mitochondrial Low 8.3 1 33-56 LTGFERWSGKRKKLYFRSNNEITS nucl(12),mito(11),cyto_nucl(9),cyto(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8H5 Uncharacterized protein Low 9.5 1 196-221 QLNSSKKCVRYKSCKRQKPLQMPISA nucl(15),cyto(9),mito_nucl(9) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W922 Uncharacterized protein Low 7.7 1 92-116 ESRATTKEIKSKHKKSNQTPSNTSQ mito(17),nucl(8.5),cyto_nucl(5.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WA17 Uncharacterized protein Low 7.2 1 13-36 EDVATAKKTRKASRPQKLRASLVP mito(13),nucl(6.5),cyto_nucl(6),cyto(4.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCW3 Uncharacterized protein Low 9.8 1 83-104 AFGWGNKTRRRVKKQEEILEKA nucl(17.5),cyto_nucl(12.5),cyto(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGA7 Reverse transcriptase domain-containing protein Low 8.9 1 356-383 KVPPQFQNALKKYRKKLQLSRCRRANSP nucl(15.5),cyto_nucl(13.5),cyto(10.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WH79 Uncharacterized protein Low 5 1 236-257 LIVWSFVRSRRRQNINNIYVNN mito(10),plas(9),E.R.(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WH82 SRR1 domain-containing protein Low 8.6 1 225-252 NDQFETFISKKNKRRNRNNNNKHIIYKE nucl(12.5),cyto_nucl(8.5),pero(6),cyto(3.5),extr(2),E.R.(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7RED1 Peptidase S59 domain-containing protein Low 8.3 1 1005-1024 KDPSHPSVKRHIANFRRKTD nucl(12.5),cyto_nucl(11.5),cyto(7.5),mito(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4X7 MFS domain-containing protein Low 5 1 561-588 GFNIKASKALAKKRKQQVAKMNHSKDTK plas(27) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7N4 Uncharacterized protein Low 9 1 677-696 ETTLRKTRNSRRIREILDRF nucl(15.5),cyto_nucl(11.5),mito(7),cyto(4.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7Q6 CCHC-type domain-containing protein Low 9.6 1 297-320 DLCRNCHEYGHYKKQCKKPNARPM nucl(18.5),cyto_nucl(13),cyto(4.5),mito(1),pero(1),golg(1),cysk(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAQ4 Uncharacterized protein Low 5 1 285-304 FDTPKSQRQREERQINQHID extr(8),E.R.(7),cyto(3),pero(3),golg(3),cyto_pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCU5 Phosphatase tensin-type domain-containing protein Low 7.8 1 10-42 FNQKSSYSGGKQKKPYKKMEPTFQKHRRDHASN nucl(12.5),cyto_nucl(11.333),cyto(9),cyto_mito(7.333),mito(4.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDY5 Uncharacterized protein Low 9.4 1 553-579 YIDPRITRGSHTKKPKRQSYNKSLVFV nucl(19),cyto_nucl(13.833),cyto(6.5),cyto_mito(4.166) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WF60 Protein kinase domain-containing protein Low 9.5 1 184-208 TQISRRNSLAMRKKKNNNIMSRTQS nucl(16.5),cyto_nucl(12.5),cyto(7.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFK1 DOD-type homing endonuclease domain-containing protein Low 9.5 1 409-428 AYCRSGHKRREAPKHVSREP nucl(16.5),cyto_nucl(12.5),cyto(7.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFN0 Uncharacterized protein Low 9.3 1 147-166 STLPSQKKPVKKPVPTTPPP nucl(17),cyto_nucl(12.5),cyto(6),mito(1),pero(1),cysk(1),vacu(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFR5 Biotin carboxylase Low 9.1 1 2114-2133 VEARRFFFWRLRRRLNEEYL nucl(14.5),cyto_nucl(10.5),cyto(5.5),pero(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFS9 Uncharacterized protein Low 7.2 1 88-110 NSISESKQKTRRRWLPNIVKKGL mito(21),nucl(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFW4 Glycine cleavage system P protein Low 8 1 247-268 FNLTKKKKFKFIVDKNVHKQTK nucl(14),cyto_nucl(10.833),mito_nucl(10.333),cyto(6.5),mito(5.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHS1 Uncharacterized protein Low 8.9 1 609-632 TTNNDKNKSSKNKNTKNNLKHSLI nucl(15),cyto_nucl(13.5),cyto(10) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W805 Septin-type G domain-containing protein Low 8.5 1 5-27 IEASSALRKRKHLKRGINFTVMV nucl(17),mito_nucl(12.999),cyto_nucl(10.833),mito(7.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8G2 CPSF_A domain-containing protein Low 9.9 1 197-217 ANLSKTSPNKRIKYNNNQFEG nucl(20.5),cyto_nucl(13.333),cyto(5),cyto_mito(3.333) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W971 Uncharacterized protein Low 9.1 1 182-213 AALAGKTKTNGKSKKNKKKNNGDKKKKKCVLL cyto(19.5),cyto_mito(11.833),nucl(4.5),mito_nucl(4.333) GKTKTNGKSKKNKKKNNGDKKKKK (186-209, prob:0.995) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WC80 Uncharacterized protein Low 9.2 1 69-93 LWKYQIYKGQRRRHSHKWKIQLGKV nucl(15),cyto_nucl(10.5),cyto(4),mito(3),pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCV8 Uncharacterized protein Low 8.5 1 44-71 LQEVGNRRNQRYWKRNRNNSNNRKSMKF nucl(9),golg(6),mito_nucl(6),E.R.(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDR5 Uncharacterized protein Low 7 2 98-118, 226-245 TTITTRPSNFLKKKNSSRLST, IRIWKPALYKKKRSVQKAAD plas(23),E.R.(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDW9 Regulator of rDNA transcription protein 5 Low 8 1 165-186 TKSLNGRHYRQNRRNQEKSKDT nucl(11),mito(10),cyto_nucl(9.5),cyto(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WF51 Acetolactate synthase Low 5 1 65-85 SQPSQKQPVKLSKKLRTEPEM mito(24.5),cyto_mito(14) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WI05 Glucosamine_iso domain-containing protein Low 9.9 1 83-107 SNSNNSSSKKNSRKKERRFKIALSG cyto(12.5),cyto_nucl(12.333),nucl(8),cyto_mito(7.332),extr(3) KKNSRKKERRF (91-101, prob:0.82) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6P2 Uncharacterized protein Low 9.5 1 172-197 KELSNKRKASSKSKPKRNSSFMSRFT extr(14),nucl(4),cyto(2),plas(2),golg(2),mito(1),pero(1),E.R.(1) NKRKASSKSKPKR (176-188, prob:0.823) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6Z8 Uncharacterized protein Low 9.1 1 413-438 VTVYVRVTKRHLRRKNRRKSVGLLPM plas(7),E.R.(6),golg(5),nucl(3),pero(2),vacu(2),mito_nucl(2) KRHLRRKNRRK (421-431, prob:0.868) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7I9 Uncharacterized protein Low 9.8 1 146-166 TLSPKRAYRNIDRFKRRKVEN nucl(17),cyto_nucl(11.5),mito(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8T4 Uncharacterized protein Low 5 1 118-138 NEKECTTTKNHQHRHKRDVAV extr(23),vacu(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W972 Uncharacterized protein Low 6.9 1 2574-2595 RHTGKFIKSKLRRKSTGGSNID pero(6),E.R.(6),nucl(5),cyto_pero(5),cyto(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9C5 GH16 domain-containing protein Low 5 1 428-453 TSSGNNFDKKCKKYRQIQANIERPGN plas(12),E.R.(6),mito(4),golg(2),mito_nucl(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBA6 Uncharacterized protein Low 8.4 1 107-132 LDLSKHYSKDHKRGKQQQQEHKSYQD mito(10.5),nucl(10),cyto_mito(6),E.R.(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBG1 Uncharacterized protein Low 7.3 1 36-59 TNTPYYLKSKRSKHQQNKVEVNSL mito(20),nucl(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBM5 Uncharacterized protein Low 5 1 294-315 IASRREQIKKRIRKYLRSNYHG plas(14),E.R.(8),mito(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFS8 60S ribosomal protein L36 Low 9.1 1 63-84 NSGEKRARKVAKKRLGSFKRAK mito(19),cyto(5),nucl(3) GEKRARKVAKKRLGSFKRAKAK (65-86, prob:0.98) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFZ9 Uncharacterized protein Low 7 1 56-83 GNSSYKKPYYNKGNNTNKRKNNSDRVFQ mito(20),nucl(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WH41 Uncharacterized protein Low 9.7 1 106-131 SYHFIFPKMPRKPRCLKNHRPSDTVF nucl(15),cyto(7.5),cyto_mito(6),mito(3.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7S4G6 G domain-containing protein Low 9.6 1 425-455 NNNNDNNGAKSKKKKKDKKVSSNNNNKLFIN mito(19.5),mito_nucl(13.5),nucl(6.5) KSKKKKKDKK (434-443, prob:0.947) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5D7 PX domain-containing protein Low 9.2 1 107-126 LPNFKKRSSKVRRRYSDFEF nucl(16.5),mito_nucl(13.5),mito(9.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6D6 Nuclear rim protein 1 Low 7.7 1 377-396 SGELIKEKYNKKKGRFEVLD nucl(9),plas(8),cyto_nucl(7),mito(6),cyto(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6T4 Establishment of cohesion protein 1 Low 8.2 1 1-24 MQTKVPVRKRSSLKAKYKQSVLRI mito_nucl(14),nucl(13),mito(13) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W738 Uncharacterized protein Low 5.7 1 135-155 LKNKSMVKRWWIKNEKFCYRL extr(8),mito(5),plas(4),E.R.(4),nucl(2),vacu(1),golg(1),pero(1),cyto(1),cyto_pero(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W791 Uncharacterized protein Low 5 1 142-164 SYCHWCKLFKRTGRKRHTLYWKV plas(18),E.R.(6),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7L6 Ribonuclease H Low 7.8 1 6-29 EQYTRTCPQCQRNKHSRVLRPGIF nucl(9),cyto_nucl(8.5),mito(6),cyto(6),pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8V6 GDT1 family protein Low 8 1 181-201 LREKLRRKRGMAKYLKKCKDL plas(13),E.R.(9),mito(4) GPSLREKLRRKRGMAK (178-193, prob:0.874) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8Y2 Ribonuclease P Low 8.3 1 8-27 KENKYGSKLIRKRPTIKTLS nucl(12),mito(11),cyto_nucl(9),cyto(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAW9 Cation-transporting ATPase Low 8.4 1 1484-1515 QLYIPTSLKKYFKKRKSGKKYKNILQEKSMSF plas(24),nucl(1),golg(1),vacu(1) KYFKKRKSGKK (1493-1503, prob:0.86) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WB99 She2p domain-containing protein Low 8.7 1 1-21 MTASKKQQTKRKVESLRVTDE nucl(13),cyto_nucl(10.5),mito(6),cyto(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBK9 Uncharacterized protein Low 8.8 1 128-147 NKKVTKPSSKGKTKKNHATS nucl(15),cyto_nucl(12),cyto(7),mito(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEM2 Uncharacterized protein Low 8 1 111-137 SDEVKRRFYKNWYKSKKKAFTKYSAKY mito(18),cyto(5),plas(2) KLPRKTHR (237-244, prob:0.66) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHQ1 Uncharacterized protein Low 8.9 2 17-47, 209-232 NIKLKLKRFYTCHKLRKRWDIHQIKRTQYRK, SEGQNDNKRLKKKQLRITFFKDNP mito(18.5),mito_nucl(13.5),nucl(7.