ProteomeAccession ScentificName ProteinAccession ProteinName Category ConfidenceScore #NoLS Positions SegmentSeqs PSORT NLS UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PDG3 SCF ubiquitin ligase complex subunit Low 9.9 1 535-556 KQPPGKSSQRRGQQQQQQLQKS nucl(19),cyto_nucl(13.5),cyto(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PNB4 Dopey_N domain-containing protein Low 9.9 1 3-25 SLLSKTKLSPKDKKYSQSVEKTL nucl(18),cyto_nucl(13.5),cyto(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQ34 Mdl2p Low 5.4 1 97-116 EFQKQENKKTFKQNLRTIGR plas(11),E.R.(5),mito(4),pero(4),nucl(1),cyto(1),cyto_nucl(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PS91 FG-nucleoporin Low 9.9 1 420-440 TTRIMKAKSRHTKLSRRLLRL nucl(18.5),cyto_nucl(13.5),cyto(5.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTL7 Potassium transport protein Low 9.2 1 531-558 NTSDGRKIRKKAPKRKTPRTQRNASFNQ plas(19),nucl(3),mito(2),cyto_nucl(2) RKIRKKAPKRKTPR (536-549, prob:0.973) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59PA1 Fre10p Low 5 1 116-140 ADPDFKKKKLYYKPVLLKKKKVEAA plas(14),E.R.(7),extr(2),mito(1),pero(1),golg(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59SC0 Uncharacterized protein Low 9.3 1 156-178 VNGEWPQSKNKKKKKISHALSIG mito(19),nucl(4),cyto(4),cyto_nucl(4) KNKKKKK (164-170, prob:0.775) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59UF7 Aspartyl-tRNA synthetase Low 9.9 1 50-69 LSKKALKKLLKEKEKAAKKA cyto(16.5),cyto_nucl(12.833),nucl(8),mito_nucl(4.833) KKALKKLLKEKEKAAKKAEREAQLAKEK (52-79, prob:0.964) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A5Q6 Transcriptional regulatory protein ASH1 Low 8.9 1 387-414 LCNSCGLRYKKTKARCLNDKCKKIPAKG nucl(15.5),cyto_nucl(12.5),mito(7),cyto(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A937 Mitochondrial 37S ribosomal protein RSM27 Low 9.4 1 83-102 VFIVADRKRRNKGAPKKKKQ mito(19.5),mito_nucl(13),nucl(5.5) RKRRNKGAPKKKKQ (89-102, prob:0.988) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AFB3 Tyrosine--tRNA ligase Low 9.5 1 349-379 AQKNGYPVEKPKQEKKKKVKKIGTRYPGTVS cyto(19),cyto_nucl(13.833),nucl(6.5),mito_nucl(4.166) KPKQEKKKKVKKI (358-370, prob:0.935) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PDA9 Rho family guanine nucleotide exchange factor Low 8.4 1 1-23 MSHQPNKKSLRRKPPPIDDSTPF nucl(17),cyto_nucl(12.333),mito_nucl(11.499),mito(4.5),cyto(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PHG9 GRIP domain-containing protein Low 9.3 1 1-20 MGKNKKKQNNSSSKKATKED nucl(18),cyto_nucl(13.333),cyto(6.5),cyto_pero(4.166) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJH3 Dolichol kinase Low 8 1 1-22 MAGRKRKNESKKPNPTARSTAA plas(23),pero(2),E.R.(2) KRKNESK (5-11, prob:0.656) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQZ7 Uncharacterized protein Low 5 1 512-536 LLAKGYYVWQNKRRNKVWKAMTEEE plas(24),mito(1),pero(1),golg(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59LX5 Transcriptional regulator of yeast form adherence 2 Low 9.2 1 31-51 CRHGEKCSKKHLKPISSRTIL nucl(15),cyto_nucl(11),mito(5),cyto(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59ZH5 Uncharacterized protein Low 6.1 1 59-79 TQRSWIRSKLEKRRHYAKPIE cyto(21.5),cyto_nucl(13.5),nucl(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A7K3 Exocyst complex component Sec6 Low 9.5 1 505-524 GYLIKESKAKRLFRKKPPVV nucl(19),cyto_nucl(15.5),cyto(8) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PDD9 Protein kinase domain-containing protein Low 9.3 1 726-749 TELRNSNTLRPRPRPTKKPTSGLA nucl(16.5),cyto_nucl(12.5),cyto(5.5),mito(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PF18 Peroxin/Ferlin domain-containing protein Low 6.5 1 367-391 RDGFSRYTRSRKWTRRATLIIDKRE plas(15),nucl(4),mito(4),mito_nucl(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PGA7 Fe2OG dioxygenase domain-containing protein Low 8.2 1 12-31 LSMPPKKKSSKTIYKFPQSF mito(13),nucl(10.5),cyto_nucl(7),cyto(2.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PH47 Uncharacterized protein Low 5 1 218-246 FPNFTKLLNYKKIKQKQDKTRFDNAKIKH plas(12),mito(10),E.R.(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PIM2 ATP-binding cassette transporter Low 9.9 1 1323-1352 IKPTIEHKNQDTKKKNKKDNKKDNGNGDSG plas(16),nucl(5),E.R.(2),golg(2),vacu(2) KKKNKKDNK (1335-1343, prob:0.75) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PN00 RNA polymerase II transcription factor B 38 kDa subunit Low 8.9 1 53-75 APCPYPKCGKILRKNKFKQQIFE nucl(18),cyto_nucl(14.333),cyto(8.5),cyto_pero(5.166) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PPK8 Uncharacterized protein Low 5 1 184-204 IGNKVDRRVLKRNRKIRIGSE plas(13),mito(6),E.R.(3),cyto_mito(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PRC7 Uncharacterized protein Low 7.2 1 580-606 SSSSAQPKEKESRTKKVKNNEQDKDDD mito(9),nucl(6),plas(5),pero(3),cyto(2),E.R.(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PDP9 SPX domain-containing inorganic phosphate transporter Low 6.9 1 102-122 IIKHRLTKNIISKFKRNNNTN plas(17),nucl(5),E.R.(2),pero(1),golg(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PF79 Glutamate decarboxylase Low 6.8 1 542-568 VAEVKEEKHKKDNHQGSKNKKSYRGTC cyto(14.5),cyto_nucl(12),nucl(6.5),mito(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PFC1 Putative alanine--tRNA ligase Low 6.4 1 36-59 EFIPPPTAKDKQNKNNNKKKDVAV cyto(10.5),mito(9),cyto_nucl(8),nucl(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PGU6 Uncharacterized protein Low 9.1 1 23-48 DNTNTTCEYKLPKKKQNKSILKLDVI nucl(14.5),cyto_nucl(9.5),mito(4),cyto(3.5),golg(2),cysk(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PIJ1 Bac_luciferase domain-containing protein Low 5 1 1-23 MTISPNKRQKRDSSSPKKHLILN cyto_mito(13.5),mito(12.5),cyto(11.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJ68 Uncharacterized protein Low 5 1 41-66 PPSPCGGKKCPPPKPCTTRIPQTHTT extr(22),cyto(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQK6 Calcium-transporting ATPase Low 5 1 894-916 AVDEIRKWLRRRKTVYTNNYSYG plas(24),golg(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PT33 Inositol phosphosphingolipid phospholipase Low 5 1 26-46 NTWGLKFISKHRKERLRAIAD plas(23),E.R.(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q96VB9 Heat shock protein homolog SSE1 Low 5.9 1 644-663 RYLAKEQEKKEQYRQKQEAA cyto(20),cyto_nucl(13.833),mito_nucl(3.832),nucl(3.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PFL0 Uncharacterized protein Low 7.9 1 1075-1101 KYCQNDKDKLRTYFKKHPKTMKFVMTE mito(13.5),mito_nucl(12.5),nucl(10.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PH79 Tpo5p Low 5 1 647-670 ILDNKLPPIKNKKRTNDYQPLEDH plas(25) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PPC1 Dolichol phosphate-mannose biosynthesis regulatory protein Low 8.5 1 65-85 TFVGKVLIKNQQKQKSKKKAQ extr(7),cyto(6.5),cyto_nucl(4.5),mito(4),E.R.(4),plas(2),nucl(1.5) KKK (81-83, prob:0.623) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQB4 Dipeptidyl peptidase 3 Low 7 1 648-672 YSRFRDAVLKQKKPRKMVIQANTFF cyto(10),cyto_nucl(9.5),nucl(7),mito(3),E.R.(2),golg(2),vacu(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PSQ3 Type I HSP40 co-chaperone Low 5.8 1 191-210 DPKDRCKKCNGKKTESERKI cyto(22),cyto_nucl(13.5),nucl(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PT49 Serine/threonine protein kinase Low 8.6 1 372-392 VKEFKRKPNESEKKYNRRLTS nucl(16.5),cyto_nucl(12.833),mito_nucl(9.666),cyto(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PT91 Uncharacterized protein Low 8.8 1 11-37 HQHNQPHHPHHHHHHHHHRQHHHHYDD nucl(13.5),cyto_nucl(10),mito(9),cyto(3.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) O74201 Ubiquitin-conjugating enzyme E2 2 Low 9.7 1 1-20 MSTPARRRLMRDFKRMQQDP nucl(23),cyto_nucl(13.333),mito_nucl(12.333) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59KQ1 Glycerol kinase Low 5 1 604-627 KLSDENRRKAWKRWEKAVDRAKGW extr(9),mito(6),cyto(6),cyto_mito(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59MQ0 Myosin-5 Low 9 1 2-21 AIVKRGGRTKTKQQQVPAKS nucl(15.5),cyto_nucl(10.333),cyto_mito(4.833),mito(4.5),cyto(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A2C5 Uncharacterized protein Low 9.9 1 242-261 SPNKYSKLSKRKESKYQSPN nucl(18.5),cyto_nucl(12),cyto(4.5),mito(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A647 Sec63 complex subunit Low 9.5 1 247-268 QGGDNDSSKSKKKKKNNKAKKN cyto(13.5),cyto_nucl(12),nucl(5.5),E.R.(5) KSKKKKKNNKAKKN (255-268, prob:0.989) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ABC6 CBK1 kinase activator protein MOB2 Low 8.6 1 8-27 RGLGRGSKKNKKDLEPSNNA nucl(13.5),cyto_nucl(11),mito(7),cyto(5.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AH29 Glutaredoxin domain-containing protein Low 8.9 1 3-32 YFQTEKTTETRQQRQQKKRPVRNSIICTLS nucl(15),cyto_nucl(11),mito(7),cyto(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PLT6 Mitochondrial 54S ribosomal protein YmL22 Low 9.2 1 219-238 GSDGKWRKRLDPKGRGRMGI mito(23),nucl(3) RKRLDPKGR (225-233, prob:0.645) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59L25 Altered inheritance of mitochondria protein 24, mitochondrial Low 8.6 1 220-243 ISKKLSRSLKKDKKSKTNTNKLET mito(21),nucl(2),cyto(2),cyto_nucl(2),pero(2),cyto_pero(2) SKKLSRSLKKDKKSK (221-235, prob:0.806) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A5A0 Thioredoxin peroxidase Low 8.2 1 1-20 MRDKKQTKKKKSFFFATHTT mito(14),nucl(8),cyto(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A872 Histidine protein kinase SLN1 Low 9.9 1 741-771 TNNVTKQNMKIRKKKKTNKNLHNNNNNNKND E.R.(7),extr(6),nucl(5),mito(3),cyto(2),pero(2),cyto_pero(2) KIRKKKK (750-756, prob:0.794) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A900 Ribosomal 40S subunit protein S2 Low 8 1 5-24 APKRQFGDRRRGGRRGGRRD cyto(11),mito(6),cyto_pero(6),plas(5) RQFGDRRRGGRRGGRRDGE (8-26, prob:0.943) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AA42 Uncharacterized protein Low 9.9 1 210-234 TDTYDKQTSQPTKEKKKDKISFMMY nucl(20.5),cyto_nucl(13.333),cyto(5),cyto_pero(3.333) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ADL4 Pre-mRNA-splicing factor SLU7 Low 9.7 1 327-350 YENGKWGYKCCKQFDKNSRCTATD nucl(18.5),cyto_nucl(12.333),cyto(5),cyto_pero(3.333) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PCX6 Phosphatidylinositol 4-phosphate-binding protein Low 9.4 1 7-26 LDKINPKLLRRIYRACRPTN nucl(14.5),cyto_nucl(9.5),mito(9) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PEQ0 Uncharacterized protein Low 9.4 1 243-268 PNYYERKSPTRFRRNITRKLSSFRRS nucl(16.5),cyto_nucl(13.5),cyto(7.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PEV4 Ribosomal 60S subunit protein L42A Low 8.8 1 2-31 VNVPKTRKTYCKGKECRKHTQHKVTQYKAG nucl(11),cyto(9),mito_nucl(9) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PEV8 Glycerophosphocholine acyltransferase 1 Low 5 1 31-54 LHLNEMKTKTKQKLHTKNLELDKL plas(18),E.R.(4),pero(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PFH0 2,5-diamino-6-(5-phospho-D-ribosylamino)pyrimidin-4(3H)-one reductase Low 7.4 1 137-156 TTTTTTTKKKKKNSESSPVS cyto_nucl(10),nucl(9),cyto(9),extr(3),mito(2),pero(2),E.R.(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQW2 Uncharacterized protein Low 9.8 1 83-105 ESRPTIMTLKKKKKSRTSIWGIS mito(6),cyto_nucl(6),nucl(5.5),cyto(5.5),golg(5),plas(3) KKKK (93-96, prob:0.649) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PSK8 Uncharacterized protein Low 7.2 1 202-228 PKEPNSRKKFFSNKKKCEKFTFKKGVT mito(9),cyto(8),nucl(6),pero(1),E.R.(1),golg(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ABP8 Protein ROT1 Low 5 1 204-227 GSVSHKIKRSRMRIKRSLENQYRT extr(8),golg(7),E.R.(6),plas(3),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AFB9 Nan1p Low 9.1 1 132-152 IVTGRKEKKKGTPHTRYINYF nucl(14.5),cyto_nucl(9.5),mito(4),cyto(3.5),extr(2),E.R.(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJY0 DUF2235 domain-containing protein Low 9.4 1 510-529 NLTVKKIKNDWTPRFWKKVP nucl(12),plas(7),mito(2.5),cyto_mito(2.5),pero(2),cyto(1.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PPV5 Coatomer subunit beta' Low 8 1 840-863 AIELWKQTLHKKNKSKVANRLIDD nucl(11),cyto_nucl(10.5),cyto(8),pero(3),mito(2),vacu(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQ93 Uncharacterized protein Low 7.9 1 58-81 NFERFFKLDKKARKEQQQQKGTIN plas(15),nucl(8),cyto(1),pero(1),E.R.