ProteomeAccession	ScentificName	ProteinAccession	ProteinName	#NoLS	Positions	SegmentSeqs
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XM95	Probable alpha/beta-glucosidase agdC	1	119-144	AGKNNKIELRHDRKIRKERYNEAEQW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD41	Zn(2)-C6 fungal-type domain-containing protein	2	281-304, 308-335	KRMSTACTDCRKKKIRCEPGVGGC, RKVQKPCVIEPVKRRRRKKALSEDADAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDR5	Protein-tyrosine-phosphatase	1	681-703	LKWEEFQCQKRGRPLRRELEWAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PES0	DNA helicase	1	23-43	GTRGGRRQARSSSRPRGPPSV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH29	Prolyl-tRNA synthetase	1	22-66	CTAEASTGKQKPKKQEKERKDQKIAHKSKAQQQPAKKKQDGPELI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIB9	GRIP domain-containing protein	1	19-47	AEEQARQKKQQPLPGKRPQRRTDDPTTRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJQ9	SPX domain-containing protein	1	675-694	VYEKRFKAPKGKKIHVPVRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKG6	Uncharacterized protein	1	143-163	DLLKIRDAKRRKPSLNKEDPI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKP5	Uncharacterized protein	1	128-150	EGPKAQHPGKKQQKERQRPLMGE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQU4	Uncharacterized protein	1	91-114	SAAERKRQTRMKPGKDKEAERKDP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS58	Phospholipid-transporting ATPase	1	1306-1332	MEQFQKAIRKVRQVQRMRKQRGYAFSQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSU8	Uncharacterized protein	2	801-828, 838-863	DEDEYEKEQKRQRKKEEKHHKKELEEEE, GGSHEHRKSNSRSRERRGSNEHKSQS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSZ8	Uncharacterized protein	1	184-208	KAVERVTAKPKQRRKSISKKLMTTT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUJ3	Uncharacterized protein	1	143-162	YEKYRPPAKKRQQQATLAQS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW36	Uncharacterized protein	1	35-58	AIQTRSPKQCRERFHQNLKPNLNH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWC0	GTP 3',8-cyclase	1	11-37	STSRALPRALRRTRWPQSQVSKKRIAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX70	Carboxypeptidase	1	78-99	SKASFFSSPKKHTKKAHSEWDF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY33	AB hydrolase-1 domain-containing protein	1	340-367	SKRDQPKSRDASPKPKRRKGQEREADAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q032	Uncharacterized protein	1	63-82	MSSIKDHRPRKPIARQRTLT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q061	EF-hand domain-containing protein	3	1575-1601, 2033-2055, 2208-2227	RKLLRQVAPSKRPNRQKQRMSWQEWCY, DTLYWTRKFKRHLEAKKDARMTM, QSMRRSFTTKRPDDQRQPSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0V9	Amidase	1	399-421	EPLSPWLRSRVRRKPQKPTTEVV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q276	J domain-containing protein	1	180-215	FSRSTKENERDRRKEKIRKAEKDTRRDRDRKYPPHA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2W0	Uncharacterized protein	4	9-34, 118-142, 375-417, 564-596	DDYDEPRRYRNVRTRPRERDEPDYVR, AGYAAGRRDRSRRRGHRDDRDYDSE, IYDRVRSKSRKRRSPSNSSADSYVPSRTRQRDRRRSPNSDTGS, REIQGIEKRKAARRKKRVARQKQEERERHERMM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4N6	Tim44 domain-containing protein	1	327-348	GWTEKEERRRKREERDRKMGFS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q524	Uncharacterized protein	2	76-101, 104-129	RLAGRGGRRSRSRSRSPPRRDNYGGN, RDERREDPRRGTHRRSPSQDRNDFRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLH7	Protein kinase domain-containing protein	1	35-57	SVSSKPRPDKVSRQPSKHDKMGT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WND5	Uncharacterized protein	1	589-609	DSRMTEKMQRRDRYWREKLEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKU5	Uncharacterized protein	1	1-26	MSQLLSKRSRSKRRRASRYILNTSKQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJ59	Ribonuclease P	1	2-32	ATSPSHPAGIQKRSRKQRKTQGKKLDRLPED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJX5	Uncharacterized protein	1	111-136	LSRLRTRTGRMILKRRRMKGRNTLSH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE05	Glycosyltransferase family 90 protein	1	134-153	AAAYRKRRGRHPPPMFDMWF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGJ4	ADP-ribose 1''-phosphate phosphatase	3	9-32, 258-278, 291-313	QNTAVSQAKGKRKRSQQDVDVERY, VSPAPKKKSRGGGNARPPRAK, MQEAPPKQRRAPKRKALEAGEDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIJ7	Ribosomal protein L19	1	159-185	MDAKRAKTKAARERRQERIQTKRQALE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLW9	Uncharacterized protein	2	2-23, 261-290	FDSQKPRPSKPVSPRNSRLEAT, YVQVGRRRGFKHSKPHRRCFSWPEKRPDGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRD9	Uncharacterized protein	1	49-69	RKMSNNFKENRRRRRSSSLMY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSF5	Uncharacterized protein	2	946-967, 1084-1121	DEEGRELRRRRNRYGHDPHETA, PTGVRKGRPPGSKNLKPRKDIGIKKGPRKKPATSQATP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSY6	Iwr1 domain-containing protein	2	98-117, 354-380	TPEAGVKKKRKAKLKEDGIA, DDEYERQMNPWRKKTPQKFSKYLRGTD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU18	Urea amidohydrolase	1	735-756	CRGIGKRDMKFNDKRPRMRVDP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUU6	Uncharacterized protein	1	25-45	QPTQPLTKRDVRRNRIMEKLN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW18	Uncharacterized protein	3	58-84, 327-346, 376-416	ERYDNDKNDRRSDRRDRDRDDRRGGDR, KSPTRSSYRSQDDRRNDRRG, EDKNDWRSRRDKFQKKDRSESRSRSRSRSRSPYRAEQKEEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY48	Uncharacterized protein	1	150-170	DTPCHCPQCRHKRKVANTTLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYI8	Cytochrome b561 domain-containing protein	6	150-177, 289-311, 554-578, 757-781, 831-854, 952-975	FLYGWWFAKRERKRKTPHPTIPLRVHIH, GAYEWWKGRRDKRRDTRDDHYEE, AAGFREWNKRRKERNEQQRTDRIRQ, GAPLRQRTQSQSPSRRRDSRSRMHS, EAAAERATRRRERRSRRASSLSSG, VSAFDNNRRRRRAERARRAEAAKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYZ8	Protein-tyrosine-phosphatase	1	129-149	FFELQKSPPPRKGRNLKNLAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZI9	Uncharacterized protein	1	421-441	VEFKRKRIEPLPYKRLKEERY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2D2	Uncharacterized protein	1	242-263	LSRERGTLRKRRTRLRHGDFQI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2P2	Uncharacterized protein	1	1-20	MSRRRPHRRRMTLDTGHDTI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3D9	Uncharacterized protein	2	15-34, 467-490	SNTFICKRCLQRQSNIPPTY, WIPKRTMKLVRQATKQIRHKQVSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBP3	DUF1746 domain-containing protein	1	26-51	VLTPAQIVARRKKNRENFNKRRGELL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCS0	Uncharacterized protein	3	15-40, 57-94, 222-245	PDDAFKKGKASPKRRQSDRKDSAQDD, SSESRRESPERRRSRRSEDDRRRRYSRNWSRSPSPRRY, ANGKEPGRRHSRDRRSHHSRSSAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE49	Uncharacterized protein	1	74-122	HTSTETSGKKRKIRASQACTQCATIKVKCDQEKPCKRCKTKGLDCRVDC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGD2	Chitinase	1	629-657	VATPSAPMKKRRGVRRGLRGEWRPRCREV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIS3	Uncharacterized protein	3	40-67, 199-225, 484-512	AEPPPPPRPQPFKVKRKRVSSVPFQEPN, LQTPTRNSPKSKRVKTRRDIKWTPQMD, EFKIGAPTDRRSRKRRFRSDEEKPRRLPL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJF1	Uncharacterized protein	1	219-245	RLMESERELKRQRRCRQRQTSLPTPTI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJF8	Uncharacterized protein	1	358-381	LQDGPVARLKKRNKKVDDFYNLFA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKB8	Zn(2)-C6 fungal-type domain-containing protein	1	32-64	STHQKRTRNAIACQRCKSRKQKCSGQIPKCFSC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKG1	C6 zinc finger domain-containing protein	1	6-31	AVLSCQQCTRRKTKCDKQLPTCTACL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMM6	Uncharacterized protein	1	146-169	RSVLRKSARSPRRHDKQTACCVCT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRY7	Uncharacterized protein	1	336-362	AASSAQRQRSRSRPRRKPVEVKQEVPD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PST8	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	1	79-101	RRIQVACSRCRRRKIKCTGDPGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT21	Uncharacterized protein	2	569-590, 661-683	SHNDLQKHKREYHRSQQQIKAD, TIHNGRKQKVRCPMCREEKTFSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUF6	Zn(2)-C6 fungal-type domain-containing protein	1	41-68	LASQACSSCRKQKRKCDKQMPHCGLCQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUR6	Uncharacterized protein	1	568-597	NETTKGDGKHWKKHKNRTRRKAKQATAAVD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVP4	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial	2	12-31, 112-131	LVLRRRTCPIQNTRYTRSRP, IVGRPKKRARIRPSGPWSVT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXZ0	Phospholipase	1	327-346	VLRWNFCKRDKYKRDDRYDW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY25	Uncharacterized protein	1	103-125	WEEARREREEERKRGRRRRSREG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0N6	Uncharacterized protein	1	578-597	AKQSLKSKRTFKPTFGRKMK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1V4	Nudix hydrolase domain-containing protein	1	122-142	VETRENWPERHKRERKWMSYC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIV9	Uncharacterized protein	1	31-52	QRDWYIVPKQRKQNRRNAHMQS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKA8	Non-specific serine/threonine protein kinase	1	629-654	GAEPKKKKATRGKRAGKKHKEKENAL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBR6	Uncharacterized protein	1	34-53	RCTSRSMKVKTTQDRFRRFF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE08	ABC transporter-like protein	1	1529-1560	YYFFRVRTSSKKSKTSKSKKNDKSNEGPNADQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGB0	Uncharacterized protein	1	367-386	LGSGQKSNGGNNKRKRKNSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIG5	RRM domain-containing protein	1	146-165	RDYDRRDRDRDTRRDRERTR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIJ1	Sterol 3-beta-glucosyltransferase	1	121-163	GGSGRSTPRQHERKKSSDSKKDKGEEKRRRRKLSETKLVRSFL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJQ0	Uncharacterized protein	1	258-280	EPSVKRRSTFLRKKSSRSRLSKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMC3	Uncharacterized protein	1	244-279	RPPTYHRRSREKDQSPWRVCIDRRKAQRKHPQHDFS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ31	Uncharacterized protein	1	446-465	IKYRQPEPSHQNKPNHNHDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSN9	Uncharacterized protein	3	112-134, 139-163, 167-189	LAAPAKRGPRKPKKASSPAQDND, AEVMPKKRGRSRKRPSPENKDRPGA, QTVSTVPPKRKRRGRPGMNLLSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTK3	RING-type domain-containing protein	2	73-93, 305-329	LAQNKELKRLRKQAERRKLEE, QEDVTPGRKSKRKKDAETGEKESKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU04	Uncharacterized protein	2	287-306, 500-529	VTKARNQRRREQRQLKVLKE, FQQRWDPQYRLPKKKRNKRRKVEANGAAHA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVV4	Uncharacterized protein	2	278-300, 486-512	YEGESRERRRRSSKSQRGEGDTI, DSEGDMRHKKKRHSKPRGSRSRSASIT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX77	Histone-lysine N-methyltransferase, H3 lysine-36 specific	6	55-81, 102-121, 190-213, 544-569, 671-693, 745-764	DTSTPPTTKRSSRSPNKYKRAPDSPIV, PPKLARSTSHKVEKRRPQLF, GDCGCGSKCQNRRFQRKKYADVTV, RFDRRDDDRRRSRSRSRSRSPERIQA, TPIDTPKKERKEDKWRTEPEEKQ, PNKISDKKVKDLRKHAQQFF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ03	DUF4210 domain-containing protein	1	480-507	GSASDAARQRRRQKAKRRSGSPKAPPGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZU7	Uncharacterized protein	1	17-44	PHNMNMGQKQNRKRVRHRPMRGARTQDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q067	Uncharacterized protein	3	92-118, 210-230, 613-632	EPEAPGYYSQKRRNVKKRKVEAEDEDA, MSTLRLPRLRTQNRRSKREHH, LIAGQKKVARHAQRSRPRMS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0M6	Uncharacterized protein	1	22-76	STTGEAKEKEKRYKCQFCARAFSRSEHRSRHERSHTKERPFKCMKCRSTFVRRDL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1E6	Uncharacterized protein	1	32-59	VGQSQQQTHRQRQQRDEEKKQHNARSPL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2R2	RING-type domain-containing protein	1	79-98	LVKQYRRKTHEYRKKWDDRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4L7	Endonuclease III homolog	2	86-110, 339-359	GESSPSSTPKPKRQPAERIKHEDGT, AVAGSPRKRKVKKEVEIEVKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5C0	Uncharacterized protein	1	316-342	RTCLLFPRPKTKFFRQRCLHLHLCRKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNQ6	Protein kinase domain-containing protein	1	568-603	RGYVPPPRDEQRRTRSRSPDRLRRERLQDRERDLYR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y367	