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4C9 Hist_deacetyl domain-containing protein Low 8.4 1 415-437 DEYSNKKSLKKPFQAKEERIHDK nucl(11.5),cyto_nucl(9),mito(8),cyto(5.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W790 J domain-containing protein Low 8.7 1 68-98 ITKNLRKLSKKYHPDKNKKYKKLYQRLNLAT E.R.(7),plas(4),extr(4),golg(4),vacu(3),nucl(2),cyto(2),cyto_nucl(2) LRKLSKKYHPDKNKKYK (72-88, prob:0.75) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7U3 Protein phosphatase methylesterase 1 Low 8.8 1 32-57 GQLPSFPKKSISKEKQHTRNLKNDAL nucl(13),cyto_nucl(9.5),mito(8),cyto(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8T9 Uncharacterized protein Low 5 1 392-413 FLPIGWQKKRIVKRFKMTKGAL plas(15),mito(6),E.R.(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDD6 Uncharacterized protein Low 7.3 1 1-24 MQKPSIKYQGRKKPNQRLQFTLYM mito(18),nucl(7),cyto_nucl(5.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDM3 Uncharacterized protein Low 8.4 1 310-330 ISEDAKKEKKKEEKVLRELMF nucl(13.5),cyto_nucl(13.5),cyto(12.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WF16 Uncharacterized protein Low 8.7 1 113-138 LLEAKLKKKEQKKSNNNNNRINKKKA mito(11),golg(6),E.R.(3),nucl(2),pero(2),vacu(1),cyto_nucl(1),extr(1),plas(1),cyto_pero(1) AKLKKKEQKKSNNNNNRINKKK (116-137, prob:0.87) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3Q5 Uncharacterized protein Low 7.2 1 344-371 IAKAIQDTKKRQKIQTAKQKKSLSKMFS cyto(18),cyto_nucl(14.5),nucl(9) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W520 Uncharacterized protein Low 9.9 1 253-278 EEIAKYGCKHCNKRFKRPSSLNTHMN nucl(21),cyto_nucl(15.5),cyto(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5R3 Uncharacterized protein Low 9 1 414-436 KENFGERQRIQRQKNMASKRHRE nucl(10),cyto(9),mito(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7H1 Uncharacterized protein Low 8.2 1 66-87 DLTNWPQWTRRQQQKDNKLMFK mito(13),nucl(10.5),cyto_nucl(7),cyto(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WA96 AAA domain-containing protein Low 7.8 1 38-57 PLGRSKESRQRQETQWKRLC cyto_nucl(13),nucl(11),cyto(11),cysk(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHB6 Vacuolar membrane-associated protein IML1 Low 9.6 1 2-24 FSSLRAKNTKKHQLSPSLNRPIP nucl(17.5),mito_nucl(12),mito(5.5),cyto(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHT6 PPIase cyclophilin-type domain-containing protein Low 5 1 303-323 ACYFLVKKRKVSKVVSLRRDE E.R.(8),extr(7),golg(4),mito(2),pero(2),vacu(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7REJ0 Uncharacterized protein Low 5.8 1 132-160 EKTKRAFQVREVTKRRNRRVRHATTKGDL mito(22),cyto_nucl(3),nucl(2.5),cyto(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7SB66 Histone chaperone Low 7.1 1 247-268 GDSTNIKRRKIEKSEKDEDKEA cyto_nucl(10.5),cyto(9),nucl(8),E.R.(4),vacu(2),mito(1),extr(1),golg(1),cysk(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3I5 MFS domain-containing protein Low 5.4 1 16-38 MTTHLRHPCTQDKQPKNSTKELP plas(22),mito(2),nucl(1),pero(1),E.R.(1),cyto_mito(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5C5 Dolichyl-phosphate-mannose--protein mannosyltransferase Low 5 1 25-50 NNKSTNDDTIKRRNNNKGHPRDSDND plas(24),mito(1),pero(1),E.R.(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8C0 Geranylgeranyl transferase type-2 subunit alpha Low 8.7 1 1-33 MHGTKRKQWSKEALNRKRLNDVKKIKDYRKLVD nucl(16),mito_nucl(11.833),cyto_nucl(9.333),mito(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W957 Ribosomal_L16 domain-containing protein Low 6.7 1 1-30 MARRPARCYRYQKNKPYPKSRYNRAVPDSK nucl(9),mito(9),cyto(9),cyto_nucl(9),cyto_mito(9),mito_nucl(9) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAC3 Uncharacterized protein Low 9.5 1 151-172 IKETRKRQKKLFKKYNVPLWKN mito(15),nucl(4),plas(4),cyto(3) KRQKK (156-160, prob:0.635) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCY5 FAA_hydrolase domain-containing protein Low 9 1 26-51 RSDLKASIRDRPTRRKINKSFESSPS nucl(14.5),cyto_nucl(10.5),mito(6),cyto(5.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGU8 Uncharacterized protein Low 9.3 1 105-141 STLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH mito(19),mito_nucl(13.333),nucl(5.5),cyto_nucl(4.166) KRKRKYGFLSRMRDRQASKILKRRKLKGR (108-136, prob:0.961) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7RTM0 CCHC-type domain-containing protein Low 8.2 1 206-231 NECRNSHGRQPGRHRYNQKSFRKSGS nucl(11),cyto_nucl(10),cyto(7),mito(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3V5 Uncharacterized protein Low 7 2 7-30, 444-463 NAGSSAPNKKPQKNFLPQGKYLKP, IKCQRKYGDDWKKYCKHCPY plas(20),golg(3),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4M4 Uncharacterized protein Low 5 1 453-473 TSSTYYMSRNKTKNRNKYIDI extr(21),cyto(3),mito(1),E.R.(1),vacu(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W593 Uncharacterized protein Low 8.4 1 713-732 NDNKHNKQNRWTPKSPAFPM nucl(11.5),cyto_nucl(8),mito(4),cyto(3.5),E.R.(3),pero(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6B5 Uncharacterized protein Low 5 1 623-642 AKYSYPRRKQNSKCIARKLF E.R.(7),plas(5),extr(5),cyto(3),vacu(3),golg(2),cyto_mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6K9 Uncharacterized protein Low 7.2 1 3-26 EPESAYRKQKIKETKQQKNFIQSI cyto_nucl(9.333),nucl(9),cyto_mito(8.166),mito(7.5),cyto(7.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6M7 Uncharacterized protein Low 6.5 1 644-663 VSKEWYKKVQKLKSSSERTT plas(15),nucl(4),mito(4),mito_nucl(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6Q1 Uncharacterized protein Low 9 1 672-696 KETPMRLHIKRQPKKTNILNVKTTK nucl(14.5),cyto_nucl(12.5),cyto(9.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6Z4 AA_permease domain-containing protein Low 5 1 55-74 SKSVSRWTRIKDSFKRAEKE plas(27) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7Q1 Uncharacterized protein Low 9.7 1 129-151 HEKLLAKRKKYEESKRLERKSLP nucl(20),cyto_nucl(15.5),cyto(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WC19 Zn(2)-C6 fungal-type domain-containing protein Low 9.9 1 17-49 YSGCWTCRARKVKCDTQRPKCCRCKQLGIECGG nucl(19.5),mito_nucl(13.5),mito(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WD83 Uncharacterized protein Low 5 1 45-68 TTSEEPKMSNRKFRRIPKPGIGIW plas(23),pero(1),E.R.(1),golg(1),vacu(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WF46 WD_REPEATS_REGION domain-containing protein Low 7.8 1 813-835 TDISNKIRRRVLKKLQEDKLQQS cyto_nucl(13.833),nucl(13),cyto(12.5),cyto_mito(7.666) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFI3 Uncharacterized protein Low 8 1 186-209 RAKPIETESKKQQKKNKKLAKKNK mito(16),pero(3),plas(2),E.R.(2),golg(2) SKKQQKKNKKLAKKNK (194-209, prob:0.979) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHF0 Uncharacterized protein Low 9.2 1 1179-1201 ETSSVLKQYKRKLKNYLRFKYYI nucl(16),cyto_nucl(11),mito(7),cyto(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7SBV4 acidPPc domain-containing protein Low 5 1 6-26 ESIKGLKQRARRLSNPNDLQE plas(23),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W592 Uncharacterized protein Low 8.6 1 214-241 VYRPNTITQDLKKKNKKKAAKTVAGSSE extr(10),E.R.(7),golg(3),mito(2),cyto_nucl(2),nucl(1.5),cyto(1.5) KKKNKKKAA (225-233, prob:0.835) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8A3 Raptor_N domain-containing protein Low 8.7 1 1170-1189 SKDYNGRLWRRNRNEKIIQE nucl(17),cyto_nucl(11.333),mito_nucl(10.333),cyto(4.5),mito(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8L2 Uncharacterized protein Low 9.1 1 596-616 TSNSHFLKKIKMKNNNSFCPF nucl(14),cyto_nucl(9.5),mito(8),cyto(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W949 Uncharacterized protein Low 8 1 144-184 GPSSSSSKKTTKDKKPQEEAKSKRQLKREKRGENQVKYRNR mito(9),E.R.(5),mito_nucl(5),plas(4),golg(4) KKTTKDKKPQEEAKSKRQLKREKRGENQVKYR (151-182, prob:0.96) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WA94 Uncharacterized protein Low 7 2 2-25, 233-258 AGTIKIIRKKDPKKADPLARQKLI, LRILSKFDKKIPPKHKNNWDTIKRFI plas(16),E.R.(4),mito(3),pero(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAE1 UBC core domain-containing protein Low 8.3 1 4-26 LCLQRLQEERKKWRKDHPFGFFA nucl(9),mito(9),mito_nucl(9) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAT4 Uncharacterized protein Low 9.8 1 258-278 KPAINDKPMKMPKNKYKVIRR nucl(15),cyto(8),mito_nucl(8) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAV0 Uncharacterized protein Low 5 1 26-48 NFDSSLKKRKSIKPIKVTKVTTV plas(19),mito(5),cyto(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCQ9 Uncharacterized protein Low 7.6 1 436-460 GTFSALKKWYIKRKSKSLNVPEDKV cyto_nucl(11),nucl(9.5),cyto(9.5),mito(4),pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGZ5 Uncharacterized protein Low 9.6 1 34-62 TAKFSNPKSAKPKFSKRRKTQKTTTNMPS cyto_nucl(9.999),mito_nucl(9.999),cyto_mito(9.332),nucl(9),mito(8.5),cyto(8.5) PKSAKPKFSKRRK (40-52, prob:0.861) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W494 Uncharacterized protein Low 9.9 1 4-29 FEVSKKLPKNFLSKRHKPQVLRNIAA nucl(16.5),cyto_nucl(9.5),mito(8) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W721 Protein acetyllysine N-acetyltransferase Low 9.7 1 53-76 SSPASPCKIRKITRKPTLKYRPIV nucl(14),mito(8.5),cyto_mito(5.5),cyto(1.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAC9 Ribose-phosphate diphosphokinase Low 7.8 1 89-110 IPQFPYSKQCKMKKHRGAITAR cyto_nucl(12.5),cyto(12),nucl(11),mito(2),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5I0 Uncharacterized protein Low 8.8 1 26-45 YTSPTKKPKLTNGKSLNSKS nucl(14.5),cyto_nucl(9.833),cyto(4),cyto_mito(3.833),mito(2.5),pero(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6P6 Pyruvate carboxyltransferase domain-containing protein Low 7.1 1 32-55 KDPSSKYRPFPAPKLPQRKWPNNS mito(13.5),cyto_mito(9),nucl(7),cyto(3.