(1),golg(1),cyto_pero(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59LP6 Altered inheritance of mitochondria protein 11 Low 6.7 1 14-33 DASPEYKQRRKIQMIRFFTA mito(11),cyto(6.5),cyto_nucl(6.5),nucl(5.5),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59MG4 Uncharacterized protein Low 9.7 1 443-468 GSPLKSQTSSHKRRKSSPSIPFQEQQ nucl(24),cyto_nucl(13.833),mito_nucl(12.833) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A5B3 Translation initiation factor 2 Low 9.8 1 132-162 PLSQSAPRKRIQPKKIKKTVKKLVKIQLPPF mito(12.5),cyto_mito(10.166),cyto_nucl(8.333),nucl(8),cyto(6.5) PRKRIQPKKIKKTVKK (138-153, prob:0.941) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ABA1 Na(+)-exporting P-type ATPase Low 5 1 271-290 LIRRVDKSNDRKPQKREYGQ plas(25) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ANH1 Uncharacterized protein Low 8.8 1 280-303 EWQNLNKLFKRRRRIVRKLEESWV plas(13),mito(5),E.R.(4),nucl(2),vacu(2) RRRR (290-293, prob:0.636) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PFB4 Uncharacterized protein Low 9.6 1 106-129 DEDDDHHKKKKRPHRHGGKSDDDD cyto(13),nucl(4),mito(4),mito_nucl(4) HKKKKRPHRHGGK (112-124, prob:0.939) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59SD2 HTH araC/xylS-type domain-containing protein Low 9.4 1 62-81 GYRTCKRCKPEKSSGWNKSR nucl(16),cyto_nucl(11),mito(5),cyto(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A3K4 Uncharacterized protein Low 5.8 1 384-406 ATNFKKLHKHISFKKNKSTAKSF extr(8),E.R.(6),mito(4),pero(4),nucl(2),golg(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A6S0 Mitochondrial 54S ribosomal protein YmL40 Low 8.7 1 15-35 NKYPENLRKHFQKNKEITNLP nucl(18),mito_nucl(12.499),cyto_nucl(12.333),mito(5.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A6S7 Ribosome-recycling factor, mitochondrial Low 6.8 1 34-58 FHSSSQCLAKRKNKKSSNKNDEELD mito(18),nucl(5.5),cyto_nucl(4.5),cyto(2.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ACY2 Histone acetyltransferase Low 8.5 1 7-29 TNIIKASPKRKTKTDTKDQDNSY mito(12),nucl(11.5),cyto_nucl(9) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ALU8 Dolichyl-diphosphooligosaccharide--protein glycotransferase Low 5 1 730-751 ESSSGTSKRNRSIKRPKLEVRE plas(21),E.R.(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ANG9 DNA topoisomerase Low 7.3 1 19-41 ILGGGRKKVRNSREKFIKNYDFT mito(11),nucl(8),cyto(8),cyto_nucl(8) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PDR3 Uncharacterized protein Low 8 1 329-351 GSSHGSSAGPCKKRRRRRRRSNY extr(17),cyto(4.5),mito(4),cyto_nucl(3.5) KKRRRRRRRS (340-349, prob:0.97) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PH11 Dck1p Low 9.7 2 15-36, 136-158 IKPFLPNDKHPNLKNKNFKNLY, NEFIKKSVPPRPTKRDHSRDTLL plas(9),nucl(8.5),cyto_nucl(6),cyto(2.5),mito(2),pero(2),E.R.(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PHU0 Mitochondrial 54S ribosomal protein MRPL50 Low 7.2 1 18-40 LNSIRNYRPGRPKKTVSKYVQVQ mito(11.5),mito_nucl(11.333),nucl(10),cyto_nucl(7.833),cyto(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PII5 Protein disulfide isomerase Low 5 1 699-721 VLRLGRRSSRRWLFKRPSSSTPS extr(8),golg(7),E.R.(5),vacu(3),cyto(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJQ4 MFS domain-containing protein Low 5 1 612-639 IRHWADKRIEKEQSKRDQKNLERLKLKN plas(24),E.R.(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PK78 Uncharacterized protein Low 5.8 1 538-574 HLYGYKVQKLRQRQKIRDLKSKQQQQQQQHQQNRDAS plas(11),mito(9),E.R.(3),nucl(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PL57 ATPase_2 domain-containing protein Low 9.8 1 600-627 LEEINRKDSRKWWKKRMQKYDRLFLPDD nucl(15),mito(8),cyto_nucl(8) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PN62 Pseudouridine synthase Low 9.1 1 42-69 KIRSDLSRDRKWKPQKIEKKIASTKVKI cyto(13.5),cyto_nucl(11.499),cyto_mito(11.332),mito_nucl(7.165),mito(6.5),nucl(6) RKWKPQKIEKK (51-61, prob:0.719) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PPS7 Uncharacterized protein Low 9.7 1 1-20 MRFRRLPKKSEIKKVYLPST nucl(18),cyto_nucl(12),mito(4),cyto(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A6M7 Uncharacterized protein Low 9.9 1 1-26 MSSPTNRLNIRKRKKVYSNESNSSRQ nucl(16.5),cyto_nucl(10.5),mito(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A756 SnoRNA-binding rRNA-processing protein Low 7.3 1 314-333 DEIKRGITKRTKRLKDKGLD nucl(6),cyto(4),extr(4),E.R.(4),golg(4),mito_nucl(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PES5 Uncharacterized protein Low 8 1 211-244 SNNNKVISSKNRKKKFLSKKKLKFGKWKEISKMF plas(6),E.R.(6),mito(4),extr(3),pero(3),mito_nucl(3) SKNRKKKFLSKKKLKFGKWKE (219-239, prob:0.975) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PFY1 Uncharacterized protein Low 9.6 1 19-50 DNVSKSSKTRPTINPHRRGRLLHKTNNYLPNE nucl(15.5),mito(9),cyto_nucl(9) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PHB8 Lem3p Low 6.4 1 39-64 DESFVDKKEKSRRPKENSFTQQRLKA plas(17),nucl(4),vacu(2),mito(1),cyto(1),E.R.(1),golg(1),cyto_mito(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PHZ0 Uncharacterized protein Low 7.7 1 4-24 QYSPAKSSKVSKRPSSKSPIM nucl(11.5),mito_nucl(10.166),cyto_nucl(7.833),mito(7.5),pero(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PK98 Putative serine/threonine protein kinase Low 9 1 118-141 RGPSLRRFFKKFKPRDHHDKSSSS nucl(16.5),cyto_nucl(12.333),cyto(7),cyto_mito(5.833) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PNX4 Protein disulfide isomerase Low 5.8 1 272-299 IEGPLSKKEKKYYYKYRTGKKKIEHDEL extr(10),E.R.(6),golg(4),nucl(2),pero(2),vacu(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59RB8 Isocitrate lyase Low 6.6 1 19-46 VAEIKKWWSEPRWRKTKRIYSAEDIAKK cyto(10.5),pero(10),cyto_nucl(8.5),nucl(5.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59YG2 Uncharacterized protein Low 7 2 108-127, 131-151 YYTKIYPKHHHQHHHHEHGQ, EENHHHHHHHHHNKRKSRGND plas(17),mito(6),E.R.(3),cyto_mito(3),mito_nucl(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AM72 Patatin-like phospholipase domain-containing protein CaO19.1504 Low 9 1 236-259 YLFTWRGERKRLRNKLRNSKTYEE nucl(15.5),cyto_nucl(9.833),cyto_mito(3.833),mito(3.5),cyto(3),pero(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PER8 ER oxidoreductin Low 5 1 475-497 DQTNTPKNQQQKQPQETDKKRLT E.R.(9),golg(7),extr(4),pero(4),cyto(1),plas(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PF60 VanZ domain-containing protein Low 5 1 112-134 YVTWSKNRARHKRSSYRQLNTHI plas(8),E.R.(8),extr(4),mito(3),cyto(1),pero(1),golg(1),vacu(1),cyto_pero(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PK68 Uncharacterized protein Low 5 1 446-467 IFQNKILKKKFKFRVLKKQLDM plas(17),mito(5),E.R.(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PK82 Uncharacterized protein Low 9.8 1 346-373 NEGGVRTNTNKQLKKKKVSFNHIVNTRE nucl(19),cyto_nucl(14),cyto(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PMY7 F-box domain-containing protein Low 9.1 1 33-60 TKNGTLYDYRRKRSRHQRHSNLNDLTKG nucl(15.5),cyto_nucl(13.5),cyto(8.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PPY5 RNA exonuclease Low 8.5 1 43-65 ILEQRRLRELRKEKIRQQKEALG nucl(17),cyto_nucl(11.333),mito_nucl(11.333),mito(4.5),cyto(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PRH3 Ume1p Low 9.8 1 13-32 QDMTKEKKMDYKTNNFRKTI nucl(13),cyto(6),mito(5),pero(1),golg(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PT87 Uncharacterized protein Low 5 1 376-395 SKLRTKNSFRLKPPHHQPPS plas(12),mito(8),E.R.(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PT95 RING-type E3 ubiquitin transferase Low 9.9 1 400-426 EDYQRIFKKPQSPRRSPKKLKCGHILH plas(7),E.R.(7),nucl(5),mito(2),cyto(2),vacu(2),cyto_mito(2) PRRSPK (412-417, prob:0.653) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59ZY9 Cytoplasmic tRNA 2-thiolation protein 2 Low 7.5 1 34-55 NCYIRFIRGKLRKQMHDERYKV cyto(15),cyto_nucl(14.5),nucl(10) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59ZZ4 Uncharacterized protein Low 9.6 1 157-177 QPKGNPKPKIHRMKEKYTIEK nucl(16.5),cyto_nucl(11.5),cyto(5.5),golg(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A5N1 bVLRF1 domain-containing protein Low 8.6 1 332-351 MPKVEKKKETPKKIEKTTVS nucl(18),cyto_nucl(13.833),mito_nucl(9.833),cyto(8.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ALW9 Uncharacterized protein Low 8.1 1 119-143 LNYSLRTHQNRERLKKKKLCITSLN cyto_nucl(12),nucl(11.5),cyto(11.5),golg(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ANL3 Uncharacterized protein Low 5.8 1 154-174 KTPNNSVSSTRRKNRRSDLGK extr(13),cyto(3.5),cyto_nucl(3.5),E.R.(3),nucl(2.5),mito(2),golg(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PF14 SnoRNA-binding rRNA-processing protein Low 9.9 1 60-81 FETNLEKLRKKRYNRLSKVGMI nucl(18.5),cyto_nucl(11.5),cyto(3.5),mito(2),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PFB0 ATP-binding cassette long-chain fatty acid transporter Low 6.6 1 62-85 SQDEKELKKKSHKLSKESFNRLAR mito(11),cyto_nucl(5),nucl(4.5),cyto(4.5),golg(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PFB8 Cell division control protein Low 9.9 1 18-43 QLPLTPTKTPTKSKKLKIDNNNSFDT nucl(16.5),cyto_nucl(10.5),mito(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PGJ8 Uncharacterized protein Low 9.6 1 411-445 KIDLSSIKKRKFARKNTTHKRIPFKTKSNKDYDHL plas(6),E.R.(6),nucl(4),cyto(3),golg(3),mito_nucl(3) KKRKFARKNTTHKRIP (418-433, prob:0.828) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59TA8 5-formyltetrahydrofolate cyclo-ligase Low 7.7 1 1-23 MTNLPLKEVKRQLRKQLKSNLKT mito_nucl(12.333),nucl(12),mito(11.5),cyto_nucl(8.333) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59WJ4 Polyadenylation factor subunit 2 Low 9.7 1 17-37 GSNGRINKPRDPKSQDKYVAY nucl(17.5),cyto_nucl(12.5),cyto(4.5),pero(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A477 GDP-mannose transporter Low 7 2 13-35, 351-370 LYLIRKKYTTTYRQQQQHQYNMD, VYAVAKQKQQKEQSQQLPTT plas(14),E.R.(5),mito(4),golg(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A508 Uncharacterized protein Low 9.6 1 1-22 MPPKQPSRSRSRSRSRVQELIL nucl(15.5),cyto_nucl(10.5),mito(8) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AI44 Ubiquinone biosynthesis protein COQ4, mitochondrial Low 7.1 1 301-323 DLRNMRKEYFAKKKLEKQLQGGK mito(14.5),mito_nucl(11.5),nucl(7.5),cyto(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PCT7 Uncharacterized protein Low 7.5 1 86-113 KLPTFKTIPTHNKHKSPNKPKYLVPNVP nucl(7.5),E.R.(7),cyto_nucl(5.5),pero(3),golg(3),cyto(2.5),mito(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PI61 Msu1p Low 9.8 1 30-58 LYNKPSIPSSRRSRSKQKFTSKSKYDDSF nucl(12),mito(9),cyto(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PNM1 GPI-anchor transamidase subunit Low 5 1 114-138 IINRWYNNYRQQKRNTNNKKKEGVE plas(12),mito(7),E.R.(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQZ8 Uncharacterized protein Low 5 1 532-552 TKAYYVFKNKRRDKIWNAMSE plas(24),pero(1),E.R.(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PR52 GPN-loop GTPase Low 7.2 1 1-22 MRTEHRRTEKKKYKINHSLLLF mito(14),nucl(6.5),cyto_nucl(5.5),cyto(3.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PRB2 DUF2415 domain-containing protein Low 9.8 1 71-90 HTSYFNKRRKSKASAEHFNT nucl(19.5),cyto_nucl(14.5),cyto(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A8P6 Uncharacterized protein Low 6.5 1 305-327 EVSHWNAKQQKLKKDNKTSSEQN plas(19),nucl(4),golg(2),mito_nucl(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AA03 Uncharacterized protein Low 9.5 1 200-239 ENMSIHSNPRKHRRDNNNMVYNCPKPVKRFKSKSQCDLVF nucl(18.5),cyto_nucl(15.5),cyto(7.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ALV8 Protein phosphatase PP2A regulatory subunit B Low 9.5 1 371-399 GGNDKPKSVFKNNTNKRKKNGYRGRDDDD nucl(16.5),cyto_nucl(12.5),cyto(7.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AMR9 Uncharacterized protein Low 9.3 1 2-23 ITPSLKYKQAHRQNAHKDIEKI nucl(16.5),cyto_nucl(14.5),cyto(7.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PK75 WD_REPEATS_REGION domain-containing protein Low 7.2 1 114-136 SKVLKFDNKSRSKKIQNRIDAKL mito(10),cyto_nucl(9),nucl(7.5),cyto(7.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PKD5 Elongator complex protein 3 Low 5 1 38-61 NGLITRYAKKYKLKQQPRLTDIIS cysk(19),cyto(6),cyto_nucl(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PLC9 60S ribosomal protein L20 Low 8.1 1 145-164 TKDLKFPLPHRVQKSKKLFQ nucl(11.5),mito(10),cyto_nucl(10),cyto(5.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PLW0 Uncharacterized protein Low 9.9 2 10-50, 523-542 FRNQLIRSKRVQKLLKKLIPDQVKKIYKKFKKNMDMQSADE, LYTWRFIYKHLQIKKRLDDH mito(14.5),mito_nucl(13.5),nucl(11.