Zn(2)-C6 fungal-type domain-containing protein	1	1-40	MPRPKKETGVEPKKRSRTGCWSCKARKVKCGEEKPVCSNC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3V8	Uncharacterized protein	3	28-48, 62-116, 128-152	DGGFHRPKNQYVKERRKSDAA, DGLADRARAKKHKYKRRAADEHDDEPAPRPSAKQDRRRSRAQTPGPGRRHKRGCG, SSSASSRSPKKPSARQRSKNYGGAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YHY8	Uncharacterized protein	1	217-237	GDNAMQHKRRPRGAKIGHREC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLN0	Uncharacterized protein	1	1927-1953	KDGYQTCKEVRKWERKNKYPHLPIIAL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLX3	Condensin complex subunit 1	1	877-898	LCEQDFKRRKADKEKSNPPASA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMU5	Uncharacterized protein	1	473-499	MLIKKAIRESRRKRPKQRPASEVRPRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQB7	EngB-type G domain-containing protein	1	337-358	LENKPLSQSKIQKERNKGRVEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU66	IFRD domain-containing protein	1	334-358	ERLTRESSKRIAKRDRKQMHTAFRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW06	Uncharacterized protein	1	72-110	PPPTDPRRQHAREQYRREVRDVARRHHRRKEREANLPVD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWR0	Uncharacterized protein	1	54-73	SKQARPKKLTHAQRLRQERA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXY7	Uncharacterized protein	1	206-225	NNTSRVDRTAKKPKRPALGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY86	Uncharacterized protein	1	6-29	REQSPAAPRSAKKRRSNTVTTINA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYM5	Ribose-phosphate diphosphokinase	1	88-109	VMPYFPYSRQSKKKAHRGAITA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1E0	Uncharacterized protein	1	133-155	GEGRSKEERGRSWRRRRDGAEGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q215	SAP domain-containing protein	1	195-214	NDGGIRKRSKVRPVKKGGGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q262	A_deaminase domain-containing protein	1	3-22	VVDKLKDKFGRRKAGQQVTV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4V8	Rho-GAP domain-containing protein	1	655-683	PAPSEDQAEKKKRHRWRFSRSQNKIEEPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI60	MFS domain-containing protein	1	546-566	SVKRPSTTLCTRKPRLFQLFR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKW3	Uncharacterized protein	1	14-39	TSSQHAQSYRRRHQSRNKKSDPFLDL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKB9	Uncharacterized protein	5	15-37, 144-163, 216-246, 369-390, 1038-1062	PTPQSRRQATSKPAPKRGKATLF, LATGKKGPSKRERHIRILTH, ELEAKKRETAAKNRRKGRKGRDTSKARDWGY, TEEADPKKTKKERKAEKEDIME, VANKANSQQPQRKSKARKAALTPPV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKI9	P/Homo B domain-containing protein	2	73-100, 753-774	HDQIKAQKADLKRRRRKREAGAELPHVL, LGIWAFCYRRKKRVARDDFAFE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSU7	Uncharacterized protein	2	476-496, 1075-1094	IGPVSRWKRKRQEAAQAKRDE, YFLAKPIRRPQLKKVLKEYC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXL7	Uncharacterized protein	1	35-54	QERRTLKVAKRKTNHQEVRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1W6	Uncharacterized protein	1	87-110	AKHLAPRKRTILRRRRTSQRSTSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q362	Peptidase A1 domain-containing protein	1	25-47	GDYTVSRIPRQRQKAQPSELKIT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WHS7	Uncharacterized protein	1	233-259	QAMWFEKFTKKKERQRNRDQRHAHEIQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XM31	Uncharacterized protein	1	91-119	LEKPFPPGEKKRAMKRKRTSMPGEPYPRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLR5	TAFII28 domain-containing protein	1	92-124	PASTDAFTKKRKRGEKRPRGRPPTKQNARQGSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMN3	Uncharacterized protein	1	322-342	MRTPMSGPRSRRRREANAVRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBN6	Uncharacterized protein	2	1-27, 60-79	MAPPSRRNARRDAKTERRRQDRDGDLN, INKTNQRKAVPTRNNGKPLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCZ0	Uncharacterized protein	1	1-25	MPKALQKRGRRMKRKHEDDPEDPVQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCZ2	Uncharacterized protein	1	142-164	DEVARKEYMRKNRRRPIEQTVNE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE01	Dynein heavy chain, cytoplasmic	1	470-492	ADKFIAIKIKKRHDRTQDRISYI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE25	PPIase cyclophilin-type domain-containing protein	2	209-229, 256-281	DSPPPPDKARRSRRQSDNMID, VSDHSPAKMHKRKRSPCPSRHLDQRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGQ8	Uncharacterized protein	1	275-295	RMPSLVSPCRRRKTCEQREIS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK45	Uncharacterized protein	1	159-184	ELLTVRRQALRRRRARYGRNSADLKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKH8	Uncharacterized protein	1	3-26	SRPIEEKKRLRDRFSKAMGRKRSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLI6	Uncharacterized protein	1	175-198	RPSSPTFKPKRPSLPRPESPFRRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM89	DUF3824 domain-containing protein	6	81-104, 393-426, 461-480, 571-592, 641-661, 891-920	DVEWKFSKRTYERNDPPKREHDDV, GSKSRSRSRSRSGERQRRRRHHRSRDRDDDKQSF, ADGRHGRRSRSRRRRGSVDT, DEIGRGRRRHSRSRSRSRSVPA, ADSSPDTRRRRSRSRGKEFAT, HSDTETSDDRKHRRRKRKGKDREADPFSHE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMM2	Uncharacterized protein	1	1980-2007	LLLAKTSKPTSPKKQKPQGRDLRVPSNA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMQ7	Zn(2)-C6 fungal-type domain-containing protein	2	14-40, 49-87	PVAVWSPPKHHHHQQQQQQPQQHRHMD, QHIQHTTPPARPRRERPCDGCRRRKSKCVLQENRRCVLC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNI6	BAH domain-containing protein	1	281-303	NEKPPSSSKRKGAIKKQEPQNED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNL6	Uncharacterized protein	2	209-231, 241-263	CTTTCKRSHDLSRHKLRQHRLSG, TIIYRDDKMRQHCRKQHGQNFGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP97	Uncharacterized protein	2	838-867, 958-978	RSSDSDPDRERRRREREQRQREREARNGGG, EEKNNKPKGILKKPTQKFPED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPT6	Uncharacterized protein	2	120-140, 522-543	IAPTTSKQSKGRKKGPEMIVT, MSGGRPRGRSMPKKKLPPPSPL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQD5	BSD domain-containing protein	1	598-625	KREDQLYLDRTKKRRRRNFDDYPGGKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQT4	Uncharacterized protein	1	235-257	YLVERARERRRQARQLERPGLRF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRK2	Uncharacterized protein	2	172-201, 271-296	QKEQTRQRNAWTRPKKRTRRSKAAKRAAGS, NVSPDRQHRYRHRRGHSRSQPQLRQM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW05	Zn(2)-C6 fungal-type domain-containing protein	1	42-68	IESACSACRRRKSRCDGQRPTCSRCQN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW88	Thioredoxin domain-containing protein	1	41-61	TVPPSAQRRQPPPPPARPQLP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3M0	DNA ligase	1	105-128	ENDDEPPTKKQRHKASATKKGLAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q484	WD_REPEATS_REGION domain-containing protein	2	12-32, 156-178	LSKKAKLAELKRQRELRQKEF, VNSADRSRSRRRKMLSQRERELE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHV8	Uncharacterized protein	1	135-184	IQAMRNTPPKRQQQKPETPKSKGKGRCKASGKKTTPRSLRKPDSKRSVPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIE8	Zn(2)-C6 fungal-type domain-containing protein	1	34-65	MLLPSCQNCKRRKTSCRYGTLKRKPGPAKGQS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBJ5	Uncharacterized protein	1	263-282	AFLLWDKRRKQKKYASSAMG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCK5	Uncharacterized protein	1	215-234	ESSEPKQKDILKPGRRPRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCU0	Uncharacterized protein	2	55-79, 350-370	QDQPSWKRRMSTREAKKKRHFDDIE, GHFICRSCQHCRPNQRRSLSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFB6	Bromo domain-containing protein	1	964-1014	DEDLPAKQRFPKPRLPPTGKISSPRKRPLKEQQQAAKKKRKLEESEGKAKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFN7	RNA exonuclease 4	2	9-31, 349-371	LSSNWKELQKKLQSEKKQESPSN, GDTGASGAAKRKKSKKKKRTKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFU0	Uncharacterized protein	1	466-486	QLGFRETRWWKLRRRMARSDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGP4	Uncharacterized protein	1	365-393	RTLHPEKSIEPSPKKRKAKSLHRAPTIHE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHT2	SAC domain-containing protein	2	689-710, 877-899	ADPHRHHDSPEKQKPPRKGVKI, VEDLPKRRYKAYRQWLRGKSLFK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLA4	Uncharacterized protein	1	459-481	LAPAGARKKPQLRRGQMKPEDSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM17	PH domain-containing protein	2	885-910, 1206-1230	NRTGRGSPTKGHRRRRRSPDLTPIQS, VPRLYITTSKHQRKRSNTGPQHLSQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP91	Zn(2)-C6 fungal-type domain-containing protein	2	31-62, 659-687	HEPKEAMNCKSCRKRKIKCNRLKPSCEACQVF, QPSKQNHHPNAVRKTKKRRSTTGSQPYPT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPF2	Zn(2)-C6 fungal-type domain-containing protein	1	1-38	MTIPIVRKRAKKPKTRTGCKTCRQRHIKCDEERPTCRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR70	RING-type domain-containing protein	5	671-699, 701-720, 730-764, 778-821, 920-950	SDETYVRRKERERRKRKERDDRYDEERNG, RDAEKSSKKHRSRSESRADD, DDEHRSSRSHRDRSKDRRHRRHRSKSPARESEAQD, DDYDERKESRRSNKHSKREDNYHEDERKDRSHHRSSKHDRSSRD, IDAPRGPKGDRGRVKKGKKERRIGYKYEDEV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRC2	Uncharacterized protein	2	366-395, 2976-2996	AERRDDRKHYIQLFKKKKREEKLTPDENND, FQDARRMSRSRNRPKHALYGI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRS1	FAD-binding PCMH-type domain-containing protein	1	487-506	LKTLKDIKKKYDPDDRWRTV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVL4	NADPH:adrenodoxin oxidoreductase, mitochondrial	1	430-450	AEEVKRGKEKGKEREKFRTVG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVU6	Uncharacterized protein (Fragment)	1	390-437	LNVAPKPTRTPKPKPKPRDFALPSKGRYIHKRGPYRRRRPEERPAAPL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXY3	Uncharacterized protein	1	10-34	DNVKKLFKGLFKRGKNKKQDTSAAQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY87	PHD-type domain-containing protein	1	681-701	TLEICDRKKCARHHEWSKLAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYF6	DUF4604 domain-containing protein (Fragment)	1	151-177	NEASTTKVTKKVKRKAKPVRLPFDDDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYH4	Uncharacterized protein	1	316-338	PYNGRFAQKSWQRRPSNNNFNHS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYX3	J domain-containing protein	2	191-213, 953-977	SDYFSLRRKKLEKLRRKELEAFI, IATCDERKWGRNRKRYLTHDRKANL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ39	Uncharacterized protein	1	11-30	STSVQFRREHHRHRLPPSIS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q466	A to I editase domain-containing protein	1	18-41	FDTLQPRYKPRTLPHRQREWVPLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMM0	Uncharacterized protein	1	250-273	WSYVRSWWIKRQWEQEKQREKAKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKQ8	AAA domain-containing protein	1	13-58	GGPGDDKKKSGDKKDKPKYEPPPQPTTRIGRKKKKQSGPNAAAKLP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNC7	CYCLIN domain-containing protein (Fragment)	1	311-333	VDEHEAKRRKLEREKRAKEDPFG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC16	Dihydrolipoyllysine-residue succinyltransferase	1	106-148	EEPKQESKPEPKKEEPKQESKPQPKQESQPKKDPKKEDPKSTE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD63	HUN domain-containing protein	2	73-120, 487-511	NGSTDPPAKLRKQRKPREPKAAGDEKPKEKKPRKPREPKVKKEIDAAP, GQTTAEGKPRKRRKKVEEYDKEDDF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG19	SH3 domain-containing protein	1	163-190	ASATKERPPRKSRHTERRLKRSQTKDLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG94	Uncharacterized protein	1	59-83	CGLRLTSRFKAKRRKLNQGIHCQLQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGG3	Uncharacterized protein	1	297-320	HEDMLDRRTKRKHLPVEQRPSQIV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGV0	Uncharacterized protein	1	301-322	LSSIRSKNRKTAKSRRGGAVRQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIM7	ATPase_2 domain-containing protein	1	66-85	TQEAKKIPRKHTFSKLPGFH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJU4	Kinesin-like protein	1	640-664	REKGLRSPSKKMRVLKTRKWDGMEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLN6	Uncharacterized protein	2	150-169, 280-299	EIAKRTKKMNKEKANRGDQG, HPDWRECRLAHRQNRFEEKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNU1	Uncharacterized protein	1	68-93	GGSCTNSSRRHNRQRRVQQNPRVTSQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT64	Uncharacterized protein	1	1320-1342	RNLGTMRKAKEEKRKEAQADPND