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9I5 Flavodoxin-like domain-containing protein Low 5 1 312-333 AGRNIRPSKATKEQEKRKSVFA cyto(19.5),cyto_nucl(11),mito(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9V8 Uncharacterized protein Low 9.9 1 168-190 RTGFSKALKKWDKRSHSHEKEFY nucl(18),cyto_nucl(13),cyto(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9X5 Uncharacterized protein Low 7.4 1 259-278 EGEPFKRFQQMQKKERKHKL nucl(7.5),cyto_nucl(7.5),cyto(6.5),E.R.(5),pero(3),mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAI0 Lysophospholipase NTE1 Low 9.8 1 719-746 SEYTITSRRQMKRNKKKKPYKEEISSNL plas(17),nucl(5),golg(2),mito(1),cyto(1),vacu(1),cyto_mito(1) RQMKRNKKKKP (727-737, prob:0.891) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBS7 AA_permease domain-containing protein Low 5 1 1-23 MAPFSFIKKFSNRKNENHQSENY plas(27) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WC71 Reverse transcriptase Low 9.8 1 1045-1065 TFHVRRLKLYHQRQHNSNNVP nucl(16.5),cyto_nucl(10.5),mito(4),cyto(3.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WD06 Uncharacterized protein Low 9.6 1 1-28 MNRTRFISKKKQNHVKHAKKQPITQDDY nucl(17),cyto_nucl(12),cyto(5),mito(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WE74 Uncharacterized protein Low 8.6 1 89-110 KYLKYLTKKYLKKNQLRDWIRF nucl(10),cyto(9),mito_nucl(9) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEG6 Ribosomal_L18e/L15P domain-containing protein Low 8 1 155-186 MGPHKNKAPRILSKGRKFERGRGKRRSLGFKV mito(12),cyto(9),mito_nucl(9) RHFGMGPHKNKAPRILSKGRKFERGRGKRRSLG (151-183, prob:0.99) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEL5 DUF1279 domain-containing protein Low 8 1 17-36 LSIPIRRKFRTQPLRRFATQ nucl(9),mito(8.5),cyto_mito(6.5),cyto(3.5),plas(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEN9 Uncharacterized protein Low 7.4 1 119-160 EQLRIKVPRSTKPKNKDCRDLIIRDNFCKKCLQSKNTKRLKI plas(8),nucl(7),mito(7),mito_nucl(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHQ3 J domain-containing protein Low 6.4 1 32-54 MQCYKLIYSKSKKDTRNHEDDKY E.R.(6),mito(5),nucl(4),cyto(4),cyto_nucl(4),plas(3),cyto_pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W379 Uncharacterized protein Low 5 1 53-72 EVSHKFDHERRRNLYKRAKL golg(9),extr(8),E.R.(8) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W380 Metallophos domain-containing protein Low 6.2 1 1-23 MFSRNRSKNNNNNKKRDEEKEER plas(19),nucl(3),mito(2),cyto_nucl(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4K3 Uncharacterized protein Low 8.4 1 8-27 DTKLKFKTSKKLKVSSTFES nucl(12),cyto_nucl(9.5),mito(9),cyto(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5K8 Uncharacterized protein Low 6.9 1 28-48 SSIAPIKYNKSNKKPNSINVE mito(20),nucl(5.5),cyto_nucl(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W698 Uncharacterized protein Low 9.9 1 1367-1387 MLSLNKMRRKVKKGEDHDDSI nucl(20),cyto_nucl(14.333),cyto(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6L8 Uncharacterized protein Low 7.7 2 548-569, 823-851 FFLFWRRKNEKKNSDNENKNND, FKWIHSNDVNRKPSKKRLVKFPNKGIVNI plas(8),E.R.(6),mito(4),nucl(2),extr(2),pero(2),cyto(1),golg(1),vacu(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAY3 Uncharacterized protein Low 5.3 1 38-60 IRSAYRQLSKKYHPDKNPNDEDA E.R.(8),extr(7),golg(6),pero(2),cyto_mito(1),vacu(1),cyto_nucl(1),cyto(1),mito(1),nucl(1),mito_nucl(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBJ9 Uncharacterized protein Low 5 1 66-85 TSKFRIPKYSYKKVQNWMFN golg(9),mito(6),E.R.(5),pero(2),vacu(2),cyto(1),plas(1),extr(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDF9 Uncharacterized protein Low 9.7 1 88-111 DLRNKLKNIIRNKRRCIQRNVMET nucl(17.5),cyto_nucl(12.5),cyto(4.5),mito(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WH55 WD_REPEATS_REGION domain-containing protein Low 9 1 234-253 MFNMKKGKKIRTIKMPNLKI nucl(12),mito(6.5),cyto_mito(5),cyto(2.5),plas(2),E.R.(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHY3 Uncharacterized protein Low 6.9 1 702-721 NTIQRRKECKRMVEILRHAS cyto(16.5),cyto_nucl(15.333),nucl(9),mito_nucl(6.165) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WI11 Uncharacterized protein Low 9.8 2 146-172, 528-548 PPTSKNSTNSRHDRHHRRQSLKYIPGN, EDTKIETKKQQVRQRSRSTLP plas(14),nucl(8),mito(1),cyto(1),pero(1),E.R.(1),cysk(1),cyto_mito(1),cyto_pero(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7REM6 Uncharacterized protein Low 9 1 213-236 MEYVPPKKEKKPKAEQNKTKVEKK mito(15),cyto_mito(10.833),mito_nucl(10.333),cyto(5.5),nucl(4.5) PKKEKKPKAEQNKTKVEKKP (218-237, prob:0.918) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3A0 Uncharacterized protein Low 9.9 1 527-547 EIELEKGKKAQKQNEKENDAA nucl(19),cyto_nucl(13.5),cyto(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W428 Uncharacterized protein Low 5 1 84-103 ALKEPPRDRKKDKNIKHSGN cyto(25.5),cyto_nucl(13.833) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7W2 V-type proton ATPase subunit G Low 8.9 1 19-39 HDIVSKARKYRQDKLKQAKAD nucl(14.5),cyto_nucl(13.5),cyto(9.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7X4 Rab-GAP TBC domain-containing protein Low 9.7 1 95-114 KSFKSFKKGIRRLTPKETTK nucl(17.5),cyto_nucl(10.5),mito(3),cyto(2.5),pero(1),E.R.(1),golg(1),cysk(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WB57 SpoU_sub_bind domain-containing protein Low 6.9 1 68-87 KETWFKRKYAHVHARRKMER mito(18),nucl(5),cyto(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBJ1 Uncharacterized protein Low 6.9 1 75-102 SNNVRSLTKSKLKSKNEKHNTHYKKNIL mito(16),nucl(6),cyto_nucl(6),cyto(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCP7 Acetyltransferase component of pyruvate dehydrogenase complex Low 8 1 168-191 EDKSEEKPKSKPKSKKTTATTDKD mito(22),mito_nucl(13.166),cyto_mito(12.666),cyto_nucl(3.166) KSEEKPKSKPKSKK (170-183, prob:0.857) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WE20 Choline_kin_N domain-containing protein Low 9.5 1 16-35 SSSSRRPSLSRQRSSHRLIR nucl(15),cyto_nucl(9.5),mito(7),cyto(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFL8 Uncharacterized protein Low 7.6 1 1176-1202 KSRSLYDSRERSRKPPKVKVPAYQYIM nucl(12),cyto_nucl(10.833),cyto_mito(8.166),mito(7.5),cyto(7.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WG48 Protein N-terminal and lysine N-methyltransferase EFM7 Low 7.3 1 4-30 QQDLVRLRKHTIHRRNVRHRITQRGAL nucl(9.5),cyto_nucl(8.833),cyto(7),cyto_mito(6.833),mito(5.5),pero(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3Q7 Protein transport protein SEC31 Low 8.2 1 1202-1222 TPLTPKEYHKQLKDCDKRLKI nucl(11.5),cyto_nucl(9.5),mito(8),cyto(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W696 TOG domain-containing protein Low 8.1 1 151-180 LDNQEGIKKAQNKRNQHRRRIRESVLQSTT plas(12),nucl(9.5),cyto_nucl(6),golg(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W760 Uncharacterized protein Low 8.2 1 185-206 TSSSSSEKKKPQQEQMKKHYDD nucl(14.5),mito_nucl(11.333),mito(7),cyto_mito(6.833),cyto(5.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W908 Polyadenylate-binding protein Low 8.3 1 557-577 AAYQSFKQEQQQQQQQQQQPA cyto_nucl(14.5),nucl(13.5),cyto(12.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCZ1 Uncharacterized protein Low 7.8 1 276-299 EYEASLKKQKRKAWIQLDDKPVRG mito(17),nucl(8.5),cyto_nucl(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEC7 Calcium-transporting ATPase Low 5 1 784-803 DHEVMKRPPRKRSDKILTSS plas(20),E.R.(3),golg(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEE2 tRNA wybutosine-synthesizing protein 4 Low 9.1 1 12-34 LSSRSDKSLSKKQERKSKYADLA nucl(15),cyto_nucl(13.5),cyto(8) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEN5 PlsC domain-containing protein Low 9.9 1 12-33 DVNPKPKSRAHIPKISRQYKND plas(19),nucl(5),pero(1),E.R.(1),vacu(1) KAR (485-487, prob:0.612) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHR5 Glutaredoxin domain-containing protein Low 5.4 1 1-20 MGTTKIPKQIKSRRNTRIIS mito(6),extr(6),pero(4),E.R.(4),golg(4),nucl(1),cyto(1),cyto_nucl(1),vacu(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHZ0 Non-specific serine/threonine protein kinase Low 9.3 1 591-611 ASRHVSEKKRIERENRKRQLY nucl(17.5),cyto_nucl(14),cyto(9.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3A3 Arrestin_C domain-containing protein Low 9.4 1 988-1013 SSYYDEFIKRKNKKRCLPLLEIKPRE nucl(16.5),cyto_nucl(13.5),cyto(7.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3S3 Uncharacterized protein Low 8.3 1 1-20 MKHPDPGKKHHRKLLDASGA cyto_nucl(13),nucl(12.5),cyto(12.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4T2 Uncharacterized protein Low 9.6 1 494-518 GLQNVRTIRKKKWQKYWQYKSGIPI nucl(19),cyto_nucl(15),cyto(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5N7 Uncharacterized protein Low 9.1 1 577-602 EEASNDKLKKKKKKGNNNKSKKEEEQ plas(18),nucl(3),E.R.(2),golg(2),vacu(2) KLKKKKKKGNNNKSKK (583-598, prob:0.983) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7W4 Ribosome-recycling factor, mitochondrial Low 5.7 1 196-216 RNNILKKLKAIQKKNDSDRKL mito(22),nucl(2),cyto(2),cyto_nucl(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WC72 CCHC-type domain-containing protein Low 8.2 1 222-249 SNECRNSHGRQPGRHRYNQKSFRKSGSN nucl(10.5),cyto_nucl(9),mito(7),cyto(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCM6 Serine/threonine-protein phosphatase Low 9.7 1 89-108 NDDKNNSKHRHRNEDTNNDN nucl(18),cyto_nucl(12.5),cyto(5),mito(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCQ2 Uncharacterized protein Low 8.3 1 499-522 SDNTEDSCNKRQKRESQNDIMPDY nucl(12),cyto_nucl(11),mito(7),cyto(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEM7 Fe-S cluster assembly protein DRE2 Low 8.8 1 254-278 TMIICGKSQTKKKKACKDCSCGIKE nucl(14.5),cyto_nucl(11),cyto(6.5),mito(2),extr(1),E.R.(1),golg(1),vacu(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGI2 Glutamyl-tRNA synthetase Low 8.6 1 528-552 DVPQTPKTEMKPKHKKNPAVGEKKV cyto(16),nucl(9) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGY5 Uncharacterized protein Low 8.1 1 509-531 IEDSYSKYTRRRRWIRTAELIRV plas(13),nucl(9),cyto(2),E.R.