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PNM0 Serine/threonine protein kinase Low 9.8 1 532-556 TSPNRGSPTVIKRRRSKTNSTAYRI nucl(17.5),cyto_nucl(12.5),cyto(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQN2 Protein phosphatase regulator Low 9.7 1 539-564 SSTTSQQRPRYSQRHQRSHRKDATTT nucl(18),cyto_nucl(13.5),cyto(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PRE4 Phosphoinositide phospholipase C Low 9.9 1 775-798 SSTSSFIIRRRKNKSPKIINELSN nucl(19.5),cyto_nucl(13.5),cyto(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTS8 Putative ubiquitin-protein ligase Low 9.2 1 467-492 KTPPFLRKYVTRRVSRKKKDLVNIDS plas(14),mito(5),nucl(3.5),cyto_nucl(3),cyto(1.5),E.R.(1),golg(1),cysk(1) RKLKTPPFLRKYVTRRVSRKKK (464-485, prob:0.724) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59KG7 Uncharacterized protein Low 6 1 41-64 SLLSYGNKKSKRRNQKNTTPANIT extr(17),cyto_nucl(3.5),nucl(3),mito(2),cyto(2),E.R.(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59LY1 Biofilm regulator 1 Low 9.9 1 403-422 VIHQPPPQQQQQQQQHNNIC nucl(19),cyto_nucl(13.5),cyto(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59X93 Mitochondrial 54S ribosomal protein YmL17/YmL30 Low 6.5 1 93-112 IYPRGKPDLKHNRDRRFRQY mito(22),nucl(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A594 Chitin synthase Low 5 1 114-133 ATPRAQFTSKESPKRQKTTE plas(24),cyto(1),golg(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ADP3 Transcription regulator Low 9.7 1 3-24 ATAHTIKQQQQQQQQHPPPPLN nucl(18.5),cyto_nucl(14),cyto(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ADR3 Phospholipid-transporting ATPase Low 6.6 1 1265-1290 MEQFQKAIRKVRQVQRIKKQRGFAFS plas(21),nucl(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PFC2 Uncharacterized protein Low 9.3 1 139-162 LNDSKFGKLKNKLKNQKSNKTLQS nucl(16.5),cyto_nucl(13),cyto(8.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PG18 tRNA threonylcarbamoyladenosine dehydratase Low 5.9 1 22-45 EAFHCYERKKIHPQPPKETPAKRD plas(8),nucl(3),mito(3),cyto(3),extr(3),cyto_nucl(3),E.R.(3),cyto_mito(3),mito_nucl(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PM13 Uncharacterized protein Low 7.6 1 144-164 SLTFQKKKKTISQYLNKRQIE mito(8),nucl(7),plas(4),cyto_nucl(4),E.R.(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PRU0 Uncharacterized protein Low 8 1 104-129 SAPRHLARISRRKRMKPIKKYSYIYE extr(12),mito(7),cyto(6.5),cyto_nucl(4.5) ARISRRKRMKPIK (110-122, prob:0.866) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PSM6 Protein-transporting protein Low 6.6 1 634-654 ALRGSDLKKKKSSKDEVEEES mito(6),nucl(4),cyto(4),cyto_nucl(4),E.R.(4),pero(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59YE8 ERF-3 Low 9 1 652-681 IELKHKLEKGTNRKSKKPPAFAKKGMKIIA cyto(16),cyto_nucl(11.333),mito(6.5),mito_nucl(6.166),nucl(4.5) HKLEKGTNRKSKKPPAFAKKG (656-676, prob:0.925) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJ04 Serine/threonine protein kinase Low 9.9 1 10-31 LDPKSNRKIINHRYKIIKKIGQ nucl(18.5),cyto_nucl(13),cyto(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJN3 Phospholipid-transporting ATPase Low 7.6 2 183-202, 1390-1409 GPWRRFKKACSRGTARVFKF, ERTFKSIKRRTTISRSKKGT plas(23),nucl(1.5),cyto_nucl(1.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PM20 Acetyltransf_6 domain-containing protein Low 6.2 1 445-465 SSSSLSQKPKHQNKKNMNTAF plas(23),nucl(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AB86 2-isopropylmalate synthase Low 6.5 1 19-43 YKNMLRDPSKKYSPPKQINLPNRTW mito(14),cyto(5),nucl(4),cyto_pero(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AKX2 Fumarate reductase Low 5 1 542-567 AAAPPPPPQKKAPKQPKPFSVPDKEF cyto(10),extr(9),cyto_nucl(8),mito(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PFN3 Uncharacterized protein Low 5 1 236-256 IYSHSQKKTRINRLLREQRSR mito(11),plas(9),E.R.(4),golg(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PG78 Uncharacterized protein Low 8.3 1 137-168 FVPIKEIPQRRPKKYRPRKKYVRPAPPPQPQK E.R.(10),golg(7),pero(3),plas(2),cyto_pero(2),cyto_mito(1),vacu(1),cyto_nucl(1),extr(1),cyto(1),mito(1),nucl(1),mito_nucl(1) QRRPKKYRPRKKYVRPAPPP (145-164, prob:0.973) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PMV9 Threonyl-tRNA synthetase Low 9.8 1 5-31 ADKVKDLSLKDKKKKPTNPLYLDPQPE nucl(13),cyto(9),mito(2),pero(1),golg(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PRL9 Zcf38p Low 6.4 1 42-66 ECTYTLKTSQLKKRKLTKEFASKSP mito(10.5),cyto_mito(6),golg(5),nucl(4),plas(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A2C3 Ubiquitin-binding TORC1 subunit Low 9.5 1 1043-1065 EPGSKEYVKRLWRRNRNESIIQE nucl(13),plas(6),cyto(4),mito(2),golg(2),cyto_pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AEG1 Uncharacterized protein Low 9.4 1 39-58 LTNGSPKKIKSYKRLELERL nucl(16),cyto_nucl(11.5),cyto(5),mito(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AGV4 Eukaryotic translation initiation factor 3 subunit B Low 6.8 1 697-718 LEEWRKYRAKHISKQGNSKNEV cyto(16.5),cyto_nucl(12),nucl(6.5),vacu(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PIL7 Mitochondrial group I intron splicing factor CCM1 Low 9.8 2 36-70, 928-947 IDPLTIRKHQQQQQQQQQRRNQRKKPSEEFETKST, LLMALKKYRKAKPYNDEEAE nucl(13.5),mito_nucl(11.166),cyto_nucl(10.833),mito(7.5),cyto(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJ53 Uncharacterized protein Low 5.4 1 50-69 KLQQQHKKFIQQKQNIHQSN extr(7),golg(5),mito(4),pero(4),E.R.(4),nucl(1),cyto(1),cyto_nucl(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PRC1 Sng4p Low 5.8 1 530-553 STQRAKKIALAEKQKKKEQQQVDK plas(19),E.R.(5),nucl(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PRG7 B30.2/SPRY domain-containing protein Low 9.7 1 645-676 TTIGSSSNNKSNQKKKKKKNGKKGGKKKGKKK cyto_nucl(6.5),extr(6),nucl(5.5),E.R.(5),cyto(4.5),pero(2),golg(2) NQKKKKKKNGKKGGKKKGKKK (656-676, prob:1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PRR7 Biotin carboxylase Low 5 1 2155-2174 TDARRFFFWRLRRRLNEEYV mito(22.5),cyto_mito(13),cyto(2.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTJ3 Uncharacterized protein Low 9.1 1 160-186 QDIYKNRLMFHQKKKYNQQRAVKIQEE nucl(14.5),cyto_nucl(10),mito(6),cyto(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PUA3 Uncharacterized protein Low 5 1 29-54 ISSVRNRSATRMKKNSRPNLKRLGSV plas(25) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59P53 Translation factor GUF1, mitochondrial Low 7.3 1 614-639 ADISRYKKLLERQKEGKKQMKLSGRV mito(12),cyto(8),nucl(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59UR2 Alpha-1,6-mannosyltransferase Low 9.4 1 315-335 EMEHYKALSKKLHKRWWKFWE nucl(12),mito(6),cyto(5),pero(1),E.R.(1),golg(1),cysk(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A441 J domain-containing protein Low 9.1 1 424-446 MAEAQAKKSSKKQKSMNNKELEE nucl(15.5),cyto_nucl(13),cyto(9.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AH35 Mitochondrial 54S ribosomal protein MRP49 Low 8.1 1 7-26 ITSKNKYNKKIENAIKKINK mito(12),nucl(10.5),cyto_nucl(7.5),cyto(3.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AKU3 CAP1-binding-protein Low 9.6 1 526-547 SSNTPPKLPPRNGIKRKHFSLT nucl(16.5),cyto_nucl(12),cyto(4.5),pero(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AL54 MFS domain-containing protein Low 5 1 136-158 VKNSSILKRRKTKEDRIRLGDKH plas(18),mito(5),E.R.(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q8TGH6 Guanosine-diphosphatase Low 5 1 115-135 LDTTKNSKPNQQQQQNTQKGA extr(20),golg(4),E.R.(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PDY7 Serine/threonine protein kinase Low 9.2 1 10-33 QQSQSPQQPQQQQQQQQQQQPQQP nucl(17),cyto_nucl(14),cyto(9) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PKH6 Uncharacterized protein Low 7.3 1 689-716 PVNSCTYKFNLTKRKRHNKEALDEIQKD mito(15.5),mito_nucl(12.5),nucl(8.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PKI9 Uncharacterized protein Low 9.2 1 253-273 DEITKKDKKLEQLKVENQRLL nucl(16),cyto_nucl(12),cyto(6),mito(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PMB1 Amino-acid permease GAP5 Low 5 1 100-123 RININSSKSNLKRKLKNRHLQMIA plas(27) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQH0 General transcription and DNA repair factor IIH helicase subunit XPD Low 8.5 1 680-700 LADRRFARKKNQLPKWIAQAL nucl(12),cyto_nucl(9.5),cysk(8),cyto(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PRT5 1,3-beta-D-glucan-UDP glucosyltransferase Low 8.4 1 1553-1582 KPGNQIRPRILSKRQKRRRRFQANLYLLIF plas(22),E.R.(2),nucl(1),mito(1),pero(1),mito_nucl(1) RPRILSKRQKRRRR (1559-1572, prob:0.878) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) G1UBC2 Cell wall adhesin EAP1 Low 5 1 49-68 DDYKKGYKSKTYSKVKPITS cyto(10.5),extr(10),cyto_nucl(6),mito(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) P25997 Elongation factor 3 Low 9.6 1 1009-1046 NKIAAAKKKKKLSSAELRKKKKERMKKKKELGDAYVSS cyto(19.5),cyto_nucl(13.5),nucl(6.5) AAAKKKKKLSSAELRKKKKERMKKKK (1012-1037, prob:0.999) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59TS3 Bta1p Low 6.9 1 50-72 FIKPLIQKKTKGPNKNQQQSLES nucl(5.5),cyto_nucl(5.5),extr(5),E.R.(5),cyto(4.5),pero(2),golg(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A388 Type 2C protein phosphatase Low 7.3 1 44-67 EPNTMIKTASPKKNQQQYRKSVAL mito(7.5),nucl(7),cyto_mito(7),cyto(5.5),pero(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PEK3 Fth1p Low 7 2 39-58, 378-401 TFNGNTKKSNRDTRNQTYNS, LIPISWQLKRIQKRKNLYQPLDAP mito(13),plas(12) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PGZ0 Phosphoprotein phosphatase Low 5 1 105-127 GSSWSKKQYLNYKKIKHDKYEEY E.R.(9),golg(7),extr(5),cyto(2),vacu(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PMC4 Fgr6-10p Low 9 1 111-133 GNKLRIAKKLKFPKNQSSWKPDL nucl(16.5),cyto_nucl(14),cyto(10.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PMF3 Uncharacterized protein Low 7.5 1 69-90 LHFLSHQKKKKRDYYFCRHLLS mito(13.5),mito_nucl(12.833),nucl(11),cyto_nucl(6.833) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PRM8 ABM domain-containing protein Low 7.7 1 1-22 MSQPQKQKLIPHQNQNNQKLSF mito(17),nucl(7),cyto(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PSG5 Isoleucyl-tRNA synthetase Low 6.2 1 934-959 PVSIRIQHSSKCKCPRCWKYTSESPD mito(19),cyto(4),nucl(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTV1 U6 snRNA-associated Sm-like protein LSm1 Low 8.7 1 134-155 LKEQQAKKIREQKVKTKQLLQK nucl(13.5),cyto_nucl(12.5),cyto(10.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59T87 Uncharacterized protein Low 8.7 1 1-23 MVKNTSYKKQKLSSRNRIINQEV nucl(13),mito(10),cyto_nucl(9),cyto(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AGX2 Uncharacterized protein Low 8 1 1-22 MNIGRRIRPRKLHLRLYSQVKV nucl(14.5),mito_nucl(11.666),cyto_nucl(10.333),mito(7.5),cyto(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AGX6 Ribonuclease Low 7.3 1 404-426 VFAMIDKKKDNSKLKRNYFCSSS nucl(8.5),cyto_nucl(7.333),cyto_mito(5.333),cyto(5),mito(4.5),extr(3),vacu(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PGY3 Protein LST4 Low 9.3 1 936-959 TNNTYKTKIKKIYTPTKNNGNKEL nucl(14.5),cyto_nucl(9),plas(6),cyto(2.5),mito(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PIN9 Phosducin domain-containing protein Low 8.9 1 227-250 EQARKLRFAKKSIRDGNRNNEKDK nucl(16.5),cyto_nucl(12.833),cyto(8),cyto_pero(4.833) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJ45 Putative flavin adenine dinucleotide transporter Low 8 1 704-740 EDKNKKLAEKWKSKISRKLSKKKSLKDKNNNTPTTTN plas(15),E.R.(8),mito(2) NKKLAEKWKSKISRKLSKKKSLK (707-729, prob:0.966) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PM93 Enhancer of mRNA-decapping protein 3 Low 8.6 1 60-86 KVIQLPPDFKQQQKKKQKPRNGELIDD nucl(14.5),cyto_nucl(13),cyto(6.5),mito(2),extr(1),pero(1),E.R.(1),golg(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PPF8 Uncharacterized protein Low 9.6 1 305-331 ARFHCVFPKRQCRHKSGKFNRPYDFKK nucl(19),cyto_nucl(14.5),cyto(8) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTK2 RRM domain-containing protein Low 8.7 1 661-682 QKSNSNKDSKQQQQHNHHNNLS nucl(13),cyto_nucl(10.5),mito(6),cyto(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59QN4 Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase Low 8 1 191-216 YFAWGHLKSRKKKRYTEIMNKRNVRQ plas(18),E.R.(7) RKKK (200-203, prob:0.65) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A1C1 Uncharacterized protein Low 8 1 520-548 LKNFTVASDEKKRRRRRSDAEEKERGSNY plas(24),E.R.