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU09	INCENP_ARK-bind domain-containing protein	2	1118-1137, 1206-1228	AHPSKFKTPSRPAQAPKSAK, DEVFKNSKNQERLKRFRDRGSSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVJ3	MFS domain-containing protein	1	507-528	IDIMFKRKIPARQWKKTVIDIN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX34	Uncharacterized protein (Fragment)	1	4-23	SGHSRWSKIKHEKAKVDAGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXL4	Uncharacterized protein	1	50-72	QEQTPGRERSKRRKTEPAVAPLI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXL5	Eukaryotic translation initiation factor 5B	3	44-71, 131-164, 298-326	GGLLAALKKNKDKRKKKGKVVENDFVEG, EGGGVKTKAQKEKEKKEREKQRKKEQAAAKKKTV, GDSEPKKPTTKDMRKKNPRKEAEERKAQQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYA2	Ribosomal_L18e/L15P domain-containing protein	1	270-289	GKKDSKKASAGKQKTQAQKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ92	SET domain-containing protein	1	397-418	SIKFWTRKERAQWRGKDGRRVV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q027	Uncharacterized protein	1	306-326	GHSARSRPKSTSPQRSKSKQT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBY0	DNA ligase	2	1-23, 665-688	MSTPNKRRKKNDHQASPQQVKSL, ATKPAPTPKAKKGKKSKATTSGQD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCH1	Uncharacterized protein	1	348-367	TPPMRIKYRKFVNKNHQDIT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE60	FHA domain-containing protein	2	24-44, 58-131	RGSDRDLEPRRNRRSDRTSSD, DDSRSGWKDYRRRNRDRSGDEASDEGRDLKRHRRRHSRSRSRDRRERRRSRSPPAKKRRSRSRSPLKRARGPLP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKF2	Zn(2)-C6 fungal-type domain-containing protein	1	10-74	NGNSSSSSNQQKRQRAKQACEPCRLRKRRCDGNLPCNMCTQFEYKCYFEKHPRKRSKLVEQHALV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMX3	Uncharacterized protein	1	60-80	PAPKTPTKLTRRPGQTPQKSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN64	RRM domain-containing protein	1	213-233	SREGGRRRRYRSDSPQKDRLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNT2	Uncharacterized protein	1	109-130	RQSPTMVRKKEKRRVSKDQLAL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSH4	Uncharacterized protein	1	1506-1529	ALAADIRQKHRRRLERQHDIESTR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTX7	FMN hydroxy acid dehydrogenase domain-containing protein	1	52-71	NNTAYRKYRVRPRVLRDVAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q051	Uncharacterized protein	1	37-56	ETKDKELKDLQRKKVKQLDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1J6	Uncharacterized protein	1	266-289	TATQSEQKVKTRRRPAVPDPRVNM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q268	Mitochondrial Rho GTPase	1	403-429	GTTPALKVTKARKRRNKPGRVERNVFL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2L1	Isoleucyl-tRNA synthetase	1	720-740	LTAPRGKNKNRSKKQAPTGST
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XK78	Brix domain-containing protein	1	3-52	STNPNKIGNKIKRQEQHLKAKKLKESTKRDDRLRRRRHEDKNPHLRVQRQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XMK6	Uncharacterized protein	1	187-208	SRDAKGRDANANRKKNNKKGRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4N5	Uncharacterized protein	2	1-22, 69-109	MAKSSRSSRLKKNNAVLKKKVF, DEANKPKKSQREVKRLQDARKQRRERSSHRKPRNQVAFPSH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI00	Uncharacterized protein	2	12-32, 441-467	SAVGHAKKRRRTISNENANPP, EKAEMVAKAPPKRSKRRIREAAIAAVK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKJ6	Uncharacterized protein	1	13-32	STTASPTKRQTQVRTKNYSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBG7	Zn(2)-C6 fungal-type domain-containing protein	1	31-56	LKVMRACDGCRKRKIRCDGALQNGPW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCW6	Uncharacterized protein	1	1-27	MPSKLSKVTKRVTKKKGSKINALHENS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDM4	ATP-dependent RNA helicase DBP10	6	428-454, 712-736, 782-805, 851-876, 927-971, 985-1010	DAAKKANAPKKNDKKRKRGPDTPSAKE, IQAIKRRRAKMESKPKKQKDEDSDA, SAPEDPATRHKKKRTTGKDEEFFM, KEATKAKGLRWDKKSKKYVARANDED, ANNEGGKRFKHKQERAPKEADKFRDDYYKRKKKVDAAREKRVGKF, VEDVRKLRKLQDRRKEKNARPQKRGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE70	Mannose-1-phosphate guanylyltransferase	1	1396-1417	EGAPVVPRGRRRRSPISTLQSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFB3	SEC7 domain-containing protein	5	75-106, 506-527, 1695-1716, 1774-1800, 1940-1980	PSTPPAAKPRSKGKGRKLLKGPRETRHQRDIS, PALSKKPSSFFRRRKKSTSEAF, LPRPRNPPYRTPTPKNSPPPDQ, GELPSSPQSPRKRLKRNPHLSKVYQVS, IAYARSQKRRKAVEEWKAREAREARQRRINRRRGASRELDV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG91	Glycoside hydrolase family 13 protein	1	485-507	SIWLFWKRHIHLRKKYKELFTFG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK32	Uncharacterized protein	1	65-84	INPPRPQPSRKERSARISNE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPP1	Uncharacterized protein	1	346-365	CVCCVPRDRNHKGARCHVGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ05	Zn(2)-C6 fungal-type domain-containing protein	2	9-37, 63-85	KPDSISKDDKREKRTSRACLNCRSRKSAC, IGSSNRGGRRVRKRPLDQAKILD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQP4	Zn(2)-C6 fungal-type domain-containing protein	1	10-43	VRKPTVRAPKVGHKKSRKGCQTCKIRRVKCDEIA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS01	CDT1_C domain-containing protein (Fragment)	1	26-50	ALAPSLSKHWKKRSVRPEDIQRILA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUG3	Potassium transport protein	1	123-146	VLAEREKRRQVQRGRSQSRGHRCG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVF0	Uncharacterized protein (Fragment)	1	160-189	ELQQIKAKWGRRKRDARDARQERKKRWGMD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW25	Uncharacterized protein	1	26-56	GYDVDTQQHKRRQAQPSRKNHIRNYRHATTR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXQ9	Uncharacterized protein	1	234-255	QPPAYIKVRGKYKKNRDFDRLF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYZ9	Uncharacterized protein	1	115-139	VRSAVARRTRKPARRQPGLRSARKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1I5	Uncharacterized protein	1	502-524	FPATKVYYSWRNQRRQRVWEGMS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q209	Uncharacterized protein	1	74-95	NTTAAGRKRSRNQLREMRQPQD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2C5	C2H2-type domain-containing protein	2	1-24, 122-143	MSSAASHPRRRPARPNKPDMTPSL, VDRTSRRIQSQRTRTRHHSHSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2U5	Protein-tyrosine-phosphatase	1	44-66	FPYPAKQSSRSPNKRSSRAQAGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Q8	rRNA-processing protein	1	95-121	EKMAEKMHKKRVERLKRREKRNKMLKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Q9	Uncharacterized protein	1	26-45	RPPSHPSRLRSKTPRYQYGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q481	Uncharacterized protein	5	1-26, 35-54, 93-112, 239-261, 307-355	MPDYDDPLPRRRHRDRRPLPPDDYDD, GYYRPSTKPRDTRYDEPKLS, GEDRKSSSRKKAPNDNGPSP, EGDDRRRKPSRPDESRRRRQAYP, RESKRDRYRDDDRRAPPRRDDRHRDDYDDYDRGHRGSRRDRKSSGNKLD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4N7	Uncharacterized protein	1	263-282	LKTPTKAPRRQRASPPRATF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIR1	Uncharacterized protein	1	178-198	IKAVISPRPPQKKKSSKCAIL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGR2	Uncharacterized protein	1	232-258	KPINVARRNRPPPKKKGGPGRGKKRVT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM41	Uncharacterized protein	1	4-23	LERPRKSTPYHLRKSWHSHV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDQ9	GTP binding protein of the Rho subfamily of ras like protein	1	173-192	HATRAALLTRKKEKKKCSIL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFB4	Uncharacterized protein	1	69-94	QEERPVKRARIDRDRSDRPRRHVDTL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFE8	YL1_C domain-containing protein	1	20-50	LDLHKIQKPFRNPNWKPPQRRNKNLKQILSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGN2	Uncharacterized protein	1	39-59	PAKAAPSKPSPERNKRAHSEV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHA5	Uncharacterized protein	1	31-56	PSMPCGIHKRPKRAPAQPRDYRDRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIN9	Uncharacterized protein	1	156-176	LPDVKQAWRGKKPTKEPVVEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIT5	Zn(2)-C6 fungal-type domain-containing protein	1	4-38	VVKNGRVRKRAPNACVRCRKQKIKCSGNVRCEQCV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIU5	AZUL domain-containing protein	1	658-677	DPENKALRRRIERRYLQQLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ50	Uncharacterized protein	1	198-222	RGCHCYSKAVPKKREVRRSVALRRI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQC9	Uncharacterized protein	1	299-319	GTDDRRPTSKRRNSRQHVDEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQS6	Uncharacterized protein	1	400-426	HSKHQPPSNPEKTKSHRRSASEKLRGM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR63	Protein kinase domain-containing protein	1	197-218	DTPMVWRKRSVKTQNRSRGNSL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRL9	UBC core domain-containing protein	1	705-724	NTTHMKRTQKEHKILRNPST
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUR1	Uncharacterized protein	4	15-51, 83-109, 172-192, 696-720	LKDTLERRKGLKKIKQKQQLKAKKKARRAEEEGKDGS, FEVPELPKKKGSKRKRDQENDEKSDSE, DNDDDEPKRKKRRSDNSDDEM, VVEQGRKEEERRRRKDKDVKAGAGE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVR4	SprT-like domain-containing protein	1	345-364	KSGPKKRSYLWIPNKSLCRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWP0	Amidase domain-containing protein	1	6-27	DFFEHRAACKRKQDERASRIAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWP6	Uncharacterized protein	1	181-206	ENGIIMPRKGNNRRRARRARAVGMTP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Y1	Uncharacterized protein	1	16-41	ETALMPPPPAPKRQRRPAKVLDEDVY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2G5	Uncharacterized protein (Fragment)	1	150-169	VRPSWFWTRRRWDEHRRGLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3V1	Uncharacterized protein	1	232-252	ATDRRDRLRERRRRENEWVSL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5F6	Rif1_N domain-containing protein (Fragment)	1	273-294	ILLFRHKKRPIEKWPKFKQWLQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL40	Uncharacterized protein	1	1567-1586	TLKPFIKSPKPEKKAKIEEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMV7	RRM domain-containing protein	1	732-762	QPEFKKLMLTERRRRRQEREKGKRQLERFAH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBL1	RRM domain-containing protein	1	132-170	RAPLTNTCRLWRRRRRQQLAPGRWRRRLRSARRLWWRPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG12	Arrestin_N domain-containing protein	1	67-86	KTTAHSKRRVQQGKNHHVTH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG82	Uncharacterized protein	1	160-186	LPLPHDHHKHRCVPRKNHQENHPRYTL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGP2	MFS domain-containing protein	1	459-485	CALFLKWLLKRANKKLRERNAEAHVFY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ02	Mediator of RNA polymerase II transcription subunit 17	1	580-599	ITIYCKTTRGNEKKVWRLDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKQ4	Uncharacterized protein	3	36-70, 342-365, 688-712	AFGGGDTPKPKKKRHRGGRNHKRKNRRQSFAATSE, HADRDSSNNRRRRKRAKVWPDLDV, GKVSPSQKKPAQRPKSQGKGNNQAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKS7	Uncharacterized protein	1	184-204	ALVLLRRRRKRQEAAARRAEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKU8	Uncharacterized protein	2	47-68, 474-493	FLISRAPKRVQKQTPSPPRYEK, SLYKVGKKRGWWRGIRNGDV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM86	DNA-directed RNA polymerase subunit beta	1	1134-1163	QYGGRRREGGRTRCRRCSRKALSTDPKSEC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN06	Aurora kinase	1	371-393	PWIVKHCAGKKEKKQSNEGVQFV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ96	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase	1	316-336	SQLWTKARTKNKKQYPIRVVY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWT4	eIF2B_5 domain-containing protein	2	59-81, 93-117	MFEGLAKKKKKKSASKEKAADED, DVDLSALKKKKKKKVKAPEGDDFEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXV7	SRP9-21 domain-containing protein	1	33-58	IPYLNEPKYQQKLRKRKRDADDDQGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYH5	Uncharacterized protein	1	285-312	PGPRPLPPALKPKRKNEKWSGRRPWGAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYM7	TRP_N domain-containing protein	1	767-792	VNDLPRPPKPVKEKKKKLEPEPEPEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Q3	Uncharacterized protein	4	67-92, 109-136, 283-310, 617-639	EAETREKEERRKRKDAAKKARDLAAR, EIDTRTWLLQQKKRQRKIDKARKLEEEL, DPSTIKVKKAKKSKKEKRTRHKAADDDD, KGSGKGKTEKRLKKIEDEKKSAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1N5	