(1),golg(1),vacu(1),cyto_mito(1),cyto_pero(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4R4 S5A_REDUCTASE domain-containing protein Low 6.7 1 293-318 AQMYLWAQKKNRKYKTKRAFLIPYIF plas(8),nucl(6.5),mito(5.5),cyto_nucl(5.333),cyto_mito(4.833),cyto(3),E.R.(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6F9 Uncharacterized protein Low 6.2 1 91-110 SSIHQVKKVHRDIRKRNERI mito(23),nucl(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9A8 Uncharacterized protein Low 9.9 1 3-27 TMNNDLTSNKKNKKQQPSADSSLSK nucl(20.5),cyto_nucl(15),cyto(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9M2 Inositol-1-monophosphatase Low 7.3 1 4-27 SNNQGKQGSCRTKNQQNKGKMTTS cyto(9),mito(7),nucl(6),pero(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAI1 DNA-(apurinic or apyrimidinic site) lyase Low 8.8 1 356-376 TRTTFDRVSNKHRKNIKREQI nucl(14),cyto_nucl(11.5),cyto(7),mito(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAU6 Uncharacterized protein Low 5 1 488-508 ANCLQNKKKKLDAYRNNRILY mito(10),plas(9),E.R.(5),cyto_mito(5),mito_nucl(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFM4 PPM-type phosphatase domain-containing protein Low 7.7 1 19-38 NSQWSRTTNKWNNNTIKYNN mito(12),nucl(9.5),cyto_nucl(8),cyto(5.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGM9 Uncharacterized protein Low 9.1 1 163-203 TYPTSKPQQPQQKFKQNNKKNKANTKKQKLNNNNTNKKQQQ nucl(20.5),cyto_nucl(12.833),mito_nucl(12.666),mito(3.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGR9 Dopey_N domain-containing protein Low 8.7 1 9-31 TIDSHTKQLNSKQKKFHINVERA nucl(13),cyto_nucl(10.5),mito(6),cyto(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3S5 FAD-binding PCMH-type domain-containing protein Low 5.7 1 483-507 FQKKIIFHIQKARKNKNLKGFQSLF mito(22),nucl(2),cyto(2),cyto_nucl(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3W3 Uncharacterized protein Low 7.4 1 10-34 IVSADRCKPKKCHQECKRSCPVVKT plas(8),nucl(7),mito(7),mito_nucl(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W463 Uncharacterized protein Low 7.1 1 507-528 IETRSKLAMKLKQLKNKGKLNL cyto_nucl(8),nucl(7),mito(7),cyto(7),E.R.(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4J3 TPR_REGION domain-containing protein Low 9.1 1 119-141 AGDTTRRNKRNRMEEQQHRKTYA nucl(15.5),cyto_nucl(11),mito(6),cyto(5.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5H3 Recep_L_domain domain-containing protein Low 9.4 1 469-501 KGGENPFSIKNKRKKHSKKARKGVKVTNSGSKF E.R.(9),nucl(4),pero(4),cyto(3),mito_nucl(3),mito(2),plas(2),golg(2) KNKRKKHSKKARKGVK (478-493, prob:0.988) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6X1 MICOS complex subunit MIC60 Low 9.6 1 36-56 VSSSPFVKPKKHTFRNTIFIV nucl(17),cyto_nucl(11),mito(6),cyto(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7N6 Succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial Low 5 1 10-29 VSTATRRQFHRQSHPYDQTI mito(16.5),cyto_mito(11),cyto(4.5),pero(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7Z2 Sfi1_C domain-containing protein Low 9.7 1 1038-1060 DTRINPRLKGSPTRRNPRLTNTK nucl(23),mito_nucl(13.833),cyto_nucl(12.333) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W812 Alpha-1,3-glucosyltransferase Low 5 1 19-44 SSSSQKSKVEDTKKSKKMNNNQPLET plas(21),pero(2),E.R.(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W986 Uncharacterized protein Low 8 1 375-399 PPVINIHKPRNRRKIKRIQNSFLKI plas(16),mito(5),E.R.(5) KPRNRRKIKR (382-391, prob:0.78) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCH5 Uncharacterized protein Low 8.6 1 9-41 QQPFYQITGKRKGNRYHHYRRNWKNNYHPEQDS nucl(13),cyto_nucl(10.5),mito(7),cyto(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCI6 Pyruvate carboxylase Low 7 1 910-929 PLRSDILRNKRRKLTCRPGL cyto(13.5),cyto_nucl(11),nucl(7.5),pero(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHX8 Uncharacterized protein Low 9.8 1 241-261 ISGKMQKKKYNKIIDEVRKME nucl(12),mito(8),cyto(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5X7 Zn(2)-C6 fungal-type domain-containing protein Low 9.9 1 6-46 INGKEVTNKNRQRLRVQRACAICKKRKVKCDGMKPCSNCIK nucl(17.5),cyto_nucl(12),cyto(3.5),mito(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8B5 Aminotran_1_2 domain-containing protein Low 8.4 1 70-89 FYLSKPQQKKGLQSNRPKLS nucl(11),mito(10),cyto_nucl(8),cyto(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8R2 Uncharacterized protein Low 8.6 1 12-39 DDDDYKDGKSKRRLSKWQYFIRNKLTQL nucl(9),plas(9),mito(3),golg(2),cyto_mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDN5 Telomere_reg-2 domain-containing protein Low 9.2 1 609-632 LLRQSKTVWKSKKLEKGSKIQEVN nucl(15),cyto_nucl(11),cyto(5),E.R.(3),mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDP1 Valyl-tRNA synthetase Low 7.3 1 953-973 IEKNQKKLKKLEGIKENLKRT mito(17.5),cyto_mito(10),nucl(8) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDP5 U3 small nucleolar RNA-associated protein 22 Low 9.4 1 1175-1195 LIKPLFKKSHKFKVNLDCNMK nucl(17),cyto_nucl(13),cyto(5),mito(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDY9 Palmitoyltransferase Low 7.9 2 7-33, 333-353 IEYSKPFRIRKSSRQKHSHDHDHDNDN, GSKNPVFHRIKRQENNPFEQG plas(20),mito(3),nucl(2.5),cyto_nucl(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHR7 Uncharacterized protein Low 9.5 1 1-26 MYSWKSKFKFGRSREEKQKQKESSVE nucl(16.5),cyto_nucl(10.5),mito(6),cyto(3.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WI37 AB hydrolase-1 domain-containing protein Low 6.5 1 24-45 DLYFRHIKPKHVSRPQSPKSSK mito(15),cyto(5),nucl(4),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W311 VHS domain-containing protein Low 9.5 1 166-190 SNTTNKTKKQSSRTRSRTRSKKSNF nucl(16.5),cyto_nucl(12),cyto(6.5),mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5C2 Uncharacterized protein Low 8 1 199-220 NKGKLIRKVKSKTKKDLKIDST plas(23),mito(1),pero(1),E.R.(1),golg(1) KLIRKVKSKTKK (202-213, prob:0.721) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W635 Nuclear pore protein Low 9 1 48-68 NEIKRRAIELRKKKNIDNTLT nucl(16.5),cyto_nucl(11.833),cyto(6),cyto_mito(4.833),mito(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7D7 Uncharacterized protein Low 9.6 1 213-241 QFVPPKKEKKAEKKPKAEQKPKVEKKPEA cyto(14.5),cyto_nucl(12.666),cyto_mito(9.499),nucl(8.5),mito_nucl(6.499) PKKEKKAEKKPKAEQKPKVEKKPEAEADAEAAPAKKPK (217-254, prob:0.995) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W824 Lysophospholipase Low 5 1 728-757 KPSATGRTRNYQRKSNSKNIDPKNHHPIIN E.R.(7),plas(6),extr(6),mito(3),golg(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8T3 Uncharacterized protein Low 6 1 335-361 MRNYDLREYTKKKRLRKDSNLPHHDLM plas(5),golg(5),mito(4),E.R.(4),nucl(3),pero(3),extr(2),cyto_nucl(2),cyto_pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WA54 Calcium-transporting ATPase Low 7 1 205-229 QKELQFAKLNKKKENRKVIVVRNAQ plas(18),nucl(5),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGS3 Uncharacterized protein Low 9.5 2 316-337, 665-688 EDAFYRKTKTHQKKLKHLENKL, LNIAREYMKNHEKKKRPLEEDTTF nucl(8.5),cyto_nucl(7.5),cyto(5.5),E.R.(5),pero(3),mito(2),vacu(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WH21 Uncharacterized protein Low 9.2 1 250-276 DWYARKTPLVDKKEKRNPYHRKAFYED nucl(11),mito(8),cyto(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHE0 Uncharacterized protein Low 9.4 1 96-116 IINARTSKKYRQRGQSFTVIP nucl(16),cyto_nucl(13.5),cyto(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHR4 Trimethylguanosine synthase Low 9.3 1 2-38 IHASKLSKIIKRRTKTRNTKHHHDTKKYKILKKLIAE mito(19),nucl(4),cyto(4),cyto_nucl(4) KIIKRRTKTRNTKHHHDTKKYKILK (9-33, prob:0.832) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WI50 D-fructose-6-phosphate amidotransferase Low 7.7 1 56-78 IGKVSALKKEIKRQNPNRDVTFV cyto(15.5),cyto_nucl(15),nucl(11.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W367 Uncharacterized protein Low 5 1 313-332 DMTNSRKKHQKEKEERAQSK plas(26) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAX6 Phosducin domain-containing protein Low 9.6 1 242-261 EESREQRHLKFDKKEKYKII nucl(14),cyto(10.5),cyto_pero(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WC66 Uncharacterized protein Low 8 1 360-382 VVERFDKKPKTFFKKMLKNPFKK plas(17),mito(3),E.R.(3),golg(2) FKKMLKNPFKK (372-382, prob:0.651) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCP3 MMS19 nucleotide excision repair protein Low 9.9 1 1007-1028 LLPLSDKKRIVRKQCIDTRQAY nucl(17.5),cyto_nucl(11.5),cyto(4.5),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDK8 MARVEL domain-containing protein Low 5 1 150-169 AFSNTFTSRRRRRNGAAEVG plas(12),mito(7),E.R.(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDL4 STAS domain-containing protein Low 5 1 810-838 NEFLFKYKTLREKTRQKRKNKIDINLAIT plas(14),mito(8),E.R.(4),mito_nucl(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEV5 FCP1 homology domain-containing protein Low 8.3 1 12-35 VLPLQLFKKKDKKDARNVIEKKVA nucl(10),E.R.(5),mito(3),cyto(3),pero(3),cyto_mito(3),cyto_pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFD6 Zn(2)-C6 fungal-type domain-containing protein Low 8.7 1 7-36 KETKKTTYACSVCKRKKTKCDKLIPCTSCV nucl(19),mito_nucl(13.499),cyto_nucl(11.833),mito(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHM0 E3 ubiquitin-protein ligase PEP5 Low 9.2 1 926-946 VDKPKEIRVKNEKCRRCNTLL nucl(16),cyto_nucl(13.5),cyto(9) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5H6 Uncharacterized protein Low 9.7 1 335-362 IRKNEAARKKICKKFEKNKPSAHQKHLQ nucl(17.5),cyto_nucl(11.5),cyto(4.5),mito(2),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W690 Uncharacterized protein Low 5 1 497-517 NIHALKRKHISTKNRYNWDKW plas(25) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7S3 Uncharacterized protein Low 9.2 1 16-41 DPSVGTPTTKKHKRPTRAFHNFGLPG nucl(18.5),cyto_nucl(13.333),cyto(7),cyto_mito(4.833) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8H0 Dolichyl-phosphate-mannose--protein mannosyltransferase Low 8.7 1 434-457 DYFGMKLSKNIRKKKRRDGFEGAL plas(19),E.R.