(2) KKRRRRRS (530-537, prob:0.856) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AKW5 Uncharacterized protein Low 7.7 1 178-198 GFTSKTIKSNQEKKERKEKHT nucl(9),cyto_nucl(8.5),cyto(6),pero(6),mito(2),golg(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PGJ1 Tlg2p Low 9.4 1 43-65 SSTTGNQSNRKSKNKSNLKQGVN nucl(17.5),cyto_nucl(12.333),cyto(4),cyto_mito(3.499),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PGQ5 Ubiquitin-like domain-containing protein Low 8.3 1 107-131 TTTNATIKKTKKKSRCAFHNCNSAP nucl(11.5),cyto_nucl(9.5),mito(7),cyto(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PL65 Tok1p Low 8.4 1 504-526 TKEEYRDLKWKKKKLQEDQEDQL plas(18),E.R.(5),nucl(1),mito(1),golg(1),vacu(1),mito_nucl(1) RRKVKSRHK (396-404, prob:0.701) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PLH5 ABC1 domain-containing protein Low 5.7 1 97-116 YYGYRETKKKHPSWIIRTFY mito(11),plas(9),E.R.(3),nucl(2),cyto(2),cyto_nucl(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PNP6 Nucleoporin Low 8.3 1 17-36 SDVLSRRKILKPKGRLGSNT nucl(11.5),cyto_nucl(10),cyto(7.5),mito(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PPQ1 Tif3p Low 8.7 1 376-399 RSSGNRKDVKKDEQQNQPPKPQKS nucl(16.5),cyto_nucl(11.833),cyto(6),cyto_mito(5.833),mito(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PRX4 Fth2p Low 5 1 470-497 PLVPLKWQLKRIQKRIRLYELRKNHEQE mito(15),plas(7),E.R.(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59SM3 Origin recognition complex subunit 5 Low 8.8 1 342-366 LHKYSKVKVVKYKKRQSTKATSVTK nucl(15),cyto_nucl(14.5),cyto(10) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A6N8 Oligosaccharide translocation protein RFT1 Low 5 1 538-560 VMERKNSKKPFEKVTNKFMKPKL plas(10),mito(8),E.R.(6),golg(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ADX5 mRNA cap guanine-N7 methyltransferase Low 9.7 1 73-97 TTTRDSRLDRLKRVRQKSAEREDVG nucl(18),cyto_nucl(13.5),cyto(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AL46 Cysteinyl-tRNA synthetase Low 8.7 2 20-44, 748-773 TSAAKKPTVKQPQWYQPENKNNSKP, GEEISKSMKKKLTKQYQQQEKLYKEY mito(17.5),cyto_mito(11),nucl(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PF08 Ribosomal 60S subunit protein L2A Low 8 1 181-202 KAGRAFHKYKVKRNSWPKTRGV mito(13),nucl(8),cyto(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PHA3 Ubiquinol--cytochrome-c reductase catalytic subunit Low 8 1 264-288 LSIWVKRFKWTPIKNRKFRFDPPKK mito(10),cyto(6),plas(4),extr(3),cyto_nucl(3),E.R.(3),cyto_pero(3) KNRKFRFDPPKK (277-288, prob:0.697) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PM72 Uncharacterized protein Low 5 1 93-112 YYSRYFKKPVSPPPPPQQQQ plas(9),mito(8),E.R.(5),mito_nucl(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PS46 Oligopeptide transporter Low 5 1 703-722 GWWIKKKWFHWWSKYNYSLS plas(26) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PU57 Uncharacterized protein Low 8.7 1 281-303 IPVIIHKKKKKTITYDLDKPDKT nucl(12),cyto_nucl(8.5),mito(6),cyto(3),extr(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59S59 ATP-dependent RNA helicase MRH4, mitochondrial Low 8.9 1 15-42 RPLVRFKSIKSPKSPKPKPTAKLSPNVF mito(23),nucl(2.5),cyto_nucl(2.5) KSPKSPKPKP (24-33, prob:0.719) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59V66 Uncharacterized protein Low 9.4 1 7-29 SPQTPPPKTKLPRIPNAPQSPTK nucl(16.5),cyto_nucl(10.833),cyto(4),cyto_mito(3.833),mito(2.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A962 rRNA (Cytosine-C5-)-methyltransferase Low 7.7 1 1-23 MIIKDRTEKKNTYKKKYPIIFFG mito(10),cyto(9),nucl(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ABB3 3-methyl-2-oxobutanoate hydroxymethyltransferase Low 5 1 272-293 VKQYTKDVKSKKFPNPDTHGYK mito(23),cyto(2.5),cyto_nucl(2.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ACV9 Cell surface superoxide dismutase [Cu-Zn] 6 Low 5 1 14-33 SIAASDKSPKIKKNPRNVVA E.R.(7),golg(5),cyto(3),plas(3),extr(3),pero(3),cyto_pero(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AIB8 Ribosomal 60S subunit protein L10 Low 7.7 1 1-30 MARRPARCYRYCKNKPYPKSRYNRAVPDAK mito(15),nucl(7),cyto(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5APE9 N2227 domain-containing protein Low 6.1 1 107-126 QNDRRRKLFQRMSYKQQKAC E.R.(7),cyto(4.5),cyto_nucl(4.5),mito(4),extr(4),nucl(3.5),pero(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PDF2 Syg1p Low 8.9 2 19-44, 217-243 YVDYKEGKKLIKKCKKLQEEYAFEDT, PSLPSLRFLKKWKTKNKRDNQFQDEIS plas(16),nucl(5),golg(3),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PFK5 Chitin synthase Low 5 1 1146-1181 DSSKIAMKRWREWERERRSTENRKQQQQQQLTNNSS plas(25) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PH53 Cyclin-dependent protein kinase-activating kinase Low 9.1 1 282-301 NENLHFKKFNLQKYPRKDWD nucl(15.5),cyto_nucl(13),cyto(9.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PH98 Myo-inositol transporter Low 8 1 531-554 VKQAAQLSKERKKHSKFAKSKPTV plas(26) ERKKHSKFAKSK (540-551, prob:0.767) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PHT9 Acyl-CoA desaturase Low 6.1 1 36-65 MNQATKMKRTKINEMKKQKQDFFKRINYSH plas(14),E.R.(5),nucl(3),mito(2),pero(1),golg(1),vacu(1),cyto_mito(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A4X7 Ribose-phosphate diphosphokinase Low 6.6 1 90-109 PQFPYSKQSKMKKHRGAITA cyto(17),cyto_nucl(15.333),nucl(7.5),mito_nucl(5.998) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AI66 Uncharacterized protein Low 7 2 94-115, 188-208 MYSRLKIRLKWLLKKSNRPFNT, ISFRKCFVSRRPKRVEKFIKG mito(11),plas(8),mito_nucl(8) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AJ65 Calcium-transporting ATPase Low 5 1 1173-1197 IVGFGWLKFRKNKKTKDNEEDDEMD plas(21),E.R.(2),golg(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PG14 Ethanolamine-phosphate cytidylyltransferase Low 6.2 1 341-367 LANKQAYEERQKRKGWKAEIEKKLQQS cyto(18.5),cyto_nucl(13),nucl(4.5),cysk(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJC5 PlsC domain-containing protein Low 5.4 1 286-312 YVKIRSVSRIPTKRKKLEKYLEHLWIH plas(15),mito(5),E.R.(4),nucl(1),golg(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJD6 Rhomboid protease Low 8 1 302-327 VGIAYGYWYNRKRKQQIRRRRHTLDF plas(20),mito(5) KRKQQIRRR (313-321, prob:0.648) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQA8 Uncharacterized protein Low 9.8 1 111-134 GNKLRIAKKLKFPKNQSSRKPDLF nucl(19.5),cyto_nucl(14),cyto(7.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQE9 PH domain-containing protein Low 9.8 1 148-170 IEEENKRFRKRLKRFAKKSTGGA mito(17),nucl(5.5),cyto_nucl(5),cyto(3.5) KRFRKRLKRFAKKSTGGAIRASRSKIK (155-181, prob:0.972) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PS06 Uncharacterized protein Low 8.1 1 173-198 ISCQQIVTSRHNKKCKERIRAIEFLD mito(11),nucl(10.5),cyto_nucl(8.5),cyto(3.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59N79 DUF1713 domain-containing protein Low 9.6 1 98-130 ALSVLRKRRLKMKKHKYKKRRKAQRALRKRLGK mito(18),mito_nucl(13.666),cyto_mito(10.166),nucl(8) RKRRLKMKKHKYKKRRKAQRALRKRLGK (103-130, prob:1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A1M6 Ccw14p Low 8 1 210-271 SDNPKPHKVQHVKRIKKFPKKVSKNANESKMSPSTLNQKIKPNRNNLKKLHKKKFKVNRKSI plas(10),E.R.(6),pero(4),mito(2),cyto(2),cyto_mito(2) PHKVQHVKRIKKFPKKVSKNANESKMSPSTLNQKIKPNRNNLKKLHKKKFKVNRKSI (215-271, prob:0.98) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A843 Uncharacterized protein Low 7.1 1 2-21 ANKISTIRYKRQIRPLLSKI mito(15.5),mito_nucl(13.332),nucl(9.5),cyto_nucl(7.833) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ADL9 Defective in cullin neddylation protein 1 Low 9.6 1 39-59 NYYNKHPNKAQVTKKPVKVKI nucl(12),mito(9),cyto(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AFB7 Dynamin-related GTPase Low 5 1 769-797 LLKMRYQFVKNSKKCKKKESKYQCPEIFL mito(16.5),cyto_mito(13.333),mito_nucl(10.166),cyto(8) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AN98 Hgt5p Low 8.4 1 654-689 YATSPTKRVKIRGLRTKRKDKGKRSGEKYKAKYNPL plas(22),golg(2),nucl(1),pero(1),vacu(1) KRVKIRGLRTKRKDKGKRSGEKYKA (660-684, prob:0.989) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q873N2 GPI-anchored wall transfer protein 1 Low 5.4 1 331-353 ITISKIRISKKQHKKESSSFFSV plas(14),mito(8),golg(2),nucl(1),pero(1),E.R.(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PDL5 1,3-beta-D-glucan-UDP glucosyltransferase Low 5 1 1510-1541 LKPSRQFSRPIINRSQRRKRNWRIIKYFILFL plas(22),E.R.(2),golg(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PE53 Smi1p Low 9 1 591-610 ETKEESKKDTKEKSNDETKE nucl(16),cyto_nucl(13),cyto(6),mito(1),pero(1),E.R.(1),golg(1),cysk(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJ01 Plasma membrane ATPase Low 5 1 859-879 FDNFCNGRKPQQHTDKRSLED plas(25) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJV5 Uncharacterized protein Low 8.3 1 390-410 DEENRHREQQQQQQQHQHQEE nucl(10.5),plas(9),cyto_nucl(8),cyto(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQQ9 Mitochondrial 54S ribosomal protein YmL6 Low 6.2 1 225-248 EFNSLNKKEKPKYLQKLKGKVLTK mito(22),nucl(3.5),cyto_nucl(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PRA1 Mitochondrial 54S ribosomal protein YmL49 Low 5.8 1 121-148 EITKEPRYQVTRKKQRCRTTKTTQVEPF mito(24),nucl(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59X91 WD_REPEATS_REGION domain-containing protein Low 6.6 1 25-51 INSILGSKQRKKFWSKRNETKPTNILT extr(11),nucl(4.5),mito(4),cyto_nucl(4),plas(3),cyto(2.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A109 Ubiquitin-ribosomal 40S subunit protein S31 fusion protein Low 9.2 1 113-149 LRLRGGGKKRKKKVYTTPKKIKHKHRKHKLAVLTYYK mito(21.5),mito_nucl(13.833),nucl(5) LRGGGKKRKKKVYTTPKKIKHKHRKHK (115-141, prob:0.995) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ANI2 Uncharacterized protein Low 5 1 265-289 PYITLKSRMHIKRKKLNIDNQQQDE extr(10),cyto(6.5),cyto_nucl(4),vacu(4),E.R.(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PEK8 Uncharacterized protein Low 5 1 702-726 PSEYESKVLNKKKRRANFEKELLKE plas(15),E.R.(9),mito(1),pero(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PL39 Ribonuclease P Low 9.4 1 6-27 KTVTNKSNKRIQGKRHIKHSPN nucl(12),mito(10),cyto(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PNV5 SMP-LTD domain-containing protein Low 8.2 2 149-173, 897-922 NSPNPKSYSHHQRHDPQPQHNHQSQ, QPNSPIRTKTLTRKPPPPKSPLLHAH extr(11),nucl(3),cyto(3),cyto_nucl(3),E.R.(3),golg(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PPW3 Uncharacterized protein Low 6.6 1 4-23 TTTRSGTKSKPVKRNSYLSN mito(16),nucl(4.5),cyto_nucl(4),cyto(2.5),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59Z52 O-acyltransferase Low 6.2 1 98-123 VDVSKREKIFLKRKRQIDNKHGSDKS plas(22),nucl(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A5N6 UDP-N-acetylglucosamine transferase subunit ALG14 Low 5 1 30-52 PSLRLPTSVKKKKKLIQECQLSI plas(14),mito(5),E.R.(3),mito_nucl(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PGN2 MFS domain-containing protein Low 5 1 44-69 PPSKNINDPLRWSKRKRRIQFFLLFI plas(25) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PLX3 Putative RNA methyltransferase Low 7.9 1 38-63 PFPLNDKERKQAKKQSQLPWYKRWTN mito(12),nucl(8),cyto(2),pero(2),golg(2),cyto_pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQG5 Sac7p Low 8.6 1 384-406 EEVNTKSKKKSKSYKKLTNDIHE nucl(12),cyto_nucl(9),mito(5),cyto(4),extr(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTJ9 Hgt14p Low 5 1 28-54 EQISSPTKSEPKKKSWFKMKNLFEKVE plas(25) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59U61 Putative carboxylic ester hydrolase Low 8.5 1 34-56 TTSNLINKFKPKKTSKGTDNELP nucl(13),cyto_nucl(11.5),mito(7),cyto(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A0J0 UPF0507 protein C2_02840C_A Low 9.7 1 225-246 NYQFRVLRYKNRKKLSHIKLEF nucl(16.5),cyto_nucl(11),cyto(4.5),pero(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ABF8 Uncharacterized protein Low 9.8 1 1240-1260 LIARGKRNYVCQRLNQRAKLA nucl(13),mito(11),cyto(1),golg(1),cysk(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AI21 Translocation protein SEC62 Low 9 1 232-260 QPVYAWEEPKKKKGKKKKEPKLEVVEEKV plas(14),E.R.(6),nucl(3),mito(3),mito_nucl(3) PKKKKGKKKKEPK (240-252, prob:0.991) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PG89 Ubiquitin carboxyl-terminal hydrolase Low 9.4 1 643-662 KEVKEKKSWVGNLKRRNTET nucl(16.5),cyto_nucl(13.5),cyto(7.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PIY8 FLO9p Low 5 1 844-868 SSTETKYTKSKKTKTHKTKTFETEL extr(24),E.R.