Uncharacterized protein	1	1077-1102	EEIASPPSPKHKQRRKPLYIREGGSI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Q0	DNA-(apurinic or apyrimidinic site) lyase	3	312-336, 359-380, 390-418	DDEEEKKPVKGRKRKSKADVDEDDE, QSTPTPPKTRGGRAKKVKDEAV, EEEAKPTKAKKPKAAAKKAAKTAPKKEVK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q551	rRNA-processing protein EFG1	2	10-36, 222-249	SNNDSRDSYLRRKRHKPNAFQPKDPEN, VKELMRSVKKVRKDKKKDSRAEGQKAVM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLM6	H(+)-transporting two-sector ATPase	1	121-143	AVPALDRKRKWKFTPSDKFKKGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC61	Uncharacterized protein	1	167-189	EEVERRRKEKLVKKLRKHTVIHH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD23	Uncharacterized protein	1	167-189	ENYPWGKRSRSRKRPEEGAHLPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEU6	RING-type domain-containing protein	1	164-186	ALIRSCNKCKKQFIKDHGCNKMT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEY3	Uncharacterized protein	1	566-586	SPYARERKSKPARKPDGDRPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGB5	F-box domain-containing protein	1	173-192	KSHGRKHYEQHRRKNSRASE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH80	Uncharacterized protein	2	10-29, 253-281	STTREFPKRFNIQKHCPTAP, STSRKLFSRNGSRKDKQQKKVDPEPVRDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHQ4	Zn(2)-C6 fungal-type domain-containing protein	1	134-157	GLTCEYARERKKRGKASRRDIAAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL23	Transcriptional adapter 2	2	152-175, 469-491	TIPREEFQQRKKRRIEERKQAIAG, REAMKNDGKLKKKNVREISKIDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL86	Glutamate-5-semialdehyde dehydrogenase	1	434-453	GTGAGKRAYKHKKLELPNGI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVA7	Chromatin modification-related protein	1	272-310	KAQPAPSKKGPPQSKRRTRPSGGTKKSDRRRQLARDRAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVJ7	Glycosyltransferase family 31 protein	1	364-388	RNNHITAQRRSRRRAARYGARRATT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW56	Uncharacterized protein	1	250-273	RWYNEGMRKRRHVEKGRIPKQTWQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWM3	Uncharacterized protein	1	121-143	ALDSPRRPEFKRLRRRSTIEWAN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWZ4	Uncharacterized protein	1	11-30	DDSYDLRRRRREEARVHARE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXV9	Cyclin N-terminal domain-containing protein	1	123-142	SEVQHPKKVVPKKSRVLRDP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY21	Uncharacterized protein	1	108-127	IPEKKASRGRRGIKSFLRPT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZI1	Bms1-type G domain-containing protein	5	3-32, 174-200, 314-336, 765-786, 1055-1117	GEEQTHRAHRPSKEKKAKDKSQPNPKAFAF, DLFRKQDTLKAQKKRLKHRFWSELYQG, LREKQDPSTKKRRRLGDKQKMIY, FVQVRIKRHRWHKKILKTNDPL, QVMTLRKEKVEKRRAKQEERRQPHRAKVAENESMRKEREKKERDDFWRREGKKRKGWSDSADG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1S3	Glycoside hydrolase family 64 protein	1	5-31	VEGIRSFVKRHLRKHHHQPARESKYYS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q444	Uncharacterized protein	1	52-73	KLSALAKKYYEKKAKKTSSLSV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGQ7	Septin-type G domain-containing protein	1	64-87	SVNAVNSPRRLRRRKDPTPFNLLV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YPL0	Protein kinase domain-containing protein	2	59-82, 132-155	APTYQSPLRHHRRAPSRSKGVKET, VKEFSKSRLRKRAQSNLLRNPKQL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG31	Uncharacterized protein	1	122-149	RPENSSRYRSWQRCRRRAWNRIAERMPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJC3	Uncharacterized protein	1	119-144	DSVTSDSQRPSKKKKGQRFFCTEFPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKB7	Uncharacterized protein	1	36-66	YGKVPRTSSRKTKPTEKIRKPEKPKEPDAGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKQ9	Uncharacterized protein	2	14-49, 106-128	DVSETSSKKLKKEKKEKKEKKEKKEEKAKRAAVQDS, AAAKAEKKAKKRVEKAVKKAAKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRA2	Uncharacterized protein	1	27-51	FVSTTSWTRRRAFKRQRGVLEAPKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRN3	60S ribosomal protein L20	1	119-140	TKDLKFPLPHRAPPKRGKKVFA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS55	Uncharacterized protein	1	48-77	SYCSDCWGRQGPHKPKKKGRDGVPHEKTNP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUF4	Uncharacterized protein	1	281-307	AEKKKAKAAGRKAKTKDEKKQDKANED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVP9	Uncharacterized protein (Fragment)	1	385-410	FNSSLAGKKDRRRRRRPNALAMGRKQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZS1	Uncharacterized protein	2	1-20, 150-169	MAKDKPKSTKGPPNKHLSAR, GTKKRFPANVMRQLRKSKRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Y3	Uncharacterized protein	3	25-50, 76-106, 425-449	STQAWGTPSRKTKKPRFRSGGDNQSD, HTDATSTRSKTKPKSREKKYKCTFPECDKAF, KSTGLQDKDRKRKVNFRKQGGFEDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1N7	Uncharacterized protein	3	65-85, 247-268, 729-748	ASPLRNPLRAQPQPRKQQSSI, EETSDRIRLRRRAKKPVSAENG, EERNRSKKAAKSKVRAKKAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1R0	tRNA (guanine-N(7)-)-methyltransferase	1	1-36	MAGPPKKRQRREDRQEGELPRKKLYRQRAHANPFSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q219	C2 NT-type domain-containing protein	1	294-319	SDGRRNFKGHHDRKGRQRKNAGELEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q592	RING-type domain-containing protein	1	165-192	KTQGCCPLCRKDFRKKKEPPVAKREEEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMY6	DNA helicase	1	821-847	AKSRNAFFKKEDRLKERKKKQAQELLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLL2	F-box domain-containing protein	1	3-22	LLKHFRSKSRLKESSPQPAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM84	NADPH--cytochrome P450 reductase	1	672-694	EDGLRSFMDKQKRIRRWQQDVWG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNE3	Uncharacterized protein	1	38-57	QGYRNQRQRQEPPPGTRIRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEA1	WD_REPEATS_REGION domain-containing protein	1	247-271	AAPETVMKKKKKKTKKANDDYHVDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH62	Inheritance of peroxisomes protein 1	1	194-218	EPEMKVRKKVKSHGRAKKWKMERAY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL82	Uncharacterized protein	1	143-169	PLAGLTKTQRKKARRKERKAVQSQMAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLH1	Uncharacterized protein	2	147-178, 251-274	EEEEVKPKKKQAKKPVKKPAPKKRKKVAEVVH, VLIDEPPKKKRQKKTETGSKAKST
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNW5	Uncharacterized protein	1	26-55	STSDKRFTTPSKRSRWSRKVKNEERLPYAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP24	Uncharacterized protein	1	29-93	SNTSNKMPPKEAKKPKPAKEVPRTPEKPKAKPKAKEETPKKVVKAKDETPKKTPAKKKGDLKLDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRD5	Zn(2)-C6 fungal-type domain-containing protein	1	1-28	MSSKRSHTKSRLGCQQCKNRRIRCDEVA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRU7	Velvet domain-containing protein	1	458-477	GEASPQTMARKKVKRRKRDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSQ5	Glycosyltransferase family 1 protein	2	994-1013, 1254-1275	MRWQVLQRDLKKKRNPDELV, LEDENRKKKFKTAPQPQANDED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT37	Uncharacterized protein	1	17-43	QIPRSSRQLHHAPKRPIDRRLTCPCRH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT53	Uncharacterized protein	3	2-28, 68-92, 538-557	ATVTATRQPTTRRKKDQRSDIWSNLLR, PPPQPPTRGNDRRQHKPKGELRLSN, STTPRTGTPKPPRTNRDTGE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV07	AMP-binding domain-containing protein	1	666-688	LLTPTLKLKRPQTAKKYRQVIDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX82	Proline dehydrogenase	1	24-49	RAQSNLPTKRRQHTQHVPRRRLHSTF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q176	Ribosome production factor 2 homolog	1	2-28	SLPIKEIKPKNARTKRYLENKGPQNVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Y5	Uncharacterized protein	1	31-53	EPEQETPSRRRQQQQQRSLASRC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2R9	Uncharacterized protein	1	21-43	PQSYPLQCSKHHRRDRARTEAAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q358	Uncharacterized protein	1	45-71	SAKHQFRLERRYRRRSKLKWARPNWTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJS7	Clathrin heavy chain	1	1515-1536	AASIYRKNKRWDKSIQLSKQDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLP1	SAM_MT_RSMB_NOP domain-containing protein	1	629-654	EKIIERSLKKQLKKKGIDPKASKSKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5N8	Uncharacterized protein	1	65-90	QEAEDQEKRRAKKRKATNRGYGTQEQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5R1	Uncharacterized protein	2	38-62, 355-377	FACKDCSKTFSRKDHRNRHEDETHC, NAEVRCPIQKRLRRKAELRALVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJR6	Histone-lysine N-methyltransferase, H3 lysine-4 specific	4	14-35, 194-217, 869-895, 1120-1144	HSPGSLKRKREHAPLRHHSPVT, ELDGKLSKEERKRAQFRKRDFGTE, ADAKAVKEKAKKKRKTKKELLAEQEAL, DVAIRFNQLKKRKKLVKFDRSAIHG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YND9	Chromatin-remodeling ATPase INO80	4	109-133, 158-188, 1425-1447, 1477-1503	LEIGEGQKRKRRRMELMQRYHDHFS, KEVEEDKERKKDQQRKRRREKAIADEQQKRE, EEAKAGGKRKRKNAAGGKRKEVS, MEGPPAKKRKGTSKKAKTVKQRLAVID
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBL0	WD_REPEATS_REGION domain-containing protein	1	309-334	STEELHRHLQRKRRRRREKAAAAGES
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCD8	Uncharacterized protein	1	414-436	ACGVERPQRKARKVKAETAASKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE42	Uncharacterized protein	1	58-88	DGPASAKKPKKVKEKQKERRAKRKEALAKSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF00	Flavodoxin-like domain-containing protein	1	1246-1268	LVQRDNGDRKNRKQARLKYTIDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF56	60S ribosomal protein L29	1	2-27	AKSKNSSQHNQSKKAHRNGIKKPKTH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG89	Polynucleotide adenylyltransferase	3	66-98, 153-174, 730-754	FSDVQPPPRKRPLKDNKKKSQQGGRPPWQPRAF, EGNGQARKKRVKTKNADGDDKP, LEPANNGPVSKKQKKNKPKPNKMKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGL3	APH domain-containing protein	1	44-67	QLTDSTKKKYVLRKKPPGKLLSKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGV9	General transcription and DNA repair factor IIH subunit TFB4	1	343-373	MSTYGQKPIAVPKRKKKKKRPLDGAATDSRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIH5	Uncharacterized protein	1	11-37	LLGSSGRCRRRSRSRRRSRSRSVWAAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJV0	TPT domain-containing protein	1	76-108	DAERGLTNTERKKRRRRRRQHTKPDERIARTPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUX9	Uncharacterized protein	1	193-216	GTYYRTSLRRVRRNFRTDIKRQVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV67	Uncharacterized protein	1	50-70	ADLSKCRYKRARRRTDEEDGQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVE0	Uncharacterized protein	4	55-74, 100-128, 1138-1168, 1190-1216	LPPKPNSTSKSSPRRRYDGV, QHSSRQRWAQWERRNVKRLPKCCNPASRR, RYMISKFPGWKKQTRHRPQRSARQENLQYIK, ALIKLKRAETTRGRRNRREQGGLHRLV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1D1	Uncharacterized protein	1	11-30	NVQAESKSARKKKAKAEAAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1E7	Uncharacterized protein	2	231-250, 357-377	ERPKGKPKGSRAKAKQKADE, ATGLEKFKKSRKAKTGDDEEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3F8	Uncharacterized protein	1	10-29	GAKTWLPRFLRPNRAKRTST