(3),nucl(2),mito(2),mito_nucl(2) KNIRKKKRR (442-450, prob:0.84) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8I3 Asparaginase Low 9.4 1 48-67 LPNLVKPTKRIRLPRIKIVG nucl(14),cyto(11.5),cyto_mito(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8Y8 Uncharacterized protein Low 9.6 1 679-705 DNDEKWFCPKCRRKQISTKQLKITRLP nucl(18),cyto_nucl(12.5),cyto(5),mito(2),cysk(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WC91 ANK_REP_REGION domain-containing protein Low 7.5 1 489-510 KLLTSRFIQRRRSSHSKSKETS plas(10),nucl(7),mito(5),E.R.(2),cyto(1),pero(1),golg(1),cyto_pero(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGA3 CBM21 domain-containing protein Low 9.1 1 159-182 LLDTNKNKKKPYCHNNNNNNDIHR nucl(16),cyto_nucl(12),mito(7),cyto(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WI61 Protein NDAI0K02810 Low 9.4 1 787-811 DDDEHGKKRQTTKKVSKEKDSESYE nucl(15.5),cyto_nucl(10),cyto(3.5),mito(3),plas(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7REN1 Protein-tyrosine-phosphatase Low 9.1 1 365-386 EEYHSQKRKLRDHSNKENEHND nucl(15.5),cyto_nucl(13),cyto(7.5),mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6W8 Uncharacterized protein Low 8.8 1 310-330 IPRRVKFKTGKVSKVQQEKKS nucl(17),cyto_nucl(11.833),mito_nucl(9.833),cyto(5.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W935 DAO domain-containing protein Low 6.9 1 42-68 SKLSETTTNDKNKKKFKLKQLTIIASN cyto(9.5),cyto_nucl(8.5),nucl(6.5),extr(3),pero(3),mito(2),E.R.(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9R4 Uncharacterized protein Low 6.3 1 31-54 AYPFYPFKRLTKQNPKKHDTNLKY mito(18),cyto_nucl(5),nucl(4),cyto(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCE6 t-SNARE coiled-coil homology domain-containing protein Low 9.2 1 257-278 HTTKAVKSARTARKNKIRCYII nucl(16),cyto_nucl(14),cyto(8) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WF67 Dolichyl-phosphate-mannose--protein mannosyltransferase Low 5 1 216-238 FVIFHNQKKKPFSRKWWKWLILT plas(26) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGP8 Pre-mRNA-splicing factor CWC15 Low 9.6 1 141-160 KTTFSRKKVVKSTENKKRTY nucl(15.5),cyto_nucl(9.5),mito(9) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3H4 Autophagy-related protein 9 Low 8.4 2 10-29, 656-675 EPPLSKSKFNLKRPNILKNI, GTSTSRRKGKSSGRRNGQLG plas(20),nucl(4),E.R.(2),mito_nucl(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6V4 Mrpl_C domain-containing protein Low 6.1 1 1-20 MTVGITRKLNRTKPHRDALF mito(24),nucl(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8C8 Aa_trans domain-containing protein Low 5 1 619-640 HASGKHNSRIKWKKNYFRCIMV plas(23),mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WD97 Uncharacterized protein Low 6.7 1 186-208 FEPLDKQCRNKNTRQRRLIDDGS plas(13),nucl(5),E.R.(4),cyto_mito(1),vacu(1),golg(1),pero(1),cyto(1),mito(1),cyto_pero(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDF3 Uncharacterized protein Low 5 1 1042-1065 LSISRGKPLQKLSKQRPQKGIFNI plas(16),mito(5),E.R.(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDI9 Uncharacterized protein Low 5 1 461-503 FIEGDEKYKRNKKANTYDRSWEHGTGCRCKCPRRLREIEDTMH golg(9),E.R.(8),extr(3),plas(2),pero(2),vacu(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDV0 Uncharacterized protein Low 8 1 155-177 LTIYKGIKARKNMKMRRILNNVN plas(25) KSKGKK (1495-1500, prob:0.718) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEJ2 Rab-GAP TBC domain-containing protein Low 9 1 12-33 LPSSHHHLKNLKQQDRNRNLIN nucl(14.5),cyto_nucl(12),cyto(6.5),mito(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5I5 Inositol-3-phosphate synthase Low 8.8 1 417-436 LYPQSDKMKKKNKDVDHCIV nucl(14.5),cyto_nucl(10.333),cyto(5),cyto_mito(3.833),pero(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5N1 Uncharacterized protein Low 9.9 1 272-299 RSDNTYQQRKKIKVNKVNKKRSHFGKLG cyto(12.5),cyto_nucl(10),nucl(6.5),pero(5) RKKIKVNKVNKKR (280-292, prob:0.754) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6A5 Uncharacterized protein Low 7.4 1 295-314 VSVGRYSKKRRYFDNPGKIY nucl(13.5),cyto_nucl(11.666),mito_nucl(10.499),cyto(7.5),cyto_mito(7.499),mito(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W819 Uncharacterized protein Low 7.3 1 348-367 TPDSNDKKKNFRPPSVHLDQ extr(9),nucl(6.5),cyto_nucl(4.5),mito(4),E.R.(3),cyto(1.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8G5 Glycosylphosphatidylinositol anchor biosynthesis protein 11 Low 5 1 1-20 MSGKAKKQVKKRVTFSDDNT plas(23),pero(2),E.R.(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WB91 AB hydrolase-1 domain-containing protein Low 7.3 1 641-664 RINSNEKLKNKIQQRKLSKYLSNE E.R.(7),golg(7),nucl(6),cyto(2),pero(2),cyto_pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBH9 USP domain-containing protein Low 7.9 1 398-421 HYQGHYQCYRHKPKLRINKENGEI nucl(10.5),cyto_nucl(7.833),mito(5.5),cyto_mito(5.333),cyto(4),pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBK7 Isoleucyl-tRNA synthetase Low 7.2 1 979-998 KSSLHKCPRCWKQSSNEADT mito(18),nucl(6.5),cyto_nucl(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WC09 Lgl_C domain-containing protein Low 7.9 1 1-22 MFKRTKLKKVSNPFKSSKKAEP nucl(9),plas(7),mito(4.5),cyto_mito(4),cyto(2.5),E.R.(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WC97 Uncharacterized protein Low 8 1 564-600 PLKVWKSGIKRAKDHRKAHRKHLIRKRFSMNHNNVTY plas(11),E.R.(8),mito(5),golg(2) KVWKSGIKRAKDHRKAHRKHLIRKR (572-596, prob:0.981) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHF2 F-box domain-containing protein Low 9.1 1 127-149 ITLIQLQSRKNKQRKFTYIPCTT nucl(15.5),cyto_nucl(11.5),cyto(6.5),pero(2),cysk(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHV4 Uncharacterized protein Low 9.1 1 183-202 KTPAKSKKLDRIKKNINVQQ nucl(14.5),cyto_nucl(9.5),mito(8),cyto(3.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7SBN4 Uncharacterized protein Low 8.7 1 32-56 PSAHTQPNLKKKKVKYDRSVLKPIL mito(12),nucl(11),cyto_nucl(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W490 TLC domain-containing protein Low 5 1 91-114 AGKKNDNKTPHHHHHHKKRYNALV mito(11),plas(11),E.R.(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W762 TNFR-Cys domain-containing protein Low 9.7 1 53-77 NDSSCKCVRKTKDCKCTNCKCSPCT nucl(18.5),cyto_nucl(14),cyto(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8S3 Uncharacterized protein Low 7.3 2 4-26, 69-95 INLPSLFRTKRLKRHPWLALLFP, FTKNFKMPKYSYKKKKSWSFLNNHVPD golg(8),E.R.(7),mito(6),vacu(2),pero(1),cyto_nucl(1),extr(1),cyto(1),nucl(1),cyto_pero(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9J8 Protein kinase domain-containing protein Low 9.8 1 689-712 SIRNGNFTSRRKRKVVHNHMHIVN nucl(12),mito(5),plas(4),cyto_mito(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9U0 Uncharacterized protein Low 5 1 44-66 ISERALKAKNKLRSWKKISDNAE plas(13),mito(6),E.R.(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WA84 Uncharacterized protein Low 9.7 1 309-328 RPQLMRRIMKNQQKNNHTKI nucl(16.5),mito_nucl(11),mito(4.5),cyto(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBF9 Lactamase_B domain-containing protein Low 9.5 2 36-61, 395-414 NFQGTIKKTKIPPKQKRRYILGTFLT, PCGQYCPEWHQKPRHINSKE mito(18),nucl(8),cyto_nucl(5.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBP4 Uncharacterized protein Low 7.1 1 428-453 ENLIIRKSRFVKKWNNERHWQKEEKY nucl(7.5),cyto_nucl(6.333),mito(5.5),cyto_mito(5.333),cyto(4),pero(4),golg(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHW1 RING-type domain-containing protein Low 5 1 577-603 RNTIKGIASRRDRRRNNSPTNRRQNEM plas(12),E.R.(6),mito(5),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7RE75 Reverse transcriptase Low 8.9 1 220-248 HKSNECRNSKNRQFGRHRYNQKSFRKSGP nucl(15),cyto_nucl(9.833),pero(4),cyto_mito(3.666),mito(3.5),cyto(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4I7 Protein kinase domain-containing protein Low 9.1 1 1040-1062 GRTASGKKNNHHHHRTHSNHFTR nucl(21),cyto_nucl(12.333),mito_nucl(12.333),mito(2.5),cyto(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5J5 Protein kinase domain-containing protein Low 8.2 1 500-524 SEGKQEKISNNKKKQFNKSMPKVVN nucl(12),cyto_nucl(11),cyto(8),mito(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8X1 Tyrosine--tRNA ligase Low 7.3 1 128-149 RFFKNGKKYYERKNKHNTVEFG mito(20),nucl(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WA67 Dolichyl-diphosphooligosaccharide--protein glycotransferase Low 8 1 674-698 GDFERAKGKLTKKRKITKPDLTLRV plas(22),E.R.(3) AKGKLTKKRKI (679-689, prob:0.823) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBQ7 AMP-binding domain-containing protein Low 9.5 1 716-736 ITPTLKIKRMNASKRFKKELD nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCN1 WD_REPEATS_REGION domain-containing protein Low 8.8 1 41-61 NGKLIHKSKMFRKNKIHGLSV nucl(13.5),cyto_nucl(12),cyto(7.5),mito(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W355 Uncharacterized protein Low 7.4 1 783-802 VRADRRLYSRAQKYQKENGA cyto_nucl(12),nucl(9.5),cyto(9.5),mito(4),pero(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4G1 Uncharacterized protein Low 8 1 150-169 QSPRRVSWVKDRQRERNPRF nucl(10),cyto_nucl(9.5),cyto(7),mito(5),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4H5 Uncharacterized protein Low 9.2 1 50-69 KSQQSEKKSRQSSKPNSSTE mito(13),nucl(11),cyto(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7Y6 Candida_ALS_N domain-containing protein Low 7 2 369-389, 416-436 HSRGHHPCRNTKHQRCHHYYH, HSRGHHPCRNTKHQRCHHYYH extr(13),E.R.(7),mito(3),plas(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBQ5 AAA domain-containing protein Low 6.6 1 84-106 DNEQQKKYSEKEKKDDSKKTSEE mito(12),cyto_nucl(5),nucl(4.5),cyto(4.5),E.R.(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDB2 Uncharacterized protein Low 5.8 1 186-205 FEPLDKQCRNKNTRQRRLID plas(20),E.R.(3),nucl(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDM8 Uncharacterized protein Low 6.9 1 230-250 ALKHEELKKKKNNSKEDGKDD E.R.