(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PKV4 Fumarate hydratase Low 5 1 475-494 FDQWVRPRKHDWTKRLSFVD mito(17.5),cyto_mito(12.5),cyto(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PKV6 FG-nucleoporin Low 8.5 1 829-850 DVLSNCSKLKLRQKLRQKSIMF cyto_nucl(15.5),nucl(15),cyto(12) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PLB6 Phosphatidylinositol-3-phosphate-binding protein Low 9.5 1 1-22 MIKTFRKSKRSSSNSSSPKKTI nucl(16.5),cyto_nucl(11),mito(5),cyto(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQW4 DUF3844 domain-containing protein Low 5 1 19-39 LAESDSKHKHQQRRHDSNVYL extr(17),E.R.(4),golg(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTV8 Uncharacterized protein Low 8.3 1 5-24 FYFNRFQKLKTHNNRYQYFK nucl(11),mito(11),mito_nucl(11) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PU28 Phosphatidylinositol-3-phosphate-binding ubiquitin-protein ligase Low 9.5 1 28-50 RPYNIFFNRRHHCRKCGKVVCGD nucl(17.5),cyto_nucl(14.5),cyto(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AH90 Rho family guanine nucleotide exchange factor Low 9.7 1 1191-1214 EPVNPFDKSNKNKNKRLEIQEINF nucl(18.5),cyto_nucl(14),cyto(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PP06 Signal recognition particle receptor subunit alpha Low 7.6 1 135-155 SSTPKKIEPKQPTNSKKMRKW cyto_nucl(13.333),nucl(11.5),cyto(11),mito_nucl(8.332) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PT53 Putative ATP-dependent permease Low 5 1 116-141 SLGDGNSKRPVRKKKQCACKSGWSGI plas(12),E.R.(7),golg(2),vacu(2),cyto_mito(1),pero(1),extr(1),cyto(1),mito(1),cyto_pero(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59SS7 Origin recognition complex subunit 3 Low 9.9 1 52-71 VYCRVTSQPKQPQKNTTPFL nucl(19.5),cyto_nucl(13.5),cyto(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A679 Oxidant-induced cell-cycle arrest protein 5 Low 9.6 1 100-119 IGRHHSPKSQHRRSHSNTRY nucl(16.5),cyto_nucl(12),cyto(4.5),mito(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AED0 Glyco_hydro_63 domain-containing protein Low 8.2 1 897-921 ASNRVPRTPQTPKNRRRQSVFLHAS nucl(12.5),cyto_nucl(12),cyto(10.5),mito(1),pero(1),golg(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AED6 Pre-mRNA-splicing factor CLF1 Low 9.7 1 43-62 SYQQTKRKEFEQHINKNRLN nucl(22),mito_nucl(12.833),cyto_nucl(12.333) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ANF1 F-box domain-containing protein Low 9.1 1 1-27 MNSKSQPSIYPKRYKKTKTNMLFQLPP nucl(14.5),cyto_nucl(10.5),mito(7),cyto(3.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PIQ1 Fgr6-4p Low 9.2 1 111-134 GNKLRIAKKLKFPKNQSSRKPDLF nucl(16.5),cyto_nucl(13.5),cyto(9.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PKC2 Oleate-activated transcription factor Low 9.6 1 6-39 KVSRNKPSLSCTNCRKRKTKCDRKQPCSACVKKI nucl(22),mito_nucl(13.833),cyto_nucl(11.833) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PM71 Fgr10p Low 6.6 1 11-31 AGKHDPNKSKKYKTLLRNALS cyto(9.5),cyto_nucl(9.333),cyto_mito(9.166),mito(7.5),nucl(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PPB6 Ubiquitin ligase complex subunit Low 5.3 1 749-772 VQNILRQFRRMRNGQRRDEANNNN extr(9),pero(4),E.R.(4),plas(3),golg(2),vacu(2),cyto_mito(1),cyto_nucl(1),cyto(1),mito(1),nucl(1),mito_nucl(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PPI5 Lysine/arginine permease CAN1 Low 5 1 22-46 QPISSSISKSNKKTKHQTDFVQDSD plas(26) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PT61 Uncharacterized protein Low 8 1 31-54 DDPLIYKKRKLVRSPSKTNPLKYK plas(16),nucl(8),pero(1),E.R.(1),golg(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) P0CB54 ATPase GET3 Low 9.5 1 278-298 DENPCKRCVARWKMQKKYLDQ nucl(16.5),cyto_nucl(12.5),cyto(7.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59PS7 Uncharacterized protein Low 6.1 1 23-42 FPIGPFKKWHHNPIMKPDPN cyto(15.5),cyto_pero(10),nucl(4.5),mito_nucl(4.5),mito(3.5),pero(3.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59SG9 Probable GPI-anchored adhesin-like protein PGA55 Low 6.7 1 61-88 CYPQCFDHRGQPKKDKCCFDKHNKVLYP mito(10),cyto_nucl(7),nucl(5.5),cyto(5.5),extr(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59ZW2 Inclusion body clearance protein IML2 Low 9.1 1 660-682 KFLLRKSRHIEARKKKYPNLPTA mito(8.5),mito_nucl(6.833),E.R.(5),nucl(4),plas(4),cyto_nucl(3.833),pero(3) SRHIEARKK (666-674, prob:0.66) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AMN3 Autophagy-related protein 11 Low 8.8 1 1039-1060 GFAKRQAKDNKLKEQEHRKLVH nucl(14.5),cyto_nucl(11),cyto(6.5),mito(2),pero(1),E.R.(1),golg(1),cysk(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5APE5 Protein arginine methyltransferase NDUFAF7 Low 8.8 1 1-23 MIFKRYLFKGKPKPKFIEKTEFH nucl(17.5),cyto_nucl(11.833),mito_nucl(11.666),mito(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PCD3 NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial Low 5 1 121-146 GWDHYVQEPKKRHFRKKDYSANFYHS mito(22),mito_nucl(13.833),cyto_mito(11.833) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PN52 Ferric-chelate reductase Low 5 1 15-37 ATTTNAAKPRKYKRYGQLKSFYA plas(17),E.R.(6),mito(1),extr(1),pero(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PPA1 Uncharacterized protein Low 8 1 308-337 GSTSKVCTLKKRSLEKKEIRKLVRKSVNKV extr(27) KKRSLEKKEIRKLVRKSVNKVIARRQ (317-342, prob:0.868) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQN8 Phosphoinositide 5-phosphatase Low 7.6 1 1020-1041 SSSEKKHDTKPPIPPMKRNTTL nucl(11),cyto_nucl(10.333),cyto_mito(7.666),cyto(7.5),mito(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PSH5 ATP-dependent DNA helicase II subunit 2 Low 9 1 563-590 LQKKLDVKYKTQHKSEKKSKPFIATSKP nucl(16.5),cyto_nucl(14),cyto(10.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59UH7 ATPase synthesis protein 25, mitochondrial Low 9.5 1 161-181 SISKVTRRRLAKRVRRGPPAT mito(17),cyto(6),nucl(4) RRRLAKRVRRG (167-177, prob:0.761) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A1M5 Uncharacterized protein Low 9 1 8-34 NGLPRPYYMKPSKKKSSPYSNLKEPIV nucl(14.5),cyto_nucl(9.5),cyto(3.5),mito(3),golg(2),plas(1),pero(1),E.R.(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A884 Cytochrome c oxidase-assembly factor COX23, mitochondrial Low 8.6 1 112-137 FDAYRECRKDFFRKKRQDNRDGAKGW nucl(13.5),cyto_nucl(12),cyto(9.5),mito(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PDB2 tRNA (uracil-O(2)-)-methyltransferase Low 9 1 414-435 GINGVRKRYPPRKNMAYKTPPS nucl(15.5),cyto_nucl(11.5),cyto(4.5),pero(3),mito(2),golg(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PEK0 Uncharacterized protein Low 6.9 1 63-86 EIDFVTMKKKPKKLSESDKQQYVS nucl(6.5),cyto_nucl(5.833),E.R.(5),cyto(4),golg(4),cyto_mito(3.833),pero(3),mito(2.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PFH1 Gsg1p Low 9.5 1 638-657 RKNFERNRQVQPQPQKQERE nucl(17),cyto_nucl(11),cyto(3),pero(3),extr(1),E.R.(1),golg(1),cysk(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PI13 Serine/threonine protein kinase Low 6.6 1 411-434 DCFDHNWIKLQRKKLEKKYYSVVG extr(8),pero(6),nucl(4.5),cyto_nucl(4),E.R.(3),cyto(2.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PIF7 Mannosylinositol phosphorylceramide synthase catalytic subunit Low 8 1 401-425 FNILGGKTKVKRRNRKDSNLPIEID plas(8),E.R.(6),mito(4),pero(3),golg(3),extr(2),mito_nucl(2),cyto_pero(2) KRR (411-413, prob:0.625) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PNB5 Rho family guanine nucleotide exchange factor Low 9.3 1 526-550 DDNKKSDKQEKKSKFSTRKRSTSSN nucl(18),cyto_nucl(13.333),cyto(6.5),cyto_mito(4.166) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PNT5 Uncharacterized protein Low 5 1 368-390 ENTIISKVKKNPKLKVNLLNSHE mito(10),extr(6),mito_nucl(6),cyto(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PSY2 J domain-containing protein Low 8 1 266-296 TSPQEDDTKKKVQKKKSKGKKVELPNGKVVY extr(9),plas(5),E.R.(4),mito(3),golg(3),cyto(1),pero(1),vacu(1),cyto_pero(1) KKKVQKKKSKGKKVELPNGKVVYSRKK (274-300, prob:0.981) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59NC4 Gly1p Low 7.6 1 346-366 CFEYHQKHPHKDDGRNNKKMY cyto_nucl(14),cyto(13.5),nucl(9.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59R09 Iron-sulfur clusters transporter ATM1, mitochondrial Low 5.8 1 64-90 TSTSKTTPKTLSKPPPKVKPPIQDNDT mito(9),plas(8),pero(4),E.R.(3),nucl(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AB98 Cdc13p Low 7.3 1 1-25 MCFIRKTRKINKQNRARLQKFFFFI mito(18),nucl(6),cyto(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PG13 Transcription initiation factor IIF subunit beta Low 9.6 1 156-178 KELNPEKKKFQVRRKFKYFRVQK nucl(20.5),cyto_nucl(11.833),mito_nucl(11.833) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PH01 alpha-1,2-Mannosidase Low 8.4 1 395-420 NHQHHHQGNKKVKRNKKKFKAEDSID E.R.(9),extr(6),golg(6),vacu(3),nucl(1),cyto(1),plas(1),cyto_nucl(1) KKVKRNKKKFK (404-414, prob:0.886) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJ35 ZZ-type domain-containing protein Low 8.9 1 70-89 NDNYLVYTRKSKRNKDFVSL nucl(15),cyto_nucl(12),cyto(7),mito(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PN71 Lysophospholipase Low 8.5 2 209-230, 723-743 PLQQQQQQQRNKYKSKKQGMFS, GKFNIPKICKKCYKTFCWRDN mito(6),extr(6),cyto_nucl(5),nucl(4.5),cyto(4.5),pero(2),E.R.(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTA4 Putative permease Low 5 1 105-127 YRVTSNVKSKRKWYKWFHEDDTP plas(25) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59MT5 Uncharacterized protein Low 5 1 102-124 YRVTSNVKSKRKWYKWFHEDDTP plas(25) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59PW0 Probable cell wall mannoprotein PIR32 Low 7.3 1 231-258 NNESRPNNSKKYHKKRPHNNYENKHGHK E.R.(8),nucl(6),cyto(3),extr(3),golg(3),mito_nucl(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A3P4 Tryptophanyl-tRNA synthetase Low 9 1 404-424 LVFGNKERKVPAKQREKKAKK cyto(20.5),cyto_nucl(12.5),nucl(3.5) GNKERKVPAKQREKKAKK (407-424, prob:0.983) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AN95 KH domain-containing protein Low 9.9 1 818-837 KSNNHNNRGGRQHQRNQSLC nucl(18.5),cyto_nucl(13),cyto(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q92206 Squalene monooxygenase Low 5.5 1 371-393 QLIAKRLKTFHRKRKNLDAVINT plas(11),E.R.(6),mito(2),cyto_nucl(2),pero(2),vacu(2),nucl(1.5),cyto(1.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PEJ0 Uncharacterized protein Low 5.7 1 116-137 LSLGNKKLDKVRQRNSKGQDHS extr(7),E.R.(6),golg(5),pero(4),nucl(2),mito(1),cyto(1),vacu(1),cyto_mito(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PFK2 Uncharacterized protein Low 6.9 1 11-32 AFKPSIKKAKNTWRLQKFKKLY mito(21),nucl(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PHC7 Rxt3p Low 9 1 271-290 TEPLKPHRQLFKKRPIPKLN nucl(14.5),cyto_nucl(10.5),mito(8),cyto(3.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PUA4 Uncharacterized protein Low 8.5 1 79-99 PIILSKEKKSKDKKGFPSFVY nucl(13.5),cyto_nucl(12),cyto(9.5),mito(2),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AD56 General negative regulator of transcription subunit 3 Low 9.9 1 51-75 ANDLKKEIKKLQKFREQIKHWLQND nucl(19),cyto_nucl(13.5),cyto(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q8X1E6 Hsp90 co-chaperone Cdc37 Low 8.4 1 27-48 KQSFIRWKQRDIHEKRMQRNIE nucl(14.5),cyto_nucl(12.833),cyto(10),cyto_pero(5.833) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PG44 Pom152p Low 9.2 1 1202-1225 IRTIDIRKGKKTFRKLVEKETIKD nucl(13.5),cyto_nucl(8.5),mito(4),cyto(2.5),pero(2),E.R.(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PHG0 Zn(2)-C6 fungal-type domain-containing protein Low 8.6 1 8-33 KQVVRCLSCKKLRIKCDQVRPKCEYC mito(12),nucl(11.5),cyto_nucl(8.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PMP7 Gst1p Low 9.2 1 1-24 MLPQFHLPKKKRVYKGGNRSHTLV nucl(13.5),mito(10),cyto_nucl(9) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PN80 Sef2p Low 8.3 1 16-46 QPPKGGRILKTCTRCRRHKTKCDAQDTNPYP mito_nucl(12.166),nucl(12),mito(12) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PU00 Uncharacterized protein Low 9.1 2 37-59, 141-160 SITTYQICPRPRPRPRPLTYLMS, GWSCGKEKLRQTNNNNNNNN mito(16),nucl(6),cyto(2),pero(2),cyto_pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59R29 Uncharacterized protein Low 5 1 74-98 NSPSTLLYNKKKIRRKSSVINHELI plas(26) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A5S5 Serine/threonine protein kinase Low 9.4 1 368-388 VEQEVKRRLEQRKPHGPRPLE nucl(17),cyto_nucl(13.5),cyto(8) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A7P3 Telomere replication protein EST3 Low 5.3 1 190-209 YNQLCGKKKHKPEYEDLMCD E.R.