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3M6	Zn(2)-C6 fungal-type domain-containing protein	1	2-33	KRTLKSPKSRGGCGRCKLKHIKCDESKPACRM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4M1	AAA domain-containing protein (Fragment)	1	558-596	VDLSKDKYVKAPKKKKAATAKAGKKKKKARDDDEGDGEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WHN4	Uncharacterized protein	2	135-155, 305-326	QIQHRPRSRSRSRSRNQDSRS, QSTNDRMRSKKRQDAGSDNQSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIK3	Uncharacterized protein	1	3-22	YDRTYRKTTTTTNRGRRPLY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YII9	MFS domain-containing protein	2	118-137, 337-359	SSQQRRRTSIQEKKRTPDGQ, PETFWDRTPKPRRPKARQQGSTW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIV6	AA_permease domain-containing protein	1	551-571	ALVGIGRKKHQDRRRSSVTEQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN71	UBA domain-containing protein	1	456-475	LDGPRKRQQKPARPNDERPT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBU4	Uncharacterized protein	3	164-190, 723-745, 753-773	FEKPRGNPRGRPRGRGRGRGRGRKATD, HVPGLVPKKRRRGRRNDLLPPVE, GDDKAPKRPRLQKTYNKAHDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCK9	Uncharacterized protein	1	1063-1091	LRYSRVHGRVRQMRRWAKKTGRAHSERDF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEE8	HEME_HALOPEROXIDASE domain-containing protein	1	29-49	NMVRAERQRVRRQQSNANGPG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGA6	Uncharacterized protein	1	684-708	ISKIDSPGKQKERKDRYETRQRLVQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI23	Uncharacterized protein	1	329-354	ALEMLSKVKKRKRRLRLTPRYLPQHE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLU8	Zn(2)-C6 fungal-type domain-containing protein	1	9-34	HTKSRSGCGACKRRRVKCDETLPTCS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNX3	Uncharacterized protein	1	36-61	TANDYFSTHNRKRQRPESREGRHSQQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ77	DUF2428 domain-containing protein	2	1513-1537, 1557-1581	LRLSRHGRRLPTKASHLRRRLHECD, LHDSVLHKARKKKGHTQPANFNSLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQA1	Polynucleotide adenylyltransferase	2	92-115, 1045-1068	DQELGPPKKEPKKTLNPNEQGKLS, AQSLWQQVPKKGHKKSKSIAGTKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTM9	Protein kinase domain-containing protein	1	1-20	MPPRRNGPCPTPKQRFEEYE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVJ8	Uncharacterized protein	1	24-50	YSPTAPLKQKASKKRKSTHEDGEQQNY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX16	PSP domain-containing protein	3	8-40, 127-147, 575-597	EHQPAEKARKPTKNELRRAKKKQTRNDAPAESA, AETKQRLSKKARKMANKLSIA, VAEESAKRQKRDRERAAQRGGKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q399	Uncharacterized protein	2	171-190, 202-223	IGPVIKRKPRKLQVRSQAIA, QPDSTPRRPKKLQVRSQSQVDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4S0	Uncharacterized protein	1	578-601	ATTSSSEKTRKRGRTNGNRRSELQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLF6	Uncharacterized protein (Fragment)	1	58-78	SITSSQAQRTKKKRNDPDAFA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLV5	Uncharacterized protein	1	211-232	VPDSLKKLVRRRKAELSKGIDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y1T7	Uncharacterized protein	3	122-145, 876-898, 1214-1243	EVTPATRKGGRKHGNKQERAEREV, IINHRKVFKTRTKPKNSKPFYNA, VIDKVKEYSKHTKQQHRRNRGVMQYKVPRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL61	60S ribosomal protein L36	1	63-86	ELLRNSKDKRARKLAKKRLGTFGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBZ8	Uncharacterized protein	1	7-28	RGLLAARKLRNHRREQQWADLH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCD1	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	1	3-37	IPVVRVRAKHSKTRTGCRTCRLRHVKCDEERPSCR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHF4	Uncharacterized protein	1	44-90	EQQASKRSKLERPSKDRPTHSESDDDQPPTKKRNTKRRSASTAPPAL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMJ3	Uncharacterized protein	1	36-60	LNCGIKLKDKKHKHSSGPRRHTRDG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR22	Pre-mRNA-splicing factor SYF2	1	248-270	IKKAEEMRLKKRRERGRPDEDGQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTW9	Uncharacterized protein	2	40-64, 99-121	EEFLDKEKRRHKYGRARLQEENKRA, PLSHIPTSKPRRNKNTARKEELA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVB9	Uncharacterized protein	1	202-226	AYVSKTTGFRKDKKHRRVRSAESER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXX1	Uncharacterized protein	1	117-136	TAVARQKDPKRKDKHVFGLF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZG1	Uncharacterized protein	1	354-376	ECKTNVWSRAARRKKKMATSDAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1F4	Amino_oxidase domain-containing protein	1	12-32	SQPNSAKKRTMDRKKIAIVGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2J9	Uncharacterized protein	1	321-342	DGAYHPDSNAPKRRRRRWSRGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2W9	Myb-like domain-containing protein	1	50-69	KTANACRKRHERLVERRHVD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3D0	Uncharacterized protein	1	99-126	PEEAKLVTEKQKKKQRHFPLRNYAVKAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4W7	Uncharacterized protein	1	207-242	ESEPLRIKEKTKRRNRHVRKVKSKHRYTILKIKQLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q562	DUF2183 domain-containing protein	1	645-669	EVVTRKKPSPSPPRPPKPQGLRGPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5B5	Uncharacterized protein	2	148-171, 1488-1507	DEDDVHTGRRRKRQRVAGSRAPSI, SKSSDKRVSGRKLRDMYKKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJF6	WD_REPEATS_REGION domain-containing protein	1	165-191	DPETEQSSKSKKKKSKQKNEDAEPVQD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YHQ3	Uncharacterized protein	2	17-43, 330-358	EPDQRFPPSPPQSPKPRVRSNVDRLLS, NVSGHHTKSLPKKFRKRKRTPSEELSDNR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKM8	Condensin complex subunit 2	4	32-51, 203-226, 495-517, 536-556	DDKEEKAKRLQSRQAHHSKQ, ENDDGTTKKSKKKTKRSAEATLVT, IKESSKETTKKPRKEKEPFEIDF, NSTICLPKKDWKDRNRNLLPD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDM6	Uncharacterized protein	1	40-66	VDDLNENKPKKKRRIIKMTDKKYECPT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGJ3	Uncharacterized protein	1	10-30	LQLFKRSKSQNDMKTKRKSLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIV4	Uncharacterized protein	1	7-31	TTHLPPTHPATRQRPKSPNRVLAEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKC7	Uncharacterized protein	1	290-309	QERHHSKRSRQRELVRKECF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL36	Uncharacterized protein	3	75-98, 187-209, 314-336	RYYEDDRARSRPRRRTDRELFGDM, HRERSIHRRRPPKSERSDREEKK, REERRFKKGKTRMPKRLVRREAI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL37	Uncharacterized protein	1	576-603	SAYMRQPVNPHRHQGRQRRQRSVDYKQM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTK0	Uncharacterized protein	2	2-34, 333-357	GVNYKLEKQKKLQKEADKRKRQKQRFEIDVDAL, KSAADGPNRKRQKKDEKFGFGGKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV34	Zn(2)-C6 fungal-type domain-containing protein	2	22-54, 64-89	SPDANVRGKLKQRRSRKACGHCHTRKIRCNVLE, DAGTTCIIRRRKNQRRESTPPDQNGH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0P3	Uncharacterized protein	1	149-171	CLCSTRPRSRCLRSHARRNAPSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q134	Nascent polypeptide-associated complex subunit beta	1	14-38	RIGGKGTPRRKVKKVHKSSGTDDKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3E4	mRNA cap guanine-N7 methyltransferase	2	6-32, 59-78	ASHFAQQRRGGPPKRKRETPASRAAKT, DGDRSPPRKLKRPGAGARVS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q453	U6 snRNA-associated Sm-like protein LSm1	1	130-155	LKKQENQDRKKTDKSKQKKLAEFGFE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q558	DUF3074 domain-containing protein	1	446-475	KLEHKKAKELRKVEEKRRKKDEQHKLSLVT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5D0	14_3_3 domain-containing protein (Fragment)	1	36-61	SILLSKKLYKARKLRKLDNTRDTKSL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XG60	C2H2-type domain-containing protein	1	382-407	RGILEKSGNKTKQKHFKPDVPGRKNG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJN9	SWIB domain-containing protein	2	125-145, 168-195	EDSTPPPKKAKKSKAPKDDED, GGAKRKAPIKKEKKAKKKSKAKIGSDDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCN2	CUE domain-containing protein	1	302-334	VQAQKRKEANKSSRANHSRRDQRAKKMARGGFP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCR2	Uncharacterized protein	2	23-45, 450-471	NAIEYKHLKKCIKRVHRELESLG, GVFFPMEVKKRQKDNERAQMLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCX2	Uncharacterized protein	2	36-55, 689-711	KAVQRFAREKERKAKGRSMF, DANKLQKEYKRERKGALRELRKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDM1	Ubiquitin carboxyl-terminal hydrolase	1	503-523	SWQTRDDQEKARHRRHDYTSF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEZ0	Uncharacterized protein	1	479-498	RTSSPLRRKTKRSPNLKVSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK7	Uncharacterized protein	1	73-94	TENARRSYIRRRPQGEKPLQSL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJE7	Rab-GAP TBC domain-containing protein	1	123-145	DRSRSPFAKRKELKEWQRQAQSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKI8	Uncharacterized protein	1	65-87	QAEQSREEKRKRRLEEPKTGPVT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMD1	Uncharacterized protein	1	1-24	MAKSKIKKEVKRKQVQQSPTQASV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMJ9	AP_endonuc_2 domain-containing protein	1	338-373	MGQVEKKREKDAKKAGKGGKKKEGKKGKKVESESDV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN60	SAS4 domain-containing protein	4	154-175, 312-332, 385-404, 537-564	LLRPSPKPAPRRTRTRSPQPAL, FLKPHKRAERKEKQLRNIERE, LDKFKQWRDQEKKQRASKEA, SEDVLRANAREKRRRKRESAVNAKEKDG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQC4	Uncharacterized protein	1	118-142	IESDRKTDKLKWKPLPMRPKSRLIQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRJ5	GTP--RNA guanylyltransferase (Fragment)	1	374-395	AEIKRAWKAREQRQKDERRRHE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRW3	Uncharacterized protein	1	696-739	MQTTGPPVNKPKKVSKKKTSTRKMTTTKKQKAPRKSNFPPPADG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSD2	Cytoplasmic tRNA 2-thiolation protein 1	1	369-399	TTRGIPIRMRQEKKANRKPNRDAPPPKQKLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTE8	WD_REPEATS_REGION domain-containing protein	1	561-581	TTRHSWRPPARIDKRAIRNGY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVJ9	DNA polymerase	1	28-50	QQASPQKKRKLEDSKPAFRQPGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXX3	MFAP1 domain-containing protein	1	304-324	RDSTKLGKKGRSKYKDLKSED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYK2	Carn_acyltransf domain-containing protein	1	147-170	VSYFYSHRDDRKRRDPAKRAAAIS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ45	Nucleolar protein 12	2	104-126, 423-450	AEDGEAKSKRKRKRLAADEELED, PMLPRKLRVSRAKAQKRNPKPGSDRPAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZB3	Uncharacterized protein	2	148-169, 184-231	ADAKQARREKKERQKEAREAST, DFEAADRKREKRRRKAQNQKTHRAKRAEELRKQQRDQRKNMREIQKTL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q099	Exonuclease domain-containing protein	1	650-672	LVENRLQGTKRKKRASMSSNEDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHJ7	Endo/exonuclease/phosphatase domain-containing protein	1	579-600	HSEPCKSMQTKKKGSNQGRSFW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIK8	Zn(2)-C6 fungal-type domain-containing protein	1	80-104	ATENGEGKKKRRKVNHACVYCRRSH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJR9	Ribonuclease P protein subunit	1	55-74	YEQNQKVKALRKTNKPRPLS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJS9	RING-type domain-containing protein	1	84-104	SPDPYQTAKRHHRRVEKNMSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKQ9	RXT2_N domain-containing protein	1	34-53	QHTNRGNKLKRNARYVKQDQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE14	MBOAT_2 domain-containing protein	1	484-509	AEEGVRRCVRRWRKSHKHAESQWYDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF74	Uncharacterized protein	1	3-22	QKSTEKVEYKNLKRKREAIS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGD8	Uncharacterized protein	2	466-488, 516-549	QLEKMLKAKKKKDDAQKKHDEHD, KDDAEKKKHDAEKKAEKKKHDAEKKAKHDAKKAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGY8	Uncharacterized protein	2	10-38, 55-76	TLDAPSPSKTPQKKRRNNSPDRKNTAQTS, TNKFIVSPKKKNPQNQISPVKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIM2	Glycosyltransferase family 24 protein	2	1463-1482, 1530-1549	CNNPQTKEPKLDRARRQVPE, QREDAERERKREKQKGHDEL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIY2	CMP/dCMP-type deaminase domain-containing protein	1	223-265	PAPPPRMNSKQQRPQVNQNPPAKSRPAEKEKPKEKLRPAGPRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJF9	Uncharacterized protein	1	807-831	TNIFKERSKTSSKKKDKEDAKENIV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL68	Palmitoyltransferase	2	442-466, 649-668	TICMIRKPLRSKHCRRCGRCVARED, SKDGNKTKSPARKTNPFSRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNV3	VASt domain-containing protein	1	549-576	AVTTKPPVKGMPRKGRRRGRKEVFDAEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRT9	RING-type domain-containing protein (Fragment)	2	140-163, 251-274	AARHRTDRATRDRQRQGQERRASS, IAEAYRRRQRYRERSRNRARVEQE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSR0	Ubiquitin-like modifier HUB1	2	120-140, 164-192	TEDARKDKRYRDRSPRRSGDH, KGFPIFKDPKPKKDKKDKKLKQITSNEPM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT29	Aldehyde dehydrogenase	1	462-483	YPPYTDKKLKQFRSMNEKKPGF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT43	Uncharacterized protein	1	169-203	AEKIEYRKRRIVKACEKCAKRKRKCPHNQAEMATV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUW1	OTU domain-containing protein	2	11-41, 105-125	EQRDLQSRITQKKKQASKKTRKGVNDECDRL, GSAHLGKKRNRQKDRLARRAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYY1	