(8),nucl(5.5),golg(5),cyto_nucl(4.5),pero(4),cyto(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDQ3 DNA replication complex GINS protein PSF3 Low 8.6 1 188-207 FEKKIYKKSHESYKDTKRWM nucl(14.5),cyto_nucl(10.833),cyto(6),cyto_mito(4.833),pero(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDT9 Signal peptidase subunit 3 Low 8 1 193-213 ENDSSVAKKKLKRARKQQKAN extr(18),pero(3),E.R.(3),golg(3) KKKLKRARKQQKA (200-212, prob:0.926) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEJ9 Septin-type G domain-containing protein Low 9.7 1 549-568 SSSPIQQQQHQQQKKKGFLR nucl(20),cyto_nucl(13.833),cyto(5.5),cyto_pero(3.666) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFH4 Arrestin_C domain-containing protein Low 8.1 1 727-746 MSWMKFKKSQSNNTNKDAQS nucl(13.5),cyto_nucl(12.833),cyto(11),cyto_mito(6.833) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFP3 WD_REPEATS_REGION domain-containing protein Low 8.8 1 1-24 MATVIPPQSKKQKREAQQPRDVSL nucl(16),cyto_nucl(10.833),cyto_pero(4.166),mito(4),cyto(3.5),pero(3.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFR3 Uncharacterized protein Low 8.3 1 143-168 IDLLRQNKGLRKRNKHYYIRNTRLDV mito_nucl(13.166),nucl(13),mito(13) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3K3 Threonyl-tRNA synthetase Low 7.7 1 10-36 KNLSVDEAPKKQKKSKQQQLYLDPEPQ cyto(14),nucl(8),cyto_mito(8) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3L2 40S ribosomal protein S24 Low 8.8 1 96-135 LAEKVEKASRQQRKQKKNRDKKVFGTGKRRAKKIARRNAD mito(20),cyto(4),nucl(2) KASRQQRKQKKNRDKKVFGTGKRRAKKIARRN (102-133, prob:0.993) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W400 SAC domain-containing protein Low 5 1 673-702 KEEHTKEKKFGKFKYSPSKKFTKPNSTKTD plas(9),mito(6),E.R.(4),mito_nucl(4),cyto(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W640 Citrate synthase Low 7.7 1 32-52 LIPERKEKFLKLKKNYHNVEI mito(17),nucl(8.5),cyto_nucl(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W712 Uncharacterized protein Low 8.6 1 252-271 VLKNPFKKNVSKRRSNLATS nucl(14),cyto_nucl(12.5),cyto(9),pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8T0 Uncharacterized protein Low 8.3 1 4-25 LSITKHSSKKRLHESQIPDEYS nucl(12),cyto_nucl(10),mito(8),cyto(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBC2 Ribosomal_L18_c domain-containing protein Low 8.7 1 10-37 SAYHSRYQTPFRRRREGKTDFYQRKRLV nucl(14.5),cyto_nucl(12),cyto(8.5),mito(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDC9 RNA annealing protein YRA2 Low 8.9 1 119-140 MYEQYPKKSPRNKPSRPDSRDD nucl(19),mito_nucl(12.833),cyto_nucl(11.333),mito(5.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WF79 Mitochondrial distribution and morphology protein 10 Low 8.8 1 105-126 QTYKHIHPSYYKRRRGHNYFDN nucl(17.5),cyto_nucl(12.333),mito_nucl(10.666),cyto(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHU3 O-acyltransferase Low 6.4 1 67-90 YDNNKTNNKGEYKNKNKNKDEVDE plas(15),nucl(4),E.R.(4),golg(2),vacu(2),mito_nucl(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7M9 Mannosyltransferase Low 5 1 100-121 IITLKFYLKNNNNTKKNRKLGF plas(13),E.R.(6),mito(5),cyto(1),golg(1),vacu(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7R2 DNA-directed RNA polymerase subunit Low 7.6 1 137-161 RMGILKKVLDQCKKQRRCLQCGALN cyto(11.5),cyto_nucl(11),nucl(9.5),mito(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WA09 Gag-Pol-p199 Low 8.1 1 157-181 KAKSNTRTPRSSPTHRKQSAKSSKI nucl(8),mito(7),cyto(5),pero(2),E.R.(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCJ7 Uncharacterized protein Low 8.8 1 803-823 HIITKKERYRRSSKLMRYDPY nucl(11),mito(5),cyto(4),E.R.(3),golg(2),vacu(2),cyto_pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WD28 AAA domain-containing protein Low 7.3 1 36-61 HLDICPSNKHKTQQKQHIPRQGNTLK mito(20),nucl(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WF58 Endonuclease III homolog Low 7.5 1 13-59 TTTTTTIKKVTKKVTKKNNQTKSKTIKVESKYFVKKKPKLEQEEIPS mito_nucl(13.833),mito(13.5),nucl(12),cyto_mito(8.166) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7REA0 Uncharacterized protein Low 9.2 1 91-111 LKAVPKKKVSHQKKRQRLYAP mito(19.5),mito_nucl(12.833),nucl(5),cyto_nucl(4.333) PKKKVSHQKKRQ (95-106, prob:0.744) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W354 Uncharacterized protein Low 8 1 366-396 DYTLPGEREKQNKRNKNKKKNKYSNDSAFFD plas(14),E.R.(8),mito(3) KQNKRNKNKKKN (375-386, prob:0.868) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5L1 Uncharacterized protein Low 9.5 1 163-187 ELYSLLKRSRRKNDHQSPNRKYPDI nucl(17),cyto_nucl(12.5),cyto(6),mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5T5 GFO_IDH_MocA domain-containing protein Low 6.9 1 26-46 ISKNRIWKRRSLITNKRNSIS cyto_nucl(8.833),mito_nucl(8.833),mito(8.5),cyto(8.5),nucl(8) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8P9 5-aminolevulinate synthase Low 5 1 72-91 DNELRKKRLDKSYRYFNNIN mito(20.5),cyto_mito(12.5),cyto(3.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WB11 Uncharacterized protein Low 6 1 1-21 MSTIKSKTSQKSKRNLRVISS E.R.(7),mito(5),pero(5),nucl(3),golg(3),cyto_mito(3),cyto_pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WE85 GPI inositol-deacylase Low 5 1 31-56 SDSNATLRKKEPKDSKSRNANIEKIL plas(14),E.R.(7),mito(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WG85 N-alpha-acetyltransferase 40 Low 9.2 1 236-255 VYQIEKRQTRNLRRINNAGT nucl(15.5),cyto_nucl(12.5),cyto(8.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGX4 40S ribosomal protein S25 Low 9.7 1 15-39 AAMAGGKKSKKKWSKNNHKDKAQHA mito(18),nucl(5.5),cyto_nucl(5),cyto(3.5) KAAAAMAGGKKSKKKWSKNNHK (12-33, prob:0.95) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHU4 HIG1 domain-containing protein Low 8.5 2 38-61, 223-245 LLEYIHQKEKKKTRTTSKMKILSA, YEEKSHPNKNKMNEKRRWEKALE cyto(10),cyto_nucl(8.5),nucl(5),mito(5),plas(2),E.R.(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7S4L2 Uncharacterized protein Low 5 1 558-580 MGSTHYKPSYKKRMANNLPSANS E.R.(8),plas(6),mito(4),cyto(2),extr(2),pero(2),golg(2),cyto_pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W392 SHSP domain-containing protein Low 9.7 1 47-72 PGSHHSHHPHHHHPRHPHPHPHTFGA nucl(23),cyto_nucl(13.833),mito_nucl(12.333) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6X9 Uncharacterized protein Low 9.8 1 642-661 NAPNREKEFKNKRVCQRWLD nucl(17.5),cyto_nucl(12.5),cyto(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7V3 Uncharacterized protein Low 7.8 1 276-298 TDKITYVLKKDEKRRNKFADLLT cyto_nucl(11.5),cyto(11),nucl(10),pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W803 Uncharacterized protein Low 6.5 1 87-107 NERQAKKFEKQHKTLEKKINL mito(8),pero(5),nucl(4),extr(3),E.R.(3),cyto_pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8K2 Uncharacterized protein Low 6.1 1 30-57 YSAKAAKFLKAQRRRQKNEEKQATIKNS mito(21.5),cyto_mito(12),nucl(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WG21 Uncharacterized protein Low 9.1 1 534-553 RKQPQHKQLDPQTARKQRGH nucl(15),cyto_nucl(13),cyto(9) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W372 Peroxidase Low 5.8 1 43-69 TASLYDSNKRRRNNYQKNNNNNNNGFS mito(16),mito_nucl(10.333),cyto_mito(9.833),nucl(3.5),vacu(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6A2 Uncharacterized protein Low 5.6 1 20-39 LKNFIIRKLKFKNLKQMTKS extr(15),E.R.(5),cyto_nucl(2),pero(2),nucl(1.5),cyto(1.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9F6 tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 Low 8.6 1 151-176 KKTVYSQEKYLKRKKQKFDKIFTVDY nucl(14.5),cyto_nucl(13),cyto(8.5),mito(1),pero(1),E.R.(1),vacu(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9Y2 Uncharacterized protein Low 9.5 1 265-287 TDRFTCGKCKEKKVSYYQLQTRS nucl(22.5),cyto_nucl(14.833),mito_nucl(12.832) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WE37 Uncharacterized protein Low 5.8 1 126-148 ATFPYMHKQNPQKVRKKEMTSGI mito(22.5),cyto_mito(12.5),nucl(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHH5 Uncharacterized protein Low 9.7 1 16-48 ERPPLRSSKTETKIRGRSRQTRQSTKTSNNPVS nucl(18.5),cyto_nucl(12),cyto(4.5),mito(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7REB0 ATPase expression protein 1 Low 7.8 1 24-46 ATGIKGKIQPRQRQPIPMKRTIL mito(16),nucl(8.5),cyto_nucl(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7RT79 Tryptophanyl-tRNA synthetase Low 9.2 1 421-440 KERLVPAKPKVKAPKDSKKK cyto(18.5),cyto_nucl(12),nucl(4.5),pero(3) KERLVPAKPKVKAPKDSKKK (421-440, prob:0.966) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7RTF8 WD_REPEATS_REGION domain-containing protein Low 9.9 1 246-268 DIDSKIKQLKFRRKNVFNKIARM nucl(15),cyto(7.5),cyto_mito(5.5),mito(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W543 RXT2_N domain-containing protein Low 9.9 1 13-33 NTFTRKIIKAKTGNHNPLKRS nucl(18.5),cyto_nucl(13),cyto(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W639 AMP_N domain-containing protein Low 8.2 2 15-38, 59-79 LLFDYIRKYNRRKEPITKNYDLKM, LEGKKYPSKAHNEKVKKIFQS E.R.