(12),plas(4),golg(4),mito(3),vacu(1),pero(1),cyto_nucl(1),cyto(1),nucl(1),cyto_pero(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A850 Glycogen [starch] synthase Low 6.9 1 558-583 DYMFDFCAKSRRQRINQRNRTERLSV cyto(17),cyto_nucl(13),nucl(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PCA4 DNA-directed RNA polymerase Low 7.5 1 1068-1091 GLPCVQPYRLHKKKQLKTAVQDLN cyto_nucl(9),nucl(8.5),cyto(8.5),mito(8) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PCJ5 Uncharacterized protein Low 5 1 276-296 YETPTRPWQRTKRSRIEPNVE plas(17),E.R.(7),mito(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PDP2 Prn3p Low 5.7 1 306-326 PLNGCPKKRAADKKSYLDSKI mito(18.5),mito_nucl(11),pero(4),nucl(2.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJ25 Delta(24(24(1)))-sterol reductase Low 5 1 433-458 VLVHRGYRDQRKCAKKYGKDWDRYLE plas(22),pero(2),golg(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PMT0 Putative lipid phosphatase Low 9.4 2 146-167, 254-274 DEYKRFTKIFPKKINRRDIRSV, TQTCGSHREKRKPFPLQRGDQ plas(16),nucl(6),mito(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQ52 PX domain-containing protein Low 9.2 1 120-141 SEEREEKITKRRQVNKKLLSGL nucl(16.5),cyto_nucl(13.5),cyto(9.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A1F2 Sorting nexin 1 Low 9.6 1 575-600 LSKKQAQLDKYTRKQQQPDKINQLNF nucl(19.5),cyto_nucl(15),cyto(7.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A4M7 Protein kinase Low 9.3 1 49-68 KRTPSVSSLKRRNTNPSQTS nucl(17),cyto_nucl(12.5),cyto(6),pero(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A6L7 Uncharacterized protein Low 9 1 192-211 EQQKQEQKKQAKQEKINSFF nucl(15),cyto_nucl(10.5),mito(8),cyto(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ABU1 Uncharacterized protein Low 8.9 1 19-50 LKNTQTSKVSFKKKSFNKPQKIQRNKLSFNID nucl(16.5),cyto_nucl(12.833),cyto(8),cyto_pero(4.833) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AD23 Predicted GPI-anchored protein 27 Low 7.6 1 425-450 IPKFFYGSRRKQPSSFKNKNSTIKFD nucl(8),cyto_nucl(7),E.R.(7),cyto(4),extr(3),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ADS3 Oxidant-induced cell-cycle arrest protein 5 Low 9.1 1 623-652 FLSRLPSKSYKYNQKRSTRQKRTSYASNAS nucl(15),cyto_nucl(12),cyto(7),mito(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PD86 Uncharacterized protein Low 6.4 1 31-55 VYLSYLQKPKPKVNSNKNTNTNTNT cyto(5.5),cyto_nucl(5.5),E.R.(5),nucl(4.5),golg(4),extr(3),mito(2),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PFH7 WD_REPEATS_REGION domain-containing protein Low 8.4 1 59-85 KISNNAKKLAKQLKRQRYKQGSRYGID nucl(12),cyto_nucl(10.5),cyto(7),mito(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PGZ5 DNA-directed DNA polymerase eta Low 9.3 1 564-590 IKYSSPPPPPPPAQKKRSKNGQLDIFE nucl(15.5),cyto_nucl(10),mito(7),cyto(3.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PPE9 Uncharacterized protein Low 7 1 36-56 PQVRGKSKTTTKDQLKPCKSS plas(17),nucl(6.5),cyto_nucl(6),cyto(2.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQ00 Uncharacterized protein Low 8.9 1 7-32 FLQSRGIQRIRKQHRRSTDTIRSRAT nucl(15.5),cyto_nucl(13),mito(6),cyto(5.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AGA0 Putative alpha-1,3-mannosyltransferase MNN1 Low 6 1 677-698 FEKEAKKKTRLKHLHTADQFRT golg(8),mito(6),pero(4),cyto_mito(4),nucl(3),E.R.(3),cyto_pero(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PCP9 Uncharacterized protein Low 8.8 1 2-24 AIFISRKSNGKAKKKYNLLSIKS plas(11),mito(9),E.R.(4),nucl(2) GKKK (330-333, prob:0.668) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PI19 Phm7p Low 7 2 222-242, 253-276 IWYSRDYKKLQKQVKERTKLA, LTKAVKLRNKCLKKSKPAPEPQDD plas(11),E.R.(8),extr(4),mito(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PNQ6 40S ribosomal protein S25 Low 8 1 15-40 AALAGGKKGKKKWNKGKVKDKAQHIV cyto(17.5),cyto_nucl(10.833),mito(6.5),mito_nucl(5.333) AAAALAGGKKGKKKWNKGKVKDK (13-35, prob:0.986) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PP94 Vid27p Low 7.6 1 624-646 TNYFDKDKKPTPRRLALKPEHEA cyto(13),nucl(7),cyto_pero(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQY1 Uncharacterized protein Low 9.9 1 22-42 QSPFTYTSRKRRHSNVSSYPT nucl(18.5),cyto_nucl(13.5),cyto(5.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59RC2 Uncharacterized protein Low 8.1 1 150-173 TTDLSHQHPNRKSNKRRVTTTAGT nucl(12),cyto_nucl(9.333),cyto(4.5),cyto_mito(3.666),pero(3),plas(2),E.R.(2),golg(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A5T3 Fgr29p Low 7.2 1 574-596 NIMGRSTKRRLSRRYNKYQSLST plas(18),nucl(6),cyto(1),E.R.(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A985 NAD-dependent protein deacetylase HST2 Low 6.2 1 298-323 HLKEDKHTTKVDKKEKQNDANDKELE cyto(10),cyto_nucl(8),E.R.(5),nucl(4),mito(3),extr(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AD04 Uncharacterized protein Low 5 1 1051-1073 SLSERFYSKVKKKCTQETGHDEI plas(17),E.R.(5),mito(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AGV9 Uncharacterized protein Low 7.9 1 45-66 KVEYNKKGRKYRFVNNTFQRIR nucl(10),cyto_nucl(10),cyto(8),mito(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AGY8 Uncharacterized protein Low 5 1 105-128 ISIRIYKKCFQKKPSHHINNGRHS plas(23),mito(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ANC5 PKS_ER domain-containing protein Low 7.9 1 2-25 STTVIKTQERTRKRLRTNTSGIVF mito(11),nucl(10),cyto_nucl(7.5),cyto(3),pero(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PGI6 Uncharacterized protein Low 9.3 1 228-249 NKFNAKMTKLWKRKQSEQESLE nucl(14.5),cyto_nucl(10),mito(5),cyto(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PKY2 Frp1p Low 5 1 38-57 FYWIPRYLRVNNKRNNYFRL plas(13),mito(6),E.R.(4),golg(3),cyto_mito(3),mito_nucl(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PNE2 Smr domain-containing protein Low 8.9 1 12-34 QPCHSNPTKTHIQKNSRKVQRGG nucl(14),cyto_nucl(10),mito(5),cyto(4),pero(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQL8 Glutamyl-tRNA synthetase Low 6.4 1 542-565 GPKEPYTESKPKHKKNPEVGNKDV cyto(15.5),cyto_mito(10.5),nucl(5),mito(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PSS6 Uncharacterized protein Low 8.3 1 1-21 MTEPKRRKYNKSRRAISTNSF nucl(11.5),mito(11),cyto_nucl(9),cyto(3.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59X27 GAF domain-containing protein Low 8.5 1 3-23 GRSSRDASHHNKKFRKSPITG mito(12),nucl(11.5),cyto_nucl(9) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A759 Uncharacterized protein Low 8.8 1 24-45 AQQYKEKWIKIKHQRDENGNLK nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A7R4 Uncharacterized protein Low 5 1 163-188 LSALQKPSTQNQRKQRLTRLRHLKSN mito(12),plas(6),extr(4),cyto(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AD72 Alpha-1,2-mannosyltransferase MNN24 Low 5 1 569-588 TTTQKDTKKKINYNSPLPEK E.R.(10),golg(9),extr(3),pero(2),vacu(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ALW7 Protein phosphatase methylesterase 1 Low 7 1 72-91 NELGHKFKTYYKPSKKPGSI cyto(14.5),cyto_nucl(11.5),nucl(7.5),mito(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PDN9 Prn1p Low 9.4 1 313-334 LEKRAAKKKAFLEKQQKKAAPV mito(14),cyto(7.5),cyto_nucl(6.5),nucl(4.5) RAAKKKA (316-322, prob:0.707) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PF81 ATP-dependent DNA helicase II subunit 1 Low 9.8 1 777-798 DQLKAFRRKYPDVKSANKKADL nucl(19),cyto_nucl(14),cyto(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PKB2 Aa_trans domain-containing protein Low 7.1 1 614-639 GESLIFRHSKKKSKRQQHQHGSTDES plas(17),nucl(6),mito(3),cyto_nucl(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PMG3 Protein-tyrosine-phosphatase Low 9.7 1 2-21 SSTLSYLRNPHRNRKSSTTT nucl(17),cyto_nucl(11),mito(5),cyto(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTE7 Uncharacterized protein Low 7.8 1 97-117 EPTITIPKREKKKVRYSIGVQ plas(16),nucl(7),cyto(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A744 Protein SDS23 Low 6.1 1 547-569 ATSKGRRTDPQAARNQRRRSSTS mito(18.5),cyto_mito(11.833),cyto_nucl(4.833),nucl(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ADM9 Dolichyl-phosphate-mannose--protein mannosyltransferase 2 Low 5 1 514-536 VVCYKNPFKKDKRTWWNIENNRN plas(22),E.R.(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AI20 Fe-S cluster-binding ribosome biosynthesis protein Low 8.2 1 24-51 AIVSADRCKPKKCKQECRKSCPVVKTGK nucl(13),cyto_nucl(10.333),cyto_mito(6.166),mito(5.5),cyto(5.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5APH1 Uncharacterized protein Low 9.8 1 33-55 RATLRDKKLQQRKSQSLERKSNE nucl(16.5),mito(9),cyto_nucl(9) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PHE0 Mitochondrial 37S ribosomal protein MRPS35 Low 7.8 1 281-303 NFGYRYGASRRDRKKDRAIGFDA mito(18),nucl(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJN6 Kre5p Low 8.1 1 1198-1221 FISYKWPNFLRKQKTKERMIWGYK nucl(8),mito(6),cyto(6),cyto_mito(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PM41 Ribosomal 60S subunit protein L22B Low 7.5 1 77-98 KYLKYLTKKYLKKNQIRDWIRF nucl(9),cyto_nucl(9),mito(7),cyto(7),pero(1),E.R.(1),golg(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PN78 Uncharacterized protein Low 7.8 1 59-84 RINYIKSLKSRKEVRKYLNRICKSKN mito(15),nucl(7),cyto(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQ11 Uncharacterized protein Low 9.7 1 38-57 SSSTSPKQPHQQQQQYSINT nucl(18),cyto_nucl(12),cyto(4),mito(2),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTB4 Alpha-factor pheromone receptor Low 5.8 1 86-114 LQWINQKIFTKKRNDNKQQQQQQQQQIES mito(15),plas(6),nucl(2),E.R.(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59YH3 G1/S-specific cyclin CCN1 Low 9.3 1 4-28 LQQQRVKYGPPHHIKRRPYHPILES nucl(16.5),cyto_nucl(12),cyto(6.5),mito(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AHA6 AMP deaminase Low 9.6 1 187-209 IYPPPPKPTYKSKNRFNQLPRES nucl(16.5),cyto_nucl(11.5),cyto(5.5),cysk(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PHH8 Uncharacterized protein Low 5.8 1 5-25 GVRLTKRVYKQSQPLLRKNEH plas(20),E.R.(3),nucl(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQ78 Aminophospholipid translocase regulatory protein Low 6.8 1 22-45 DPTSSIHKSRKPPNTAFRQQRLKA plas(17),nucl(5),cyto(2),pero(1),golg(1),vacu(1),cyto_mito(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQR9 Uncharacterized protein Low 9.4 1 111-134 GNKLRIAKKLKFPKNQSSRKPDMF nucl(17.5),cyto_nucl(13.5),cyto(8.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59S85 Mitochondrial inner membrane magnesium transporter LPE10 Low 9 1 15-44 GFLSKPFLRQLNKKSKPNPHKNKNFDSFNE nucl(10),mito(7),cyto(6),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A506 GTPase activating protein BUD2 Low 9.4 1 1218-1237 GSAIKPNTSKNPFKKWLRKN nucl(15.5),cyto_nucl(10.5),mito(5),cyto(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AGV7 Palmitoyltransferase PFA4 Low 5 1 109-136 RCEWIRYCKKCNNYKPPRSHHCKICQQC mito(9),E.R.(5),cyto_mito(5),mito_nucl(5),golg(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AJC2 AAA family ATPase Low 8.9 2 56-80, 765-784 NNDHEKDSERKPKKDQNKDEEEQLR, GEDAFKGKPKSKDQNSNDDG mito(10),cyto(8),cyto_nucl(8),nucl(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PEC2 Cyclin Low 9.8 1 26-49 TTNSIIQVKPSKRNQHHRKLSSTS nucl(19),cyto_nucl(12.5),mito(4),cyto(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PNM6 Uncharacterized protein Low 7.4 2 982-1011, 1021-1047 KMVIEKVQQQKQQKQKQKRQQVYHGQSTHD, DKVKHVFHNNTNRRHTRKTGANQNAVE plas(10),E.R.(7),golg(3),mito(2),pero(2),nucl(1),cyto(1),cyto_nucl(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PPH3 Glutaredoxin domain-containing protein Low 8.8 1 35-56 IHPEKYKSSKDINKLKRYSKLN nucl(18),cyto_nucl(12.833),mito_nucl(10.333),cyto(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59VL7 Putative alpha-1,3-mannosyltransferase MNN15 Low 7.8 2 131-151, 634-658 RINQLRKRFEKDSNNKNKQFT, TKPEMEFRKSWKSRKKDTDEINEKL golg(9),E.R.(8),mito(4),nucl(2),vacu(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59ZI7 Mitochondrial 54S ribosomal protein YmL10/YmL18 Low 8.8 1 242-261 REELANKKPTKKLSKFKSLE mito(24),nucl(2) RGQSSGKGKTAGRGQKGQKARS (46-67, prob:0.813) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A2V2 Protein RMD9, mitochondrial Low 9 2 89-111, 146-171 KHEPYHLKFNPKTKNQRNNDSAS, GTINSRRARLNKSKNRDKDQRSAFRE mito(19),nucl(6),cyto_nucl(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AD33 Uncharacterized protein Low 6.1 1 60-81 NWDQTLTKYKRKKRDYNDDSLA plas(8),E.R.