General transcription and DNA repair factor IIH	1	382-403	TTQLEVRDKPRRRRAEGASESS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZF2	Glycoside hydrolase family 2 protein	1	44-66	GIHPWPQHPRPKLVRPQWQSLNG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1B3	Uncharacterized protein	1	151-171	GRHSSRRYDHHHDDNRRDPYE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Z0	Uncharacterized protein (Fragment)	1	105-126	SQTYATKSRRAKPKPTARPADH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3I3	Uncharacterized protein	1	68-88	GGSKERSKSNGRRPSGQQRSC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3S5	Zn(II)2Cys6 transcription factor-like protein	1	21-62	SPDGQPYRVVRKRNRIPLSCAPCRHRKLKCNRGHPCDNCSKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y5	Uncharacterized protein	1	284-303	TAYADKAKRHEHHRHGHAHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q588	MFS domain-containing protein	1	531-553	KHGFGVKYARQLRKDRKEEIEER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLN3	Uncharacterized protein	1	146-171	GDSPTKKPKAAPRKKATPKKAKAAEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLL8	Uncharacterized protein	1	13-37	GPQNRSPTSQRQNSLHRQPSRQQFE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCH4	Uncharacterized protein (Fragment)	1	3-24	GPWNQGTSRKLRKTRSACPLSI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFC5	Uncharacterized protein	2	61-85, 143-163	AGWNCCIKTKKRKRQERLNHDKGTK, SLDSGIRKRNRNKKSSLQSLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFF5	PlsC domain-containing protein	1	107-128	EGEGNRTRREQRRKEIEAQLLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGG9	Uncharacterized protein	1	10-30	RCLARPVTHKHSKICRNPITT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI33	Uncharacterized protein	1	3-24	PSSPNSPKSRLGRLFRRRGPSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL75	Uncharacterized protein	1	373-392	LTEKEQKKLRRQRRMADMKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLJ5	SET domain-containing protein	3	102-147, 626-648, 664-688	VDLLRARQRQRQKRELVEPTTNGLKRAPSKSHKKKVKEPGTAQTNG, TKTALGRKPKPQRGPGRPPNKVV, LDPPTPPPRAPKPRKPFVSNRQRLM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLW1	Zn(2)-C6 fungal-type domain-containing protein	1	17-38	CSVAKVRCTKEKPSCSRCHLRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRA9	Uncharacterized protein	1	127-147	LGPGGKPLPKKHNNNGSPKEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTF1	HEME_HALOPEROXIDASE domain-containing protein	1	419-438	GYEKAPFLRRRSVRRNGEIE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYB3	Uncharacterized protein	1	11-31	AVAPKQSAKRRSKLAKENDLT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZF4	Zn(2)-C6 fungal-type domain-containing protein	1	21-44	AQACDRCRSKKIRCDGIRPCCSQC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZH4	Uncharacterized protein	1	240-260	AYDAAKRKTKANKQRKHQETL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0L1	Phospholipase	1	93-115	SPELYLRRPPAKNKQYRLDKLLF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1R6	HTH La-type RNA-binding domain-containing protein	1	162-181	GEEGKVRRGKKEPKEPKDSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2K2	Uncharacterized protein	1	49-68	EMHLRCRNSHQQHVWRRPIH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2R3	40S ribosomal protein S6	2	80-100, 183-205	GHSCYRPRRTGERKRKSVRGC, LVTPQRLQHKRHRIALKRRHAEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2X6	ANK_REP_REGION domain-containing protein	1	203-230	FSRHHAHFPNPRKRKHRASSVSLPNKRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIP1	Uncharacterized protein	1	142-163	IQGWHWQKTKKKDKTETERIYD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNK4	Uncharacterized protein	1	465-489	ETEKVFLSRQRRRRHKAVIYTRALE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHP3	Uncharacterized protein (Fragment)	1	22-41	GEKKGPSKNELKKMAKEKEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XI10	HET domain-containing protein	1	134-154	WWEPRKWKVWKSRYTKHDHNE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y227	Uncharacterized protein	2	839-863, 902-923	TAQQAIQHKIKHKRRMPPDSAIRFV, RAPEYDRPPEHERRRNRGPGAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHM4	Uncharacterized protein	1	13-34	PEEQRRKCNALVRQNNRKLERD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI43	Flap endonuclease 1	1	357-392	KASLKRKNEEKMANAKKQKKEADKAKKEAKAKPKMN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK86	Zn(2)-C6 fungal-type domain-containing protein	1	76-102	AFSIECKIPTPKRKKTSGKKEESIERA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKW7	U6 snRNA phosphodiesterase	1	15-37	QSPASPRPPAKKRKTLGDEKDAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMF2	AD domain-containing protein	1	208-227	IVEGEKRKLREKEDKERKAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN18	Chitin synthase	4	7-31, 77-105, 140-161, 443-467	NADLNRKKSLVRPERRRNAPDEPDY, GLERGKSRSGSKRQPNKLSRKATQQVRED, ILSCFGKKQKEQQRAWREKIGL, YAAPKTSMTKDKKKRQQQIEDWSDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPF3	Uncharacterized protein	4	50-73, 112-131, 498-520, 543-573	EDLIRDAKSKRGRAKKTQQLSDEL, VVKPSKRPARPGRKVLHDEQ, LQSLLPKKRAPMRPRNRKTEYDL, GGAMRRKKATPLKNTKKRRHAKGNTVRGASK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQQ3	Uncharacterized protein	4	50-81, 647-670, 801-828, 839-866	ITRAWDRKPQSPFSRKKLRFGKVWKRNGNALN, DPLSPKRTSRRSGRSKKSSQQAIP, TSSETPSKPKLRRLKPPRTASTPRQPLS, EQVKETKPKAPSTKRKSRLTTPAKPKDG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRE8	U3 small nucleolar RNA-associated protein 11	2	1-52, 190-215	MSSLRNAVQRRNHRERDQPTERKKWGLLEKRKDYKLRAADHKTKQRKIKALQ, DLTPEQRALRRKKRHALQTKQRKLES
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRN0	Zn(2)-C6 fungal-type domain-containing protein	1	471-499	TFGPRRQRGSKACTNCRQRRTRCDEGIPC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWN6	Uncharacterized protein	1	44-68	GEPMPRPKYRAPPKKEHKEKLESFS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ29	Uncharacterized protein	1	22-42	QDDQRNRSRNPLDRRRPPISS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0C9	POP1 domain-containing protein (Fragment)	1	67-88	RTASHNAKRVPKRLQPRAKREV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q259	Uncharacterized protein	1	114-136	KCDFCGKAFKRPQDLKKHVKTHA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2B3	Uncharacterized protein	1	381-403	SQKASNWKPTNNKNKQVKETCFF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2D4	Uncharacterized protein	1	296-321	SLPIRRPTRAYRSQRRRPLRRFVGDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3T1	Leucyl-tRNA synthetase	1	991-1014	AQLKKMQKGKQTSYDPKKDKKLTV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4I1	Uncharacterized protein (Fragment)	2	7-34, 106-126	HDDLEHRERPLKKRRVTLKREQPEEKTV, VQPESSSRRGQQHRRKPATAL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGG7	Uncharacterized protein	2	144-163, 422-446	TSDKDLKRSRKDRTLQHPSW, APGTDHSTRRTKRRKVTKAETSEDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YII0	COP9 signalosome complex subunit 2	1	474-494	MPSSRAPHAAGKRKPNRAPGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNM2	Methyltranfer_dom domain-containing protein	1	228-248	AKLTEKQKLMRNKKAFRKGRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YP74	Uncharacterized protein	3	74-93, 991-1014, 1490-1511	LSTVERKGQRPRSPERTTTR, TNYITRKQTNRRKNEKAWRKGTKA, QESGSTRKPRPTKQQKLMAQLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFY2	Uncharacterized protein	1	179-198	ERSTCPKQCLREQSKRRGTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG24	Uncharacterized protein	2	1-41, 782-806	MAHELRKRKKPPQEQLDSGDALQPSPQKKPRARAAASKKDA, DMPRLRRMWKRCNWDGKKMHRSQDF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHR2	Uncharacterized protein	1	328-348	YNFWRSKQSQRVKNPEKNKIL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMA5	Uncharacterized protein	1	197-222	AKNDHDHKSGQRRQRRRVQGPRETGL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ18	Uncharacterized protein	1	403-424	ARPVEARESKKKRRLTLNPLAL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ41	Probable endonuclease LCL3	1	715-734	DGVWYRARVRRNDREKKTSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT58	Uncharacterized protein	1	232-258	VMTVAKRRTHIPQKVRRIRSEQRRIDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUA3	Peptidyl-prolyl cis-trans isomerase	2	87-107, 412-465	RTFTPEFSKKRKHEERGTVSM, RGTGRNARRYQSRSRSPKRHNQHDPAKGVERYREDRTRQRSRSGDRYRNGRSNR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV06	Uncharacterized protein	1	4-24	GINHIKKWYRKISRNAPPAQP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVZ8	Uncharacterized protein	2	12-36, 295-321	FSNRASRIPSKRPSAQPKYTIPRPP, ASMAVPFPPKRRPKRSRAPDGRMPGPV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXW9	Uncharacterized protein	1	290-310	SFAPAASKPKKRDGRRSVVRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0M1	PHD-type domain-containing protein	1	8-32	VEGAPPHRLRSRKRRALVERQAQAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0T4	Uncharacterized protein	2	801-826, 1015-1047	MRPEDRWHRKVVRKSKKSKGNDDNAT, PKTPSKCTPRSQNLFNNRLKTPTQSSRKRKALT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0U4	Uncharacterized protein	1	378-399	AWYCRNPRTRRRCIALIRRINM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q149	Uncharacterized protein (Fragment)	1	54-74	RQGASRPPSRRQRPCENVARS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1C1	Uncharacterized protein	3	584-608, 646-673, 791-813	DTLWQDKDKWEKKRKADTQRATSAS, ALAGLNQQKRPKKPKAPKPATKKTERVH, GGGGAASKKKKHKPMGKDQQTAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q527	Uncharacterized protein	2	14-41, 73-94	YLSCAPCSDARHRRRRKEEAKGERAERE, GLQRNKRKTHTADSRRRLREQN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5D7	Uncharacterized protein	2	96-115, 134-157	VDNPDKLKDKHQMRENRKHV, VTGGANPHRKRKRQEPRLNEQSVN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMD8	Histone domain-containing protein	1	45-71	TSSTRNDGTPRKKRRYKPGTKALKEIR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJV1	Hps1-dma1 cluster transcription factor tfc7	1	13-32	CSATKIKCTQERPQCTRCRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBF4	Non-specific serine/threonine protein kinase	1	52-71	NTTFPCPKVHRIHRYRGKLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC77	THUMP domain-containing protein	1	14-38	GGDDKRSKTKKEWRVPRKNDHGAVS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFW2	C2H2-type domain-containing protein	1	196-222	QHVAKKSCTRVRRYSNGRERPRPRVID
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGG0	Uncharacterized protein	2	115-135, 1126-1148	PGPFKLRPSPTPSLKRKKAEA, GGSPSGKRRWRDVWRKGGRDGSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGZ4	F-box domain-containing protein	1	124-150	FHDFFRKPKSDRSKVRPRKSNTRDGPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI16	RRM domain-containing protein	1	321-360	NVAPIVKKDHHNKHKGKNNNHYKNKDIKQHQKDPLKANTG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIT0	Usp domain-containing protein (Fragment)	1	180-209	PVIVVRPGSSREKKKRKRLQDPSRSGYRDI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKE7	Glycoside hydrolase family 16 protein	1	436-457	AETRDRHARHLKAHTRHGKGRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL72	Zn(2)-C6 fungal-type domain-containing protein	1	33-58	CTYSTGRPVGKPKGHRKSKSCNATSN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNZ1	Uncharacterized protein	1	164-193	YAYGVRDNPSRERRKRRRPNAPVKAARRGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYU8	Zn(2)-C6 fungal-type domain-containing protein	1	13-47	ASCEPCRRGKIRCDHQRPTCGRCQRRNLTAQCFYH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q017	Zn(2)-C6 fungal-type domain-containing protein	2	143-172, 693-713	ASDKNKDKRTKVSRACDECRRKKIRCDAID, GAVRDLVKKKREKLQEREGLQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0C2	Uncharacterized protein	2	75-97, 99-120	DDQPPPAKKPRLKLNVRAKNDSP, DTIAVSRPRRDVKRRSYGKSVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q153	Uncharacterized protein	1	1032-1057	YSSPHRRSSLNSRKRRERPEEGPGFS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3C4	Uncharacterized protein	1	472-499	DPRSRSSSIESRRKLQKKRRPSEESQAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y027	Uncharacterized protein	2	1-22, 355-379	MAKKRRRLRKNSKRHDPSTEIG, EGMARTIKGQRQKRLKGNSNIEQAI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y098	Uncharacterized protein	1	42-63	PDSTLPRSRVRRPRSVAQRILA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YII5	Uncharacterized protein	2	2-23, 1266-1292	SIDMNSRSGNKRKQPSDNAFAP, MAIQQPAAKKAKKKNPVNNGANKNRGV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIX4	Uncharacterized protein	1	50-74	