(9),extr(5),cyto(4.5),cyto_nucl(4.5),nucl(3.5),mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W864 Uncharacterized protein Low 5 1 535-554 YYLLYKKKYYHGPKTNLSDE plas(26) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W909 Phospholipid-transporting ATPase Low 8 1 319-346 HFTEEGREKRRQQKRNRMRTQRASFDGD plas(25) KRRQQKR (327-333, prob:0.628) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAB8 Uncharacterized protein Low 9.3 1 25-47 EESRRRILEDKIRRRQRDERITS nucl(16.5),cyto_nucl(13),cyto(6.5),mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFH7 Uncharacterized protein Low 7.9 1 2-31 VNVPKTRKTYCKGKACRKHTQHKVTQYKAG nucl(10.5),mito(10),cyto_nucl(9),cyto(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4M5 TruB_N domain-containing protein Low 9.4 1 62-84 KETGKVASKRKLRKVSKVKMGHG mito(17),mito_nucl(13.499),cyto_mito(10.999),nucl(7.5),cyto_nucl(5.832) KKQYEKETGKVASKRKLRKVSKVK (57-80, prob:0.898) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5I6 Vacuolar protein sorting-associated protein 35 Low 9.7 1 796-820 RIRCVSRCSKLLKKKHQCRSIYLCS nucl(17.5),cyto_nucl(12),cyto(5.5),mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5M5 Uncharacterized protein (Fragment) Low 8.4 1 44-64 VIPLYCKHKRTKYFYYKEESS nucl(12.5),cyto_nucl(12.5),cyto(9.5),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBJ7 Uncharacterized protein Low 8.2 1 41-64 SLSFPIKNLIKRKQKNHTLNTPTS nucl(11),mito(9),cyto_nucl(9),cyto(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCU4 AD domain-containing protein Low 7.9 1 39-63 LDTTTSTKKNKIKKSKETNLHDFKI nucl(9.5),cyto_nucl(9),cyto(7.5),mito(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCY7 Anaphase-promoting complex subunit 1 Low 9.8 1 1379-1403 GLHSYLFKRAKKKTRINPIVREFAA nucl(12),plas(11),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WE59 Ribose-phosphate diphosphokinase Low 6.5 1 6-27 DLEYPFKRYHCKTQPTKSIVMS cyto_nucl(10.833),cyto(10.5),cyto_mito(10.332),mito(8.5),nucl(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WG66 Abhydro_lipase domain-containing protein Low 6.5 1 54-80 INEPKNKAYKSSKYSKQRKPSVSSVSS E.R.(7),extr(6),golg(5),nucl(4),mito(2),plas(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W455 MFS domain-containing protein Low 8 1 315-339 SLPNQRSSLKRKRHVHKMEARTKRA plas(20),E.R.(4),mito(2) KRKRHVH (324-330, prob:0.675) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6D0 MFS domain-containing protein Low 5 1 15-41 DGTNNSENNSKKKKKNANSMSDPNNKY plas(26) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W869 Pex24p domain-containing protein Low 7.2 1 496-520 LYDSLFKRRRLTRKVLKYANPTLNS plas(12),nucl(6),mito(3),cyto(3),cyto_mito(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8C9 Proline dehydrogenase Low 8 1 88-107 TTTNNTKNIRRNDKNPTVTS mito(11.5),nucl(9),cyto_mito(6.5),plas(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9B9 Uncharacterized protein Low 9.5 1 313-337 KPKSNTRTTRSSPTHRKQSAKSSKI nucl(15.5),cyto_nucl(10.5),mito(6),cyto(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9G3 Conserved oligomeric Golgi complex subunit 5 Low 9.8 1 304-323 LLTEYTKQRKPKSSTPRELY nucl(20),cyto_nucl(14.5),cyto(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9U2 Uncharacterized protein Low 9.5 1 77-105 LAKIEAKKRRGKGAPKKTKKGDVKGKGKK mito(12),cyto(7),nucl(4),extr(4) KIEAKKRRGKGAPKKTKKGDVKGKGKK (79-105, prob:0.999) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WC69 Flavoprotein domain-containing protein Low 9.6 1 412-432 ATKFFTRKSVKKNCNNNNSNA nucl(17.5),cyto_nucl(13),cyto(7.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCZ6 Protein kinase domain-containing protein Low 7.8 1 680-699 MILKKFPWKIPKLRDNSFKL cyto_nucl(12),nucl(10.5),cyto(10.5),mito(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WD22 Uncharacterized protein Low 8.1 1 773-796 DVSLSKIKSFKKPNKDVLMPKSSL nucl(11.5),cyto_nucl(11.5),cyto(10.5),mito(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WG50 Uncharacterized protein Low 9.5 1 312-334 LTGVNQSKKKENNNNNNNNNHDN nucl(16),cyto_nucl(10.5),mito(4),cyto(3),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W340 SPX domain-containing protein Low 5.3 1 81-112 LFNRNFARKFKNTFFKKKTKSKHSTSFNEHVE plas(21),E.R.(2),nucl(1),cyto(1),cyto_nucl(1),pero(1),golg(1),cyto_pero(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3Z1 Uncharacterized protein Low 7.9 1 81-107 VWDLISKVKYHKKNQMKKAKRTSSLLQ nucl(14),mito_nucl(13.833),mito(12.5),cyto_nucl(7.833) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4T5 Uncharacterized protein Low 8 2 145-164, 581-610 LIFKPSWKWRNRKTGNMEGG, LGKRGWYYRGRCRKRECWRHKPQVWKRVLW plas(17),nucl(3),mito(2),cyto_nucl(2),vacu(1),golg(1),E.R.(1),pero(1),cyto(1),cyto_pero(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5A7 Uncharacterized protein Low 9.3 1 708-727 ANDRSKKASKVSGKNRLPSH nucl(15),cyto_nucl(10),mito(7),cyto(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7M4 Uncharacterized protein Low 6.2 1 205-225 FFFNNNKKRNNKMQSTRHSNI mito(8),plas(7),E.R.(4),nucl(3),pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAF3 KRE9 domain-containing protein Low 5 1 250-270 YDPSKRLSLTTRKINLRKRAV extr(14),plas(8),E.R.(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WB66 Uncharacterized protein Low 7.5 1 573-594 LVDTWKKEKEKYKRALESPYSD cyto_nucl(10.333),nucl(10),cyto(8.5),cyto_mito(7.166),mito(4.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WB96 AP complex subunit beta Low 9.6 1 1-21 MPPLDKRIKKFLKNSIRIAPK nucl(15.5),cyto_nucl(9.5),mito(6),cyto(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBV4 acidPPc domain-containing protein Low 5 1 23-49 DTRWNPKIGIRNLKRWNPKRNDILHYG plas(14),mito(8),E.R.(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WBV5 Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase Low 5 1 19-38 TTTTTTKKNETKPFERPPID plas(18),mito(3),E.R.(3),cyto(1),pero(1),golg(1),cyto_pero(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WC11 Altered inheritance of mitochondria protein 24, mitochondrial Low 6.8 1 427-448 SSNPLKEKAKQGFQNKKKINMN mito(16),nucl(5.5),cyto_nucl(5),cyto(3.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WC44 AB hydrolase-1 domain-containing protein Low 8.2 1 371-390 ERDFVKFKDKRTRKTISSKL nucl(14),mito_nucl(11.833),cyto_nucl(8.833),mito(8.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDD9 Uncharacterized protein Low 8.1 1 513-534 TDTWQQKRDEYKKQGKTLHNSF mito(11),nucl(8),cyto(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WF69 Phospholipid-transporting ATPase Low 5.8 1 1249-1272 HFQNAIRKVRQVQRMKKQRGFAFS plas(18),mito(3),nucl(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGN6 Uncharacterized protein Low 8 1 300-324 RNLNNRSSNKNLRRRRRRLTMDDMI plas(14),E.R.(8),golg(3) RRRRR (312-316, prob:0.688) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WHG0 RNB domain-containing protein Low 8.3 1 15-36 SSSRSMFRSKLNKSKSNKYVSL mito_nucl(11.166),nucl(11),mito(11) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7RTF3 Glycogen [starch] synthase Low 7 1 570-595 DYMEEFCKKTRRQRINQRNRTERLSD cyto(15.5),cyto_nucl(12),nucl(7.5),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7SBQ0 Uncharacterized protein Low 9 1 920-941 VYHKDIKNIKTKKRKTVVEEDT nucl(15.5),cyto_nucl(11.833),cyto(5),cyto_mito(3.499),pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3B7 High osmolarity signaling protein SHO1 Low 5.3 1 3-24 IPDRAQAKAQRTRNRINHSFNG plas(21),golg(2),nucl(1),mito(1),cyto(1),cyto_nucl(1),E.R.(1),cyto_mito(1),mito_nucl(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3S9 26S proteasome regulatory subunit RPN2 Low 9.4 1 800-839 LSTTARAKARAKKTKKDKDEDKNRKTKKESQEEKSRKEDE cyto(11.5),cyto_nucl(8.5),nucl(4.5),E.R.(4),pero(2),vacu(2) RAKARAKKTKKDKDEDKNRKTKKESQE (805-831, prob:0.983) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W549 Uncharacterized protein Low 9.7 1 113-133 KDDSESKYKEQQQQQQQQQQQ nucl(18),cyto_nucl(13.5),cyto(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5M2 SPX domain-containing protein Low 5.4 1 53-75 GSSSRFGKKLKNKLFHNNKSTIT plas(23),nucl(1),pero(1),golg(1),vacu(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6W4 Uncharacterized protein Low 9.7 1 743-762 NVPILRRKYRFQTLKQEWLF nucl(18.5),cyto_nucl(12),cyto(4.5),mito(1),golg(1),cysk(1),vacu(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCK6 Uncharacterized protein Low 5.4 1 38-62 YQATPKGQKKSSKYDPENPHKHKLG plas(23),nucl(1),pero(1),golg(1),vacu(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCL1 tRNA-binding domain-containing protein Low 9.8 1 325-344 LKQLNPKKKLWEKLQPLFST cyto(13),cyto_nucl(11.666),nucl(9),cyto_mito(8.666),mito_nucl(6.666) AAKDKPAKEAKGPRGKPDEETLKKLREEAKAKKAAKKA (158-195, prob:0.976) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEP8 Palmitoyltransferase Low 5.8 1 602-624 TNSEFNKYVKDKKRRQDDLHSTI plas(18),nucl(2),E.R.(2),golg(2),vacu(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WES5 Uncharacterized protein Low 8.5 1 867-886 NARCSSSSMHQKKRVSNFEN nucl(14),cyto_nucl(12.5),cyto(9),mito(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WF37 WD_REPEATS_REGION domain-containing protein Low 9.8 1 326-348 GLLAIRTKKKEKKISTNKKGLTV mito(12),cyto_nucl(6.5),nucl(6),cyto(5),pero(3) KKKEKKIS (333-340, prob:0.762) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W329 FHA domain-containing protein Low 9.1 1 515-538 KGGRTGLRSCRKTHKQYFWKKPTK nucl(15.5),cyto_nucl(11.5),cyto(6.5),mito(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4C2 Opy2 domain-containing protein Low 7.6 1 102-121 FLYKRYWEPRWRENKRKTFA nucl(8.5),cyto_nucl(7.5),cyto(5.5),E.R.(5),mito(2),extr(2),vacu(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6C2 SAM_MT_RSMB_NOP domain-containing protein Low 8.9 1 1-23 MGRSKNFKRGGRNNNRSNRNWSE nucl(12),cyto(5.5),cyto_mito(5.5),mito(4.5),plas(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6E4 ATPase GET3 Low 7.8 1 279-300 QEHNCKRCQARWKMQKKYLDQI cyto_nucl(15),cyto(13),nucl(11) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6H0 Uncharacterized protein Low 7 2 20-44, 435-456 ISLPSFTLHRKWKNKHDPTNIPYSQ, EFDSQYKRDKNKMKYDKSSDIG golg(9),E.R.(7),extr(4),pero(3),vacu(2),cyto_pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6Q6 CHCH domain-containing protein Low 8.7 1 106-127 AYRECKKQWLMARRNNRSQWQK nucl(17),mito_nucl(11.999),cyto_nucl(11.833),mito(5.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W729 Adenylyltransferase and sulfurtransferase NDAI0B05570 Low 5.8 1 276-297 GQSMRTFKMRRRQKNCACCSNE plas(11),cyto(6.5),cyto_nucl(5),nucl(2.5),pero(2),E.R.(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W8B6 Carboxypeptidase Low 5 1 78-98 LQYFTKPKFPQKINKKSHWDF extr(22),vacu(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WC93 Uncharacterized protein Low 5.8 1 555-577 NQPYCKFLSRDKRYAQRRRDYIH plas(9),E.R.(8),mito(5),nucl(2),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDH0 Ribonuclease H Low 8.6 1 42-66 TVSTRSKSTKKSGNKRNHVHHLNST nucl(16),mito_nucl(11.833),cyto_nucl(10.333),mito(6.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEP9 Exonuclease 1 Low 9.5 1 365-395 ISREIKLKEKYGKERERKRNTKKATTNIFIG mito(15),cyto_nucl(6.5),cyto(6),nucl(5) EIKLKEKYGKERERKRNTKK (368-387, prob:0.906) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W5M1 Ubiquitinyl hydrolase 1 Low 9.8 1 1211-1233 GINAARKKLRLLKKVYNRSSPSL nucl(19.5),cyto_nucl(14),cyto(7.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7J8 UBX domain-containing protein Low 8.3 1 1-27 MGQQSKTDSTRYKKKRRTITQIMPIIT nucl(10),E.R.(5),mito(4.5),pero(4),cyto_mito(4),cyto(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W814 Palmitoyltransferase PFA4 Low 5 1 73-103 DFNDQRKWNTHCKKCNNYKPERSHHCKTCNQ plas(13),E.R.(7),mito(2),golg(2),cyto(1),extr(1),pero(1),mito_nucl(1),cyto_pero(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9D6 Uncharacterized protein Low 5 1 2-22 SEPIPPTPKTKKPFYRYFKFL E.R.(8),golg(7),extr(5),vacu(3),mito(2),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9H0 Nucleolar protein SWM2 Low 8.8 1 41-65 AISKDNKLRRLAKKKCKNYFERWVS cyto(12),nucl(10),mito(2),cysk(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDU9 Uncharacterized protein Low 8 1 149-176 MLPYTIYKKFKAKKRMKMRQIIRNCYAL plas(27) KFKAKKRMK (157-165, prob:0.738) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WE72 DNA-directed RNA polymerase Low 7.7 1 116-138 VLNSRLMKRKIDKPNKNPYLPNF mito(15),nucl(8.5),cyto_nucl(6),cyto(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGA1 Uncharacterized protein Low 6.9 1 126-147 DLFKYIWPRNNKKLNKSHHCVN mito(12.5),cyto_mito(8),nucl(6),plas(3),cyto(2.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGE4 Uncharacterized protein Low 7.1 1 24-46 ILSTSEKEKQKHNKNQDNNNGGT plas(13),nucl(6),golg(2),vacu(2),cyto_mito(1),E.R.(1),pero(1),cyto(1),mito(1),cyto_pero(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) J7REJ4 GPI-anchored wall transfer protein Low 8 1 345-371 TLSTSITNKKKRNPQRNKLKAWDRFTS plas(14),mito(7),E.R.(4) KKR (354-356, prob:0.619) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W360 Tr-type G domain-containing protein Low 8.9 1 365-384 RTFSYKSRNKINNPKKPQEN nucl(16),cyto_nucl(10.833),mito(5.5),cyto_mito(5.166),cyto(3.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W628 V-SNARE coiled-coil homology domain-containing protein Low 8.7 1 193-212 SHNFKKKAARIKERMWWQRM nucl(14.5),cyto_nucl(10.333),cyto(5),cyto_mito(3.833),pero(2),E.R.(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6P7 Phosphoinositide 5-phosphatase Low 7.8 1 951-972 PTEPQMQRKKPILRPPPPPAAK nucl(9.5),cyto_nucl(8),cyto(5.5),E.R.(4),mito(3),pero(2),vacu(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W897 Uncharacterized protein Low 9.9 1 766-787 IKQGEEKKKKKVQSILNSLLKT nucl(18.5),cyto_nucl(12),cyto(4.5),mito(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WA44 alpha-1,2-Mannosidase Low 5 1 698-722 GDVHCNSLKTRRKWRVEKIHVGDYD E.R.(9),golg(9),extr(8) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAS9 Uncharacterized protein Low 8.4 1 780-799 SPSLLRKTNKFENKNRHDQE nucl(13),cyto_nucl(11),mito(7),cyto(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WB28 WD_REPEATS_REGION domain-containing protein Low 7.8 1 377-399 LRFVHRGGSRRNPQQHGKRNTVA nucl(11.5),mito_nucl(10),mito(7.5),cyto(4),pero(4),cyto_pero(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WDM4 AB hydrolase-1 domain-containing protein Low 5.9 1 12-36 IKTSITKLIKRDRKLQTPQTSPQIF mito(21),nucl(2.5),cyto_nucl(2.5),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3J0 H(+)-transporting two-sector ATPase Low 6.8 1 395-414 QIVKKKTKSYQHQRHGGKQE cyto(15),cyto_nucl(13),nucl(7),pero(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3L9 Uncharacterized protein Low 9.5 1 77-103 LVTAAVQSVRRNRKRSRNRSSSTSSNS nucl(16.5),cyto_nucl(12),cyto(6.5),mito(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6V2 KR domain-containing protein Low 7.6 1 302-327 FCKFQIKNWFKKEQAKKDLDNKKKEQ nucl(9),cyto_nucl(8),cyto(5),pero(5),mito(3),extr(2),E.R.(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7H4 Uncharacterized protein Low 8.9 1 76-95 RSPSLKSSSVHNRNKPQSHN nucl(15),mito_nucl(12.5),mito(8),cyto(3) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W7W5 Fatty acid hydroxylase domain-containing protein Low 8.6 1 301-324 INKYHYFLKNRKSLKNKSKEEIEI nucl(11.5),cyto_nucl(7),E.R.(4),golg(4),mito(2),pero(2),cyto(1.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W945 Uncharacterized protein Low 6.6 1 75-95 YLKYLTKKYLKKNQLRDWIRF mito(13),cyto(8.5),cyto_nucl(7.5),nucl(5.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAU4 AMP-binding domain-containing protein Low 7 1 674-694 TSAQKLKRKKILDAVKRQVDQ cyto(18),nucl(5),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WCB9 Uncharacterized protein Low 7.1 1 93-120 IERQRSKIIKQTEKKRWRDSRRFIFTLG plas(13),nucl(6),E.R.(2),golg(2),cyto_mito(1),vacu(1),pero(1),cyto(1),mito(1),cyto_pero(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WE99 Uncharacterized protein Low 7.9 1 2023-2043 SNYTWEQKKKLSKTDIKIHGS plas(14),nucl(8),E.R.(2),mito(1),cyto(1),golg(1),cyto_mito(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFB7 Outer spore wall protein 5 Low 5.7 1 169-193 LEPEPTSTRNKKQQRVTPNRRDFEF E.R.(10),golg(6),cyto(3),extr(3),nucl(2),vacu(2),cyto_pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFP6 Triacylglycerol lipase Low 5 1 1-27 MSLKRYNTPPARNLKRRHSYTIRGIKI plas(7),mito(6),golg(6),extr(2),E.R.(2),vacu(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFQ1 Uncharacterized protein Low 5 1 175-200 NYSHFQPNNNYKKNKNKNSRHQEDFP plas(11),mito(9),E.R.(5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WH30 Uncharacterized protein Low 8.4 1 698-719 EEGFNKFSKKWKDKTEWLPEIL nucl(11),cyto_nucl(8.5),cyto(4),pero(4),mito(3),E.R.(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WI28 F-actin-capping protein subunit alpha Low 8.2 1 240-259 LNEKQFKSLRRRLPITRSKV cyto_nucl(14),nucl(12.5),cyto(12.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W399 Glutamine synthetase Low 6 1 34-53 GTGHLRSKGRSLKKKITSVE cyto(10.5),cyto_nucl(8.333),cysk(8),cyto_pero(7.666),nucl(4),pero(3.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W3B1 Arf-GAP domain-containing protein Low 9.8 1 118-137 SSVAKRYKDHLDKKVRKDMT nucl(20),cyto_nucl(14.5),cyto(7) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W439 Uncharacterized protein Low 8 1 1530-1549 KSFKSLKRTKSAKSAKSAKS plas(25) KSVKSFKSLKRTKSAKSAKSAK (1527-1548, prob:0.844) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4K0 Ribosomal_S17_N domain-containing protein Low 8.8 1 19-43 IFSNPKFKTSKRTKRWYKNAGLGFK nucl(14.5),cyto_nucl(11),cyto(6.5),mito(6) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4M7 Uncharacterized protein Low 7 1 465-488 SDNSNERKKVVKRRLGLDKPKDVY plas(18),nucl(5),vacu(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W800 Uncharacterized protein Low 8.7 1 57-83 TNDGNNDKKNQPPHRKFKLPNPNVTED nucl(12),cyto_nucl(8.5),cyto(3),plas(3),mito(2),E.R.(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W893 Uncharacterized protein Low 6.8 1 384-409 PVKWDESHKRLRIKNVKDKENRNLLL cyto(12.5),cyto_nucl(10),nucl(6.5),mito(4),pero(2),vacu(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAJ9 Uncharacterized protein Low 7 2 8-29, 603-626 WEESINKNKNKNENANKSNNSN, RSTLSDNKFNKKKKPVNEEDMPEK plas(23),mito(1),cyto(1),golg(1),vacu(1),cyto_mito(1) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WB51 DNA-directed RNA polymerase subunit beta Low 8.5 1 1-26 MVSATKKRKTTSKAHKHTHEHEKDET nucl(12),cyto_nucl(9.5),cyto(5),mito(4),plas(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WE57 Uncharacterized protein Low 9.4 1 9-30 FNNWLLHRKIARRTERPNFCFD nucl(16.5),cyto_nucl(11.5),cyto(5.5),mito(2),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W4F0 Ribosomal_L16 domain-containing protein Low 9.2 1 38-66 RRFKHEYAPRYKDQKKKQKGRVPVRVGGS mito(22),nucl(3) KDQKKKQKGR (49-58, prob:0.765) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W6S5 Uncharacterized protein Low 9.2 1 17-37 GGSTGDKQPKQQQNIKKMRST plas(18),mito(4),nucl(3) KKKW (77-80, prob:0.645) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9G1 Uncharacterized protein Low 9.7 1 35-54 LSNKNEQQQQQQQQQQQPQQ nucl(17),cyto_nucl(12),cyto(5),pero(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0W9P0 Abhydro_lipase domain-containing protein Low 7 2 2-22, 69-93 VRMTKMPIKLFKKTSRRIVSS, RENNNTTKQKKNVIRNNNNNKFKED E.R.(6),golg(5),plas(4),extr(4),mito(3),pero(2),vacu(2),mito_nucl(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WAI8 Uncharacterized protein Low 8.9 1 44-70 MSNAKRESTSRSRPTSRRNSTNNIIRE nucl(13.5),mito(9),cyto_nucl(9),cyto(3.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WES1 RNA polymerase II transcription factor B 38 kDa subunit Low 9.8 1 93-115 AQCPYKRCDKILRKNKFKTQIFD nucl(12),mito(9),cyto(4) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WEV0 Cytochrome b5 heme-binding domain-containing protein Low 8.9 1 67-89 DDDKNNNKKKIRNKVRLKPGHSA cyto(13),cyto_nucl(9),mito(6),pero(4),nucl(3) KKKIRNKVRL (74-83, prob:0.723) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WF71 Uncharacterized protein Low 8.9 1 27-48 ISSPSLTRTRRKLLRNNRETSW nucl(13.5),cyto_nucl(9),cyto(3.5),mito(3),plas(2),pero(2),golg(2) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WFG3 Glycogen [starch] synthase Low 7.3 1 569-595 VDCMEEFCKKTRRQRINQRNRTERLSD cyto(15.5),cyto_nucl(12.5),nucl(8.5) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGD9 DNA helicase Low 9.7 1 885-904 KDESSHSKKKNKTTITYDKY nucl(20.5),cyto_nucl(14.333),cyto(5),cyto_mito(3.999) UP000000689 Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) G0WGF3 Kinesin-like protein Low 9.9 1 158-183 VLNSMYSQRRNNRHRRSTLNNPPHSN nucl(18.5),cyto_nucl(11.5),mito(4),cyto(3.5)