(8),nucl(3),pero(3),golg(2),mito_nucl(2),cyto_pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AL27 Palmitoyltransferase AKR1 Low 9.1 1 1-21 MAKKKSKSKSSSPKPKVSSTA plas(19),nucl(3),mito(3),mito_nucl(3) KKKSKSKSSSPKP (3-15, prob:0.757) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PEX3 DNA-directed RNA polymerase subunit Low 8.2 1 1076-1099 ALSYSKKVRKSLKKQKDVPHYDQV nucl(12),cyto_nucl(11.5),cyto(9),cysk(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PMG7 Histone deacetylase Low 5 1 13-43 QKENVCSVCKQKKNAPQKKPCPPPCKYCQTS cyto(20.5),cyto_nucl(12),mito(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQ19 Mnn4-4p Low 6.8 1 838-860 DLVKYKTYKKGLKMVKPLRKALY golg(7),nucl(5),pero(5),E.R.(5),mito(2),cyto(2),cyto_mito(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PSZ6 Csp1p Low 7 2 113-135, 163-206 KWDDKYKDKKCHDKWDDKCKDKC, DDDKCHDKCKDKKCDDKQKHDHCKDDNKCHDKCKDKKCDDKCKD extr(11),cyto(5),mito(4),pero(2),E.R.(2),vacu(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59RQ4 Mitochondrial 54S ribosomal protein YmL8 Low 9.2 1 221-246 GKLLVSKQFKTKPRPERQSINIPQSP mito(15),nucl(11) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59VY2 Methyltransferase-like protein Low 9.6 1 286-305 ATDRRLLVNRKKQLKMYRNW nucl(17.5),cyto_nucl(13),cyto(7.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PEY6 Tricalbin Low 7.5 1 82-101 MSNVKTKPPPRQPVDPTYRG cyto_nucl(11.5),cyto(10.5),nucl(9.5),mito(3),E.R.(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PFV1 Ribosomal 60S subunit protein L4B Low 8 1 303-327 AGEKTQKKSHVLKKNPLKNKQVLLR mito(14),cyto(4),pero(4),cyto_pero(4) VIKSKKLRAGKGKLRGRRFTQR (182-203, prob:0.976) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PHW7 G-patch domain-containing protein Low 9.6 1 15-42 SETESDKSKLKSRKKQFKIPEYPQPPSF nucl(19),cyto_nucl(13.333),cyto(5.5),cyto_pero(3.666) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PIA3 Putative asparagine synthase Low 9.3 1 637-659 TTTPTVSTKKSNKNKLTFIPTRK nucl(14.5),cyto_nucl(9.5),mito(4),cyto(3.5),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PRY4 Cwh43p Low 5 1 978-997 DEPRYFAQHKWQRYNEQEQE plas(23),E.R.(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PSV9 Mediator of RNA polymerase II transcription subunit 5 Low 9.8 1 7-26 SISKLIKKSINQKLPPKLFI nucl(12),cyto(5),mito(4),cyto_pero(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTC7 Uncharacterized protein Low 9.7 1 101-122 QETQISKQRLKKNKQTMYNKIS nucl(19.5),cyto_nucl(14.833),cyto(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTH3 Dihydrolipoyllysine-residue succinyltransferase Low 8 1 176-195 EEPKKESKPAPKKEESKKAT mito(26.5),cyto_mito(14) KKEEAPEKAKEESAPAAAPKKEETKKEEPKKESKPAPKKEESKK (150-193, prob:0.99) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59WG7 Protein BIG1 Low 7.7 2 246-265, 293-318 RDSNDRYYRNKKKDEIHLFD, SFFNYLKQKIIQKKQQKSKRGIIADD E.R.(8),golg(6),mito(3),plas(3),pero(3),nucl(2),cyto(2),cyto_nucl(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ACV4 Peroxisome biogenesis protein Low 7 1 387-410 STEDTFSKYTRRRRWIRTAELIFD plas(15),nucl(5),E.R.(3),cyto(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5APC2 Putative ferric-chelate reductase Low 8.6 1 639-660 NLENKIYKGRPKLNHRYYNWCI plas(11),nucl(9),E.R.(3),golg(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PDV5 Rho family GTPase Low 8.9 1 216-236 TATAGTGKKRKIKRAKKCTIL cyto(19.5),cyto_nucl(12),nucl(3.5),mito(2) TGKKRKIKRAKK (221-232, prob:0.948) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PID2 Uncharacterized protein Low 8.7 2 197-227, 268-299 VDDVKKYPQCFNKKNDKPKRKHCCFDNDGKV, IDDVKKYPQCFNKKNDKPKRKHCCFDNNDRVL extr(6),E.R.(6),nucl(5),golg(3),vacu(3),cyto(2),pero(2),cyto_pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PMF4 Fre3p Low 8 1 449-471 TIKVTIPKPKRWRPKPGGHAFVH plas(17),E.R.(7),golg(2) KPKRWRPK (456-463, prob:0.718) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PRQ0 Reverse transcriptase domain-containing protein Low 8.9 1 22-41 PTNFHSTKSAKKRLDRIYID nucl(19),mito_nucl(12.833),cyto_nucl(11.333),mito(5.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTM6 Fgr32p Low 9.8 1 32-51 LSLSERQKLQQQQQQQQRQQ nucl(20),cyto_nucl(14.5),cyto(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59QT4 Mitochondrial 54S ribosomal protein YmL20 Low 9.9 1 150-173 PVKVVSKKLLDRQKRKQLWLRNQY nucl(19.5),mito_nucl(13.5),mito(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A5R5 Zsf1p Low 8.2 1 167-188 ELKHVERPPKWRSKPCANWTKY nucl(11),cyto_nucl(9.5),mito(8),cyto(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A7K2 Uncharacterized protein Low 8.6 1 7-27 ANSNIRRNKIIQKNNKQQSVD mito(13),nucl(9),cyto(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A847 JmjC domain-containing histone demethylation protein 1 Low 8.6 1 67-90 PKYGESTYKRKSKRARVSIDYQSL cyto(12),nucl(9),mito(2),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AAQ7 Ant1p Low 6.4 1 250-275 VSKAMIQKKSSPKKNNKATDKNTEED cyto(8.5),mito(7),cyto_nucl(7),nucl(4.5),extr(2),pero(2),vacu(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5APM7 ATP-dependent RNA helicase MSS116, mitochondrial Low 8.5 2 616-641, 644-668 NNRNNDWSYQNKNRYNNNNNRQTERS, SDRKSHNDWKYEKKFEHRRIRDHDE mito(18.5),mito_nucl(12.5),nucl(5.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PDG9 Uncharacterized protein Low 7.6 2 322-343, 365-385 GIINQEVKKKKQQLREKHGVLW, NSKSIDNKKKTDNGKQLPKGK mito(15.5),cyto_mito(9),plas(6),nucl(2),E.R.(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJJ7 Zcf1p Low 9.9 1 5-36 LLPISCISCRKRKIKCNRIKPCDQCIKRHLPC nucl(17),cyto_nucl(10.5),mito(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQS8 Uncharacterized protein Low 7.9 1 101-124 LSPHSREYLRQRKRRYYHYYHTHF mito(15),nucl(9),cyto_nucl(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PR32 Reverse transcriptase domain-containing protein Low 9.7 1 800-826 YDMLKGHSTTKNKKQKKFNTTIYPFIS nucl(17),cyto_nucl(12),mito(4),cyto(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTD5 GCR1_C domain-containing protein Low 9.7 1 1-20 MAKRKKSRSKLQQNVDSNES nucl(18),cyto_nucl(12.5),cyto(5),mito(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A649 Serine/threonine-protein kinase ATG1 Low 9.5 1 86-105 IKSVYRSKLKSKKLLENLEI nucl(16.5),cyto_nucl(12),cyto(6.5),mito(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AAW1 ATP-dependent 5'-3' DNA helicase Low 9.8 1 89-116 TSSALSNKSEKKKPSKNHKEESQTQDQS nucl(20),cyto_nucl(14.5),cyto(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ADY1 Utp9p Low 7.9 1 46-68 DFVWASPTTRKKRTPNGGSKESE nucl(16),cyto_nucl(14.166),mito_nucl(9.832),cyto(9),cyto_mito(6.332) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PEY4 H(+)-transporting V0 sector ATPase subunit e Low 8 1 10-34 ESSADVKKKSKSQNKKGALTQKKKS plas(20),mito(3),E.R.(3) KKKSKSQNKKGALTQKKK (16-33, prob:0.76) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PG02 Uncharacterized protein Low 8 1 48-92 NQFIKQQTKKQQQQQNSKPSNNNTTKTNNNKRQRRDKSPSTRVGR mito(15),nucl(8),cyto(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PGE9 tRNA(Adenine34) deaminase Low 9.6 1 248-269 TVNYKKPIGKYNSKKRHFANDE nucl(16.5),cyto_nucl(11.5),cyto(5.5),vacu(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PGU0 Hsp70 family chaperone Low 5 1 847-872 EQLLERKKQQELRRKLREAQKAAKEE E.R.(10),extr(7),golg(5),vacu(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PHG7 Mitogen-activated protein kinase kinase Low 8.7 1 88-110 PSSVSSSKSTKRKPPPIDTKVIS nucl(13),mito(10),cyto_nucl(9),cyto(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PKH8 Uncharacterized protein (Fragment) Low 5 1 41-61 IKTGKSKSKSWKRMITKHTFV mito(13),cyto(5),pero(5),cyto_pero(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PL59 Uncharacterized protein (Fragment) Low 7.2 1 227-248 ILYLLRKKFNKQYKLNRGGREN mito(15),mito_nucl(13.333),nucl(9.5),cyto_nucl(6.166) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PMQ7 Uncharacterized protein Low 7.7 1 316-341 DQFEKVKIIKQYKKYEKNMNINVRSY mito(17),nucl(7),cyto(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PNW3 Bac_luciferase domain-containing protein Low 6.7 1 483-505 GESKDEFERRLNKKRKSETQEIA cyto(13.5),cyto_mito(9),nucl(6),mito(3.5),pero(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PP09 Membrane insertase Low 6.6 1 270-290 PISFTPKKRINYAKIKNDNAV mito(9),nucl(4),plas(3),extr(3),cyto_nucl(3),pero(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PPV6 Uncharacterized protein Low 9.2 1 165-186 KKNEFFKKFISKFKKNSHAAKN nucl(14),mito(10),cyto_nucl(9.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTZ8 Uncharacterized protein Low 9.8 1 226-253 FEKEKGTSPQQKRYTKKQREEIERREQE nucl(19.5),cyto_nucl(14.5),cyto(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AEM5 Oxidation resistance protein 1 Low 8.8 1 46-67 SDSVNEKPKEQPKPVKRRGTFF nucl(17.5),cyto_nucl(12.333),mito_nucl(11.666),cyto(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ANN6 Uridine kinase Low 9.9 1 1-21 MPLHPKSRRRSSRISPLPDED nucl(18),cyto_nucl(11.5),mito(4),cyto(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PEI4 Crp1p Low 5.4 1 117-143 VGMYHKFINSRNKKKHMKYCKVCQESE plas(20),E.R.(2),golg(2),nucl(1),cyto(1),cyto_nucl(1),vacu(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PN42 Gpr1p Low 5.7 1 590-609 QDRYIKRKLRDSRKLDKLVQ plas(12),mito(6),E.R.(5),nucl(2),vacu(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PP73 DNA primase Low 7.8 1 71-92 VYKINPKERKNLPKQAFKPESK mito(16),nucl(8.5),cyto_nucl(5.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) G1UB61 Septin CDC11 Low 8.4 1 8-29 VSSAALRKRKTLKKSINFSIMI nucl(11.5),mito(11),cyto_nucl(8),cyto(3.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59R26 Bromo domain-containing protein Low 9.1 1 523-543 TSSSASRKRARSRSPLPVPAQ nucl(15),cyto_nucl(12),cyto(7),mito(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59TA3 Uncharacterized protein Low 6.1 1 156-175 QTNSATSKRQQKLQARREKG plas(6),mito(5),extr(4),mito_nucl(4),nucl(3),pero(3),golg(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59VX7 Karyopherin beta Low 6.4 1 853-874 KTKDAARWARDQQKRQQQQLFG cyto(16.5),cyto_nucl(12.5),nucl(5.5),cysk(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59W44 Mitochondrial import inner membrane translocase subunit TIM50 Low 7.5 1 80-106 SEEQATKQTGRKRKRAQTSKDLQRERY mito(13),mito_nucl(12.833),nucl(11.5),cyto_mito(7.833) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A0L0 Ribonucleotide-diphosphate reductase subunit Low 5.9 1 70-90 QDFLAKHKVHRHKLKQLEAEE cyto(21.5),cyto_nucl(13),nucl(3.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A1Z2 Uncharacterized protein Low 5 1 311-334 GLEPLPPKHRKLQKFEKRAYRGLG plas(18),mito(3),pero(2),E.R.(2),golg(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A6P1 NDT80 domain-containing protein Low 8.5 1 1-25 MTNLSFHRKQKSKNKACNLDFKSDS nucl(12),mito(10),cyto_nucl(9.5),cyto(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AI42 Octanoyltransferase Low 6.6 1 45-66 DYKSLEFKYRRIQRQRQQISTN mito(21),nucl(4.5),cyto_nucl(3.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ALU1 54S ribosomal protein L31, mitochondrial Low 7.2 1 80-107 KYTTFNRHSKNYRKPVHRVPKWTKLSFR mito(17.5),mito_nucl(13.5),nucl(8.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PE38 Uncharacterized protein Low 8.1 1 289-319 TEIQSKKSEYTKRFKKNANKQRNQNQQDIIK mito(18),nucl(8) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PE70 AP-2 complex subunit alpha Low 9.5 1 112-131 GKNQKSKKFTSSKQRLNYIL nucl(17.5),cyto_nucl(10.833),cyto_mito(3.833),mito(3.5),cyto(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PG36 V-SNARE coiled-coil homology domain-containing protein Low 9.2 1 227-246 TSSSVFQKRAQQIKRKMWFM nucl(15.5),cyto_nucl(10),pero(4),cyto(3.5),mito(1),extr(1),E.R.(1),golg(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A390 Uncharacterized protein Low 8.2 1 10-32 CEIIQCICWRRRRQGRTFFPSYF mito(17),nucl(8) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A4W7 Fatty acid synthase subunit beta Low 6.6 1 1973-1995 VKPFQRFLCKKIPKSSVKPQDLI cyto(11.5),cyto_nucl(9),mito(6),nucl(5.5),E.R.(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A7K0 40S ribosomal protein S24 Low 8 1 96-129 LAEKVEKASRQQRKQKKNRDKKIFGTQRRAQKRA mito(21),cyto(4) KASRQQRKQKKNRDKKIFGTQRRAQKRAARRN (102-133, prob:0.979) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A922 Altered inheritance of mitochondria protein 9, mitochondrial Low 6.9 1 67-90 TWGSWLTNDKSKKKQRETTFSIEG mito(19),nucl(5),cyto(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ADN8 UDP-galactose transporter homolog 1 Low 5 1 350-370 EAFIKFKQQSQQKMKIKSKVA mito(10),plas(7),E.R.(5),cyto_mito(5),mito_nucl(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AI68 Uncharacterized protein Low 8 1 98-120 LDKSGKPAKRWVKKPRSFKTFTG mito(23.5),cyto_mito(12.5) KPAKRWVKKPR (103-113, prob:0.76) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PU67 Proteasome endopeptidase complex Low 5.7 1 220-240 ITPNVRIKKCKDYKFPRGTTA cyto(17.5),cyto_nucl(11.333),cyto_pero(10.166),mito(4),nucl(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PUB1 DNA helicase Low 9 1 428-448 SASCKFNSKPRIKFKRQIDLL nucl(17),cyto_nucl(13.333),cyto(7.5),cyto_mito(4.666) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59VW6 1,3-beta-glucanosyltransferase PGA5 Low 8.6 1 559-583 EVESTPKRKGKGKSKEKEKGKLIEE extr(8),E.R.(7),golg(4),nucl(2),cyto(2),cyto_nucl(2),pero(2),vacu(2),cyto_pero(2) STPKRKGKGKSKEKEKGK (562-579, prob:0.984) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A0H8 Polyubiquitin-binding protein Low 7.8 1 327-356 FSGSGQSLRQSKKRKDKNTNYPSLKNHTRS cyto_nucl(12.833),nucl(12.5),cyto(12),cyto_mito(7.833) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A360 Nucleotide exchange factor SIL1 Low 5 1 369-388 VESRKENKKRDDYSQEDKDF extr(10),E.R.(10),golg(3),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A970 Mitochondrial inner membrane magnesium transporter MRS2 Low 8.3 1 433-457 YGSGGKYSKPSKKFDRPTNREKDAM mito(11),nucl(9),pero(2),E.R.(2),cyto(1),extr(1),golg(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PEE8 Uncharacterized protein Low 8 1 20-39 TRFFWTSTIRSKNRKQENIS mito(12),nucl(8),cyto(7) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PFH5 Type I sorting receptor Low 7.7 1 336-359 LCVYGHREKFRRRKQDAKCFVNKL nucl(10),cyto_nucl(8.833),cyto(5.5),cyto_mito(5.166),E.R.(4),mito(3.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PJ05 Protein-tyrosine-phosphatase Low 9.8 1 17-39 SASMTHTLRVKRNRPKSSYFEDF nucl(19.5),cyto_nucl(14),cyto(7.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PL45 Csp2p Low 8.9 1 113-133 CDDDCKKKKKKVYFAKRGDDD extr(9),cyto(5),vacu(4),cyto_mito(4),nucl(3),mito(3),mito_nucl(3),cyto_pero(3) KKKKK (119-123, prob:0.671) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PN46 5-demethoxyubiquinone hydroxylase, mitochondrial Low 8 1 16-44 TSALLNKSTKPKSKAPKKKSQKEVIYGPL mito(18),cyto_mito(13),cyto(6) TKPKSKAPKKKS (24-35, prob:0.886) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PN84 Mitochondrial-processing protease subunit alpha Low 6.5 1 503-522 TEPRDFSSNQNEKKKKSRWF mito(15),mito_nucl(12.332),cyto_mito(10.332),nucl(8),cyto_nucl(7.666) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PT74 Uncharacterized protein Low 9.3 1 111-134 GNKLRIAKKLKFPKNQSSRKPDLF nucl(17.5),cyto_nucl(14),cyto(9.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PTF8 Fre30p Low 5 1 203-223 SVPATFTKKKCQEQRCFKFFD plas(16),E.R.(7),mito(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A7P6 Mitochondrial 54S ribosomal protein RML2 Low 8 1 334-361 QSMWGLKKFQKTRLRPNPDQIRNRKGHL mito(25) RSHRSSGRNNEGKITVRGRGGGHKKRAR (97-124, prob:0.898) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AEC8 ESCRT-I subunit protein Low 9.2 1 172-196 NFKESRKLYHSRKEKLHRWEEERVS nucl(15.5),cyto_nucl(12.5),cyto(8.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PEG3 Kexin Low 9.6 1 790-814 VMKFHKTPGSGRRRRRRDGYEFDII E.R.(8),nucl(4.5),extr(4),cyto_nucl(3.5),plas(3),golg(3),pero(2) SGRRRRRR (799-806, prob:0.778) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PU09 Uncharacterized protein Low 7.7 1 1-20 MKKKKFYKYRTQNSRGGGKL mito(11),nucl(9.5),cyto_nucl(9),cyto(5.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59US4 T5orf172 domain-containing protein Low 7.7 1 11-30 TTKGVRCRIKCQSPNSYCRH mito_nucl(13.833),mito(13.5),nucl(13),cyto_nucl(7.333) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AP74 Uncharacterized protein Low 5 1 556-578 FPFLYYGKTFRRKTKRLYVSMVE plas(23),E.R.(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PCX8 60S ribosomal protein L6 Low 7.8 1 12-35 EDVPAPKQTRKTARPQKLRASLVP mito(12),nucl(8.5),cyto_nucl(6.5),cyto(3.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PDM9 Carboxypeptidase Low 6.6 1 76-100 LINQYESKNEKPKKNKFNPMSTFSS extr(12),nucl(4),mito(3),cyto_nucl(3),vacu(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PKC4 Ubiquitin carboxyl-terminal hydrolase Low 8 1 441-464 FEKLTIKKQIKKSKKSKQIMLDRP E.R.(9),golg(6),extr(4),pero(4),cyto(2) KQIKKSKKS (448-456, prob:0.715) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PKZ4 Uncharacterized protein Low 6.1 1 21-41 FFFRCWQKWTEKKIEKKVESC mito(17.5),cyto_mito(11.5),cyto(4.5),nucl(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) P48990 Mitochondrial import inner membrane translocase subunit TIM54 Low 9.6 1 365-384 MDWPKKWVEKGKERNSEWVQ nucl(17),cyto_nucl(12),cyto(5),pero(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AAN6 Uncharacterized protein Low 9.7 1 77-98 QISSRPIKINNNSNRQRRKSSI nucl(18.5),cyto_nucl(14),cyto(6.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AB70 Peroxin/Ferlin domain-containing protein Low 6.9 1 7-26 CETERKKKIPSIFLRCKKSG mito(21),nucl(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AI97 Mitochondrial genome maintenance protein MGM101 Low 9.6 1 229-272 LWDPSFIRRWKKKYCEEIFVEHVNTKKKKKIWKLKSIKTIDYPY mito(21),nucl(4.5),cyto_nucl(3.5) KKKKKIWKL (254-262, prob:0.795) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AJY2 Dihydroxy-acid dehydratase Low 5.5 1 552-571 LTERRKHWTPPEPRYKRGTL mito(12.5),cyto_mito(10.5),cyto(7.5),nucl(2),pero(2),E.R.(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PEU9 Uncharacterized protein Low 9 1 471-492 VLFLYLKKRKRNNLTNQQPDFN nucl(13.5),cyto_nucl(9),extr(5),cyto(3.5),mito(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PF73 EngB-type G domain-containing protein Low 7.9 1 33-59 TNIYQSSKSSKSKKSKNLPSERQLKSY nucl(13),mito_nucl(11.999),cyto_nucl(10.333),mito(9.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PKH2 Glg2p Low 9 1 309-328 FPWEHRQEKRQPTRVFQNIP nucl(14.5),cyto_nucl(12.5),cyto(9.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PLV8 EamA domain-containing protein Low 5 1 438-457 FSPKLKSKHPLRISHFNLNE plas(20),mito(3),E.R.(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQE8 Cst5p Low 8.9 1 3-23 QSTPKSWKDFLKSPKKPTSPT nucl(13),cyto_nucl(9.5),mito(7),cyto(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59NN4 Long-chain fatty acid transporter Low 8.2 2 62-88, 597-619 YSNNKALAFPRPKKNPPKPQVDENGYS, EASHNHKVPKNQFKNQKLPKGED pero(6),E.R.(5),plas(4),cyto_nucl(4),nucl(3.5),cyto(3.5),mito(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59NR8 Palmitoyltransferase PFA5 Low 8 1 226-248 ITINQRKRYNRWKDARKNPNMPS plas(15),E.R.(5),mito(3),golg(3) RWKDARKNPNMPSWMKTKNPPRKETGRK (236-263, prob:0.771) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59TD1 Rim2p Low 8 1 64-85 ISTTTNEKPKPKPKPWVHFVAG cyto_nucl(13),nucl(11.5),cyto(11.5),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PD40 Defect at low temperature protein 1 Low 9.6 1 546-573 KYDSHTSGNTRNKKQRQKRNEVGNNSDD nucl(16.5),cyto_nucl(11),cyto(4.5),plas(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PES6 Uncharacterized protein Low 8.5 1 543-566 CKFSQFFKTKKQTKKEEYLRQSHP nucl(15),cyto_nucl(13.833),cyto(8.5),cyto_mito(5.832) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PQI1 FXNA-related family protease 1 Low 7 2 2-23, 619-642 LYEKRVLPPKRSYQRNPIVWAF, IPEGKQCRMMRRIHHHKHKTTLQE extr(11),golg(8),E.R.(3),vacu(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59LF8 Uncharacterized protein Low 8.6 1 409-438 KYHGHHCSSHKSNQHKPKNHCSSPDKTKEF nucl(13),cyto_nucl(9),pero(5),cyto(3),mito(2),plas(1),extr(1),E.R.(1),golg(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A314 Uncharacterized protein Low 7.4 1 527-552 VKLSFWKSSLKSRKKLEREKFSLVTH nucl(9.5),cyto_nucl(9.333),cyto_mito(6.499),cyto(6),mito(5.5),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A7M7 Uncharacterized protein Low 7.5 1 1-23 MFFRLHPVKRRNGLRQLWQHSNV mito(14.5),mito_nucl(13.833),nucl(12),cyto_nucl(6.833) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ABX0 Serine/threonine-protein kinase TEL1 Low 9.4 1 2796-2817 LYSWTLSRFKKRKLQEDETGPG nucl(15),cyto_nucl(10),plas(6),cyto(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AGW4 Alk6p Low 6.7 1 18-39 AEYWKRESIKRKYDCQPVKQAP nucl(5.5),cyto_nucl(5),E.R.(5),extr(4),cyto(3.5),golg(3),mito(2),plas(2),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AKX4 Uncharacterized protein Low 8.4 1 408-428 PKSLSQRQKDELKKMNKENTM nucl(11),mito(9),cyto_nucl(8.5),cyto(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AND1 Maintenance of telomere capping protein 6 Low 5 1 579-608 IEKVFRKTPIQTNRKRYWKKAIHEYYAKND plas(9),E.R.(8),extr(3),golg(3),mito(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PG26 Uncharacterized protein Low 5 1 20-41 ISRANRKSIYKRLSLNRRNSTP mito(22),cyto(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PIR2 Gcn1p Low 6 1 657-676 WEQSIKKELKQPKKLSKEEQ cyto(22),cyto_nucl(14),nucl(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PPP4 Endo-1,3(4)-beta-glucanase Low 7.8 1 60-79 EPPSLFKRFKHQQQPIGCCC nucl(9.5),cyto_nucl(8.5),cyto(6.5),mito(6),pero(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59Y20 Protein DSE1 Low 9 1 206-229 NSAEICKRFNHRKHLKQNQLENTI nucl(15.5),cyto_nucl(12.5),cyto(6.5),pero(2),cysk(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59ZV5 Eukaryotic translation initiation factor 3 subunit G Low 7.6 1 63-83 IAQRKNWKKYGKEKNSPPGPD cyto_nucl(12),cyto(11.5),nucl(9.5),mito(2),pero(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A3K8 Uncharacterized protein Low 9.9 1 78-101 IQKWCFKKFYKKSKVKSNASKKIS nucl(18),cyto_nucl(13),cyto(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AGC6 Glucose-induced degradation complex subunit Low 8.9 1 68-90 QGEGNNKRKRKFTKDPYLNEIIK nucl(18),cyto_nucl(14.333),cyto(8.5),cyto_mito(5.166) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AKZ2 Membrane-bound O-acyltransferase GUP1 Low 5 1 23-42 TTNPIKRQSIIKKANPTSRW plas(15),mito(4),E.R.(3),golg(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PH42 Branched-chain-amino-acid aminotransferase Low 5 1 36-55 EKTSNPKPKLPKDKLVFGKT mito(21.5),cyto_mito(13.5),cyto(4.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59MB6 Amino-acid acetyltransferase, mitochondrial Low 9.8 1 538-563 GEVFDKKIDRFKRKLRHQNGVVDIDR nucl(14),mito(5),cyto(5),cyto_mito(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59QB7 CCT-alpha Low 5 1 479-499 AQIAKPDDEKRRKYKNYGLDL cyto(19.5),cyto_nucl(12.5),mito(4) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59SL4 Uncharacterized protein Low 6.7 1 13-32 TFESREHKEHHSIRNKPPSS mito(9),cyto(8.5),cyto_nucl(7.5),nucl(5.5),extr(2) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q59X65 Uncharacterized protein Low 8.9 1 1-26 MWSKEEKKQKREKKMYVQPQQRTYYL nucl(14),cyto_nucl(11),cyto(6),mito(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A5N2 DNA-dependent ATPase Low 8.8 1 56-83 DPGSTKYVIQWRKKTSKKNKTWDGDGYA nucl(13.5),cyto_nucl(10.5),cyto(6.5),mito(5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AB15 Pre-rRNA-processing protein IPI3 Low 9.7 1 388-407 TTTNKADKKHRMIPQFKRVL nucl(18.5),cyto_nucl(13.5),cyto(7.5) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5ACI8 Peptidyl-prolyl cis-trans isomerase D Low 9.4 1 345-369 GLQEAKHNIKLRRDKQKKAMAKFFS cyto(16),cyto_nucl(12.5),nucl(5),mito(3) RRDKQK (356-361, prob:0.628) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AIA0 Tom20p Low 9.2 1 27-59 RNSADFRKSLKKREVKQKKLKAKKEAESKQNKL cyto(16.5),cyto_nucl(11.333),nucl(5),mito_nucl(4.833),mito(3.5) RKSLKKREVKQKKLKAKKEAESKQ (33-56, prob:0.986) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5AIA1 Glucan 1,3-beta-glucosidase 2 Low 5 1 379-405 CAEFNKSPDKWSKKQKKDYRRFVEMQL plas(6),mito(5),golg(5),extr(4),pero(3),E.R.(3) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) A0A1D8PDN5 Uncharacterized protein Low 8.9 1 188-207 QTNANKQQREHHHHHQQQQS nucl(12),plas(7),cyto(6),mito_nucl(6) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A879 Sphingosine N-acyltransferase Low 5 1 38-57 MPTTRSSRRRSIARLKELQD plas(22),pero(2),mito(1),cyto(1),E.R.(1),cyto_mito(1) UP000000559 Candida albicans (strain SC5314 / ATCC MYA-2876) Q5A927 N,N-dimethylaniline monooxygenase Low 7.4 1 425-444 ESLIKKRSETRAEKNARLKN cyto_nucl(12.833),cyto(12.5),nucl(11),cyto_mito(8.666)