ALGAKSPKSSRWPRTRRQEYLDYQF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKK5	J domain-containing protein	2	84-110, 240-262	NYNKPKVGKKGDKPKVHVTKNKQPSQS, SMQWNRKQKREMERQRKKEGKNP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLM0	NMO domain-containing protein	1	50-72	SPDDLRKEIRKCKKMTNKPFGVN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCR0	Ubiquitin carboxyl-terminal hydrolase	1	101-122	FEEIRDTKSKKRKQSDSLSESD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD10	Uncharacterized protein	1	194-216	AMFYVARRYRRKRSSHQRTSSVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEG3	WD_REPEATS_REGION domain-containing protein	3	143-166, 170-193, 302-328	EDAGKSARRKRHSRHGSKGQKAIE, EEPAGPPKLHKLRRERDKLEHRLE, GSLPKPKESPSKPRRKKTSRRISMPVL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF96	Uncharacterized protein	2	105-128, 232-253	AVVSEHRKRQRQKAADKTRKVQRD, APEFRRHRHMPKPEKVKKLKDV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFH5	Uncharacterized protein	1	521-542	AQKDAKKRAKADKKEEKKAEKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL83	SWIRM domain-containing protein	3	144-172, 291-312, 489-509	VVDPQVPVKRKRGRPRKHPLPEPKVPAPS, QVQKNPKIPKKFSKDARQRTVV, QIKAHKPAARRGRRRNAPPGT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM49	Uncharacterized protein	2	140-160, 705-746	ATLTFVKKRWPKKDVNSMAKE, IVLPRGRKRTQRGVEVQDDRERKATRKKKNKPKPLENMGVDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP74	UDP-N-acetylglucosamine transferase subunit ALG14	1	25-52	LSTILSPDRPHPRRRRRENVKVPRHLLI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPB1	Uncharacterized protein	1	1-21	MKRRNQMKKGSRNQQRSDISK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTK8	Uncharacterized protein	1	8-34	RVLTRCLQRVPRRRVVPQLQCLHQRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUM9	LigD_N domain-containing protein	1	253-278	NHQAAHSKKPARKRRRQDPSKVASKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0S7	Uncharacterized protein	1	130-156	FDEAKKWKSSRLRQRVKRRRSREAAAQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0X3	Peptidase A1 domain-containing protein	1	42-64	ISNPLEHDRKRWLRKRDDTINVA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q255	Uncharacterized protein	2	8-30, 432-460	DDYDYHGRPRRRPSPHHMRSDAG, EPAKKEKQFALYRRRSKSRSGRPNEVGVI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XZI8	Uncharacterized protein	1	188-213	GLTGNARKNKKKAIKAKESRATGRRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJT7	Gamma-glutamylcyclotransferase	1	349-370	QSNGRRGRTMTRQRYRDSRQDV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLF3	Uncharacterized protein	1	555-580	AFVRDIGDHKQRNRRIRKVSLWATQV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEP7	HRDC domain-containing protein	2	644-666, 735-764	DDTFILKEHNRKRKRTLDRFASM, LNPPRERGQSAKERKKQQKQKNPYAKALDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGT9	Uncharacterized protein	1	58-78	LAHPRPPYPKRYRRRQALLIR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHB4	Uncharacterized protein	4	12-36, 525-547, 695-723, 797-817	GRLASLKGGPPKRRGPPKKPAAATS, EEPAPPPKRSRGRPRKVEPPPID, GGNKPGRKGKKGDKVKKKRSKMGDGSVLT, DDRNDSARRRRRSSPDAQAGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHD2	CoA carboxyltransferase C-terminal domain-containing protein	1	31-59	LKNDQNQRPTTSRRRRKDKKDELPSDYSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKF4	Uncharacterized protein	1	66-92	HILDRVRPYSRRRCKKPPMWRCLTGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLP0	Uncharacterized protein	1	172-195	DLTIENKKLKRRLKKYERLQDAHL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM74	Uncharacterized protein	1	181-208	DYTKNFVTETPRRRKRQKLRSQPEGPVD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMG0	ATP-dependent DNA helicase	1	35-54	YNGNAAKRMRQKEPSNNART
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN70	Uncharacterized protein	1	12-39	GDYQPTAKRSTKRRVKRAPSLRVTRLMK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPX7	Uncharacterized protein	2	50-88, 133-156	DTTFGARKSRGKGRPKKKCRLTKAKKPKKEKPFRFLDLP, SSYYYGKKRRQSRWARYYDRNNDN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQT6	Uncharacterized protein	2	62-82, 382-406	FTTAITKKRKRGDPSTRSLTI, DVDICPRSKKRQKRRQGRTLEEQHQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR45	Palmitoyltransferase	2	96-124, 234-253	APTSTPSPPFHRRRKSWARKLERCCCQTF, QPRYCKKCSNVKPDRTHHCS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTZ2	Zn(2)-C6 fungal-type domain-containing protein	1	64-84	GQACDRCKIRKIRCDARPGGC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUD2	Tryptophanyl-tRNA synthetase	2	72-91, 472-503	VTGKKPHRLMRRKLFFSHRD, EDGKLTKGQRKEQKLAEKKREKEEQKLAERPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVD4	APH domain-containing protein	1	16-39	DDWGRRVRSNEIARKPKKHDWLYW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVT8	Uncharacterized protein	1	290-316	ESPSKDVVPKLKKAKKSRKIGVPEEVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXJ9	RRM domain-containing protein	1	448-473	TSPTGERPPRNDRRPSRQQQQNGGGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXP6	Peptidase S53 domain-containing protein	1	165-185	RELSRTKPDKLKKRHLEHMVS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0H3	Uncharacterized protein	2	13-45, 111-140	SLAFLPRKRASRHRGKVKSFPKDDQKQKPHLTA, SDEVKRRFYKNWYKSKKKAFTKYAKKHAEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q468	DNA polymerase kappa	2	539-559, 605-627	EYDLKHKPQQNSPPRKQPEQW, LMQASTSKRKRGKAQSNGHTATS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMD4	Uncharacterized protein	1	174-193	KSKNDLPSKRRRKTPQSANG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMT7	Uncharacterized protein	1	39-58	TSKASRQLSKIQRNRKAFRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBS0	Uncharacterized protein	1	181-205	LGGIFFWRKRKQKKASEEQRRKEIE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDT0	Ubiquitin carboxyl-terminal hydrolase	2	596-618, 722-743	EDERIAQSRKRVENRKKQQDEIA, VKKEEEKVKKNRFSLGRKRSTM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE22	Zn(2)-C6 fungal-type domain-containing protein	1	51-92	VNKAAAQHAPRIRRRNRQITSCLECRRRKLKCDKQAPCTNCT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEC9	Uncharacterized protein	3	134-153, 161-185, 369-390	SSEQNRPKKRSKFLSAFSKE, MRTETDDSKKKKKRPKISFMSQVKA, MYNEPSQKTPKKSRGKKEEGEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF39	Uncharacterized protein	1	4-26	QYCCSVTKKKDLKWLKEKYGDRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFU6	N-acetyltransferase domain-containing protein	1	285-306	EWVSGESRKKNKKAWRGFIRAW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIH2	DDHD domain-containing protein	2	49-74, 143-162	ISRKHRLSLRHYPKDCPRLRPQWFHA, GSNASSKKHKPGQPKVPVNE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM63	Uncharacterized protein	2	50-69, 771-806	QSRALQKKFKEQQENGRRMS, KTEERESRKDDKPAGRQRSRSIWGRSKKEKPPALPL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMA7	Cir_N domain-containing protein	3	75-101, 260-286, 295-338	ASSRDEDQARRERKRRRLRGEDDTDRD, EIAALKRAGRCRKERHRHRREDEVDSL, EANTRERSDHDRHRRRGHHHHRHRRHSRSRSGERDRHRSRHRPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN85	Uncharacterized protein	1	595-616	QAGQQSSRTKPKGRGRPPASIG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS49	MFS transporter-like protein	1	82-103	SLAKHHKRQPIAREWNPNRKRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT87	Uncharacterized protein	1	135-157	SKVNTKFCYRHRPDLKCRRQANE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUS7	Uncharacterized protein	4	53-78, 216-242, 245-270, 466-485	EEREPEPPKSSKQKKSKDNVVQVVVE, PEPVLRRPLRQSRSRSRSRSRDGRGAT, YETSGTKVYIKRRRKSRPADTSESSF, STPTLKRRGARRKSLSPIKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXS5	Uncharacterized protein	1	653-673	GSSPPYKKRRIHKPDDSQAVS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0I4	Uncharacterized protein	2	341-363, 1143-1166	NPLQALRNRRLRNRERRPLPASP, AVDAMFRQRRRQFRLVRRAGFKLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0X0	Uncharacterized protein	1	24-65	EYVSSTHSPKRRRSNDGQVIPVCKPPKPSQTQRVKQPPPTSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1W3	Homeobox domain-containing protein	1	93-114	NNWFQNRRAKSKQDAKKQQGAF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2Y0	Phosphodiesterase	1	890-923	DERQSNPPIRHSRSRSRLRLKFWKRRRGASVEAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q319	Clustered mitochondria protein homolog	2	931-955, 1279-1303	HGTADGSKKKKKKQADKSPSRAAAS, INGESSKQTTPKKTPTNPKRRQQKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJE6	Uncharacterized protein	1	4-25	SSKPCWNTFRVQKKGRHRIDIA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNS6	Zn(2)-C6 fungal-type domain-containing protein	1	31-62	QQGRQRSRAACTPCRQRKRKCDGRLPCATCIR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCR7	Uncharacterized protein	1	964-990	EVQSLIAAKKKRKRRKGAGNQQKDCAN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI06	Zn(2)-C6 fungal-type domain-containing protein	1	10-34	NHTPSCAVCQRRKVKCDRVYPCAAC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIK4	Uncharacterized protein	1	31-55	ASPNVVRIKRFHRKWKNIIYSPPKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIY0	Uncharacterized protein	3	32-59, 207-227, 375-399	ASDRDLKKAYRRLSKKYHPDKNPDDEAA, GQIIKHKCKKCKGERVLRAEE, KDFWATWEKYRKKRVDLHKDTGRPD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJZ9	Uncharacterized protein	1	304-328	ASDLSERKKLRPKVCRKPRLYSLAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNJ6	Uncharacterized protein	3	10-38, 63-89, 371-395	DEKSTAKPSGPKGKKSKKRSLNGDVKGAQ, EDEVASDRGQKRRRRRREDEPDPVVTD, SDPMAKRKGKGKDKKVNKGGKKDGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNY6	Uncharacterized protein	1	17-39	ADTADIKRRKLQHHQHHCHQPSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPB7	Uncharacterized protein (Fragment)	3	2-27, 367-394, 771-791	DVEERLDPRSRKPKQRRATGQDDSLE, KAKRIAKIKSKSYRRVHRKERERQAEQE, GLSRSIRKANKKAAHNPLWKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPX4	Uncharacterized protein	1	191-211	SISPTRRDVRRSRSRSPYRGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVY2	Uncharacterized protein	1	149-172	DQPAKPSPDRYRRPAQKRTESSQS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX89	Glycoside hydrolase family 61 protein	1	416-438	VTYLLKQSWTRKDQRNHARDFEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXI4	Uncharacterized protein	1	35-64	KANVDAEQRQSKKRKRDRQHERALKKQTVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXU8	Fatty acid hydroxylase domain-containing protein	1	310-331	DHDLHHRKGWRKSQNYGKQTRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYV5	DNA ligase	3	13-32, 40-59, 922-942	DEKYPNRPHNHSKTLPFRTL, LNDNKKKPTGPVQARKKIGP, GAARRMRKSIANKKQLPRIVS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3E9	Uncharacterized protein	1	227-246	LLSNPKRKKKEVPNVDHSKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4A5	Dolichol phosphate-mannose biosynthesis regulatory protein	1	75-96	MIRSNRKKALKAKQKAQAQKAQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4P2	Uncharacterized protein	2	47-87, 199-220	VLAWYLLRKVRKKHENPRYLPTQFLKRKWQNWKPWSSQSSK, IAEREERRQRRREARQRGDFAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y8	Mitochondrial import inner membrane translocase subunit TIM54	3	28-48, 105-131, 251-277	VVYDKWQTKRMREKWCNMVAH, EGDVRHKTAERIRKKRRRNGEGTPASE, EEDKKKQEDAKKKKEEDKPKRRFPPSY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q593	Uncharacterized protein	1	717-745	WCVGCHTHRYSSKCRKCKKPVTDVVVKAL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WHJ7	MYND-type zinc finger protein samB	2	51-80, 260-280	ANGNRQRQQRSVRHHSPRRLRRHRQVGSGS, FYCGKKCQKGEWEGHKKECKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0W1	MFS domain-containing protein	1	489-511	KKENPVFTEKRHRKQNTTPDVEQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI61	Uncharacterized protein	1	339-361	FDWFAVKDKRGKKHKIREIVLVV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIS8	RING-type domain-containing protein	1	603-628	YALLLLRSRIRRRRWRAPKSVVERLP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC99	Csm1 domain-containing protein	2	53-79, 131-152	SVGKPAAKRKTAPKRTRKALEDRTNMP, YTKTKAPAKRGRPAKRAPSPEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCH9	Zn(2)-C6 fungal-type domain-containing protein	1	30-56	RAVSSACIPCRKRKSKCDGQLPSCSTC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDL2	SAP domain-containing protein (Fragment)	1	38-59	EAEDAPKRPGKRKRVTVADAED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHR3	Uncharacterized protein	1	617-637	LEPDRIHKHQRRPSAMKRHST
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJS7	W2 domain-containing protein	1	424-444	TGNRRVSKLKRKRGVGKEQTV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLR7	Mtf2 domain-containing protein (Fragment)	1	35-60	TLFRSRQKQPAESKKHKEARSRTTNL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMF3	Zn(2)-C6 fungal-type domain-containing protein	1	1-28	MSSPKVSKPSRPRTPRSCVPCGRRKVGC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNG7	Uncharacterized protein	3	115-135, 259-280, 306-327	LAEREKKKSSKSPDSNAKSPP, LDESLKEEKRIRKRQLDKEMAE, LNDELQRQKRDRKKALDKEIAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ52	Zn(2)-C6 fungal-type domain-containing protein	1	28-57	RKTHRKSRLGCVECKKRRVKCDEAKPACTN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSA7	Uncharacterized protein	1	60-87	QQPASRPVPPKLQRRRSQKDGRSQGSHF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSB3	Signal recognition particle subunit SRP72	2	540-574, 579-605	TTTPSRKRPAEDIKPKKAKKIRPSRMPKDFDPNKK, RWLPLKDRSTYRPKGKKAKARQALYSQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSZ3	Uncharacterized protein	3	177-199, 659-685, 925-949	LDDKHLRRDRKVFTKQNLRAFLK, PSNGRSLRRGNDRKRKREEDNARREKE, MGHLHSQPTKPKKEKAKAAARELKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV90	Zn(2)-C6 fungal-type domain-containing protein	1	145-165	QCIITAPSRKRQKKADSRVAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVG2	FCP1 homology domain-containing protein	3	39-66, 73-92, 151-176	SSSTTTVIQPHRRPRRKPAQPTITTTTT, QAGTRKRMSRKQPTGPSTSN, LPTQTKIAKKKAKKEAKKLQQPPSHP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVH4	DNA-directed RNA polymerase III subunit RPC6	1	187-210	VRQHSWKEPSRKHKVKKEPSPPVL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q069	Endopolyphosphatase	4	391-418, 472-491, 533-564, 613-648	DIALGRKRDRKDFKRKQKKYLKKIGGEY, VEMAKKKHKKYKFTIPEAPS, IEASKWHEGKHKGKKPHDKDHTPRPKKFRFEE, ADAEIGRYKHKHKKGKKRKQKYRKKNEAWFTFVRRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0A2	Zn(2)-C6 fungal-type domain-containing protein	2	5-37, 58-84	PEVPPRRRTARACDNCRRRKTKCDGRLDCNTCE, VQHLEKKLRRLQKEKSRRPSNLQSPQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3J0	Uncharacterized protein	1	57-82	ERDWHERKGKQERRELQKQRSRRAVR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKP0	Uncharacterized protein	2	159-180, 625-650	TGKPSGKQKVAKDKWKKEEENY, IQQQATRMAKDKKKPGRVEKTVEPAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WM25	E2 ubiquitin-conjugating enzyme	1	179-205	KSENKRKLEDKEKKRVERQRSREAYKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCK4	F-box domain-containing protein	1	69-100	AIPLKSKKTERMQKRMQKKLRKTKVTSDTKNF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDB2	HET domain-containing protein	1	503-532	VSVKRSASPRDPPRRCPSRRSSPDRTSIRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEA8	Uncharacterized protein	1	982-1011	GAQTMKLKPKEREQPKDEKKKGFKALKGIA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGP0	Uncharacterized protein	1	73-100	CSRLVHRHSVEKRSKDKQRELLRRANPD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN75	Uncharacterized protein	1	610-634	TNFNSKWMYCCRRMRPNTKFVWCDN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNR3	ECM11 domain-containing protein	1	71-90	EVLKKFKAARQDKRKAAREF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTC2	Uncharacterized protein (Fragment)	1	192-215	PHFLPPKQNFHPKRNQARQKLSTL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV99	SPRY domain-containing protein	1	39-64	PAPPIERERREKKESLKKRESNAHYE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWT7	Uncharacterized protein	1	213-236	EEEKEEEKKKKKKGQGRALTPKTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWY8	Zn(2)-C6 fungal-type domain-containing protein	2	1-38, 45-72	MPNLPPDRPKKLQRISQACDLCHRRSIRCRPSAENPQH, DFAVDCTYKRPSRRRRNQSGQNGVPPNL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX06	Uncharacterized protein	2	253-275, 434-457	SCISPIPHSRHKRHRDHEREGLA, KAETTRYKDKNRLHSEQKLQYWKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXD3	tRNA-dihydrouridine synthase 3	1	362-406	DPSAKKEKTENGRKSKKQKKAERLGQKQNGTKKTKPEKSNDPNFT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXR8	Nitric-oxide synthase (NADPH)	1	67-89	DALSTSPRRRSPRPKVSSSTVRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0N2	Uncharacterized protein	8	79-104, 158-184, 393-415, 551-575, 998-1018, 1155-1179, 1327-1357, 1371-1395	GAPALKRQTIRARKARREGRREDAAR, LQMTQQERQQNRKFRKKDQYHLPDMDM, LYSSRRRIATKRRLEPKQKTEID, LAESRKTKRKTSPPQRRQHQTLKME, YEKELKQLRNQQKKDRRDADE, PKEADAKIPFRKKFRKNATKLFLPP, PSVDPPVGKQEQRKRKRKRKRVETAQFETAT, EKAKSKTKTSEGSGRRRKKKAVNDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q258	Uncharacterized protein	1	120-141	VDGHHPHRPHKPPHHHEPNQTV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3X2	Zn(2)-C6 fungal-type domain-containing protein	1	3-32	PKSNRSRSGCLTCRQRKLKCTEERPTCAQC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4B5	Uncharacterized protein	2	14-36, 109-136	NDEQPAPRKAPKRKVDINSLSWK, AKSVKVTKAKQESKSKTKSKPADKAGKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y3	Uncharacterized protein	1	11-39	PQSSNAKKTSKHRKPPATPAKGNKKNKTV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5E4	Uncharacterized protein	1	11-30	LPQLRGRYDPRRPTSRQLLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIZ5	Cytochrome P450 monooxygenase cypX	1	127-150	NIFNFRDQKKHSQRRKLYAKGFTL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJU5	Rad60-SLD domain-containing protein	1	33-76	LDLQKERIEREARRKQKEKDKEERRKAKQEEKRRSSSEKRKVME
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCE9	DUF2236 domain-containing protein	2	46-67, 99-120	SHRSTAHRTRTQERRWTRCCDL, PALKNTRQSTWKRPQRPEDSDF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGW0	Glycosyltransferase family 15 protein	1	19-48	LAPQMWKVNSRKPRKAPKCREPPQNPSQRC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMR8	Zn(2)-C6 fungal-type domain-containing protein	1	5-40	ARNPRQGSKRAKYVDRACRQCKRRKVRCSGAEEDAC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP84	Defect at low temperature protein 1	1	306-330	VDEVRKQTMARERQNRRHRNPAMLH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPL6	Uncharacterized protein	1	567-587	SYLFRMIRAQHWHRRSRYKCG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRG5	Btz domain-containing protein	2	31-60, 122-142	AANVAKSAGKKARKSRKQSAKKTGKDQAVE, QSPVERQRRDHEEYRKKRDTD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRL0	Uncharacterized protein	1	180-199	MGWLKVKKGRGKGKKPEYVF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRR8	Non-specific serine/threonine protein kinase	1	867-891	TDDESLKGREKRHRFSKRNSKSGLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT92	Uncharacterized protein	1	715-734	LYIARCTRPRRSRPETTNAY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUQ0	MRP-S28 domain-containing protein (Fragment)	1	38-57	SKPFEKPSHKRLPLRWRYTT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWE0	Uncharacterized protein	3	251-272, 717-765, 797-816	SEDESDRPRRRRRSSNSGDDIA, GKVRSKAEIKEREERKKRKAAEKAAQKAARARKREERRQLRQERNAANG, DETASRKKRRGLNRFGHAFQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Z9	Zn(2)-C6 fungal-type domain-containing protein	1	92-115	QRTAIACRYCRRRKIRCSGFDQSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q400	Uncharacterized protein	1	536-556	ATIPHCVKYWPKDCRERSRSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q491	Uncharacterized protein	1	785-813	LWEERLRPRWKAFRKRIFGHHSRNKSPKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4I8	Protein kinase domain-containing protein	2	494-515, 555-581	MPSPVPSSKSHRPRGSQRSTSQ, MLGFLSRKKGRDRSPKAKEKERGVLGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4R0	Zn(2)-C6 fungal-type domain-containing protein	1	31-77	TEKQLVRTERRQGHQRRYAPKTRTGCVTCKIRRVKCDEEKPFCRRCT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5B0	Amidase domain-containing protein	1	505-531	AYQIQRLGRVRRTPRWARQRVEPRAYE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLJ6	Uncharacterized protein	1	45-73	SANAAKYKRKDQPASQRKKKAKSTFDTPD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMS9	J domain-containing protein	1	20-39	EEIKKAYRKAALKNHPDKNP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJW7	Uncharacterized protein	2	155-185, 456-481	APDTPSKTGRPRGRPKGKRRERTPSPPPNLP, DLDAGGRPPKKKKPVNNTPKKQAQAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJJ6	HET domain-containing protein	1	94-113	ADLTKPQRSQPKENKYPVKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD76	Uncharacterized protein	1	180-204	AHLAKREARRDAQRRKRVERASAKM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE67	Uncharacterized protein	1	39-62	RSDPEFRKTLKKQHKKVQKISEES
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF47	KOW domain-containing protein	1	5-24	NTNLSSSRRKSRKAHFSAPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJT8	Protein phosphatase	1	45-64	SSTVISSKKRERSRDPQAGL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK74	Autophagy-related protein 11	1	1418-1437	LSPRARSKSPSKSVRSLQQH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL57	SHNi-TPR domain-containing protein	2	42-68, 406-430	LGGKVAGSGKPKRKKRKTSHLETSVGE, STNGTANGKKNKNKNKDGHFLKDRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLN9	Fanconi-associated nuclease	1	18-38	GEEFHTPPSKRQKRDITDFAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNF0	Zn(2)-C6 fungal-type domain-containing protein	1	5-28	VPAACQFCRSKRTKCNGEQPCAAC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP25	RING-type domain-containing protein	1	911-936	ATRPRRAANCPVCRKQIRQKVKVIRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPA1	Uncharacterized protein	2	1-32, 70-92	MCRKSRIAKSQRQCWNRRKRKGSVQSKEFPPA, CAVKRESSKKSKNDPRHRQWTIR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQJ1	Uncharacterized protein	1	15-36	TEPEPARKSRFDRRSRSPAADG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRH8	L-type lectin-like domain-containing protein	1	265-287	AAGSKDYSRKKGRPQKARTSGGW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVF2	Poly(A) polymerase	1	544-569	VFVEGEKKPTKKKSKKAKDVTPAAEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY78	Uncharacterized protein	1	19-44	NDEPEKAQKSRRPPNNAFRQQRLKAW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYK6	Uncharacterized protein	1	86-106	ASTPASKGKKRGKKTGHDEEV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYL8	Uncharacterized protein	1	31-57	YTALQRSNSSLKRRPRKAIQASIERVL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3W1	Uncharacterized protein	2	1320-1342, 1520-1544	RLPGPKMSQKDRKRMQQVQQASL, AAAVATKTSKRNRARGGRSGRGGKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4C5	Uncharacterized protein	1	118-137	RFMGKERKRHVPPPAKPPEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJ18	Aspartate--tRNA ligase	1	22-42	GEKKGPSKNELKKMAKEKEKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCF8	PDCD2_C domain-containing protein	1	17-46	GHERRLYIWACKRKTCRRKDGSLRGFRATR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCY0	F-box domain-containing protein	1	52-74	LVWRRHCMHTWRHWHRRHDIAEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH73	Uncharacterized protein	2	43-72, 476-497	KLDHDAIREKAKKRKKNKKKGMQPAAPAAN, LKAHRFFRKIDWKKLEKRESEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ53	Zn(2)-C6 fungal-type domain-containing protein	1	59-81	ACEVCRSRKSRCDGGRPKCKLCA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJM2	Uncharacterized protein	4	44-75, 122-159, 350-374, 485-559	LDPSEQWNRKKQTKEQKKAAKKAKLDPANQKT, EEVAKRKAYVEKRKEKREKNKDKKLKKAEKAEAKRAAK, LLEQRRKKEEQRKAHKKELRQKSKE, DDTSLLKKALKRKEKQKGKSAEEWRERQDNVVKGKEIKQKKREANLQKRKDDKGSKGNKKKPSGGKGGGKRKGRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKZ3	Uncharacterized protein	1	211-231	TSQGTRPQRAKARQSYKPAAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL88	Uncharacterized protein	4	38-60, 538-562, 617-638, 725-748	SSGSHDPSPRKPLQRPKCPGSGS, FYPKFPRMKSSRKGQKKAKDLEQSI, VARNVAKSRRRSSNKSQTWPEA, LDSWRENKAQKRREDLKRMIRVVD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLG2	Protein arginine methyltransferase NDUFAF7	1	84-105	SDQLRLRRERPRRVKMLLRDFI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNI8	S5A_REDUCTASE domain-containing protein	1	202-223	ADRQKSQWMKEKKEKKHSEDFL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNS1	NmrA domain-containing protein	1	30-49	VTVLKRKSSKSTSKYPKQVL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPM7	Glycoside hydrolase family 18 protein	1	139-158	APPPLRLGRRRQPHGPQHTS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPU2	Carboxypeptidase	1	533-556	IAWGIFIWRGRRRRRGYRGLVGSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTV6	Uncharacterized protein	1	314-333	ETPFRRRQSRPKSMLPRFPT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTZ9	Uncharacterized protein	2	27-66, 106-150	PTSPLARHSPVRRQSSKKRSPSPRKVGRPRKHATPAKSVI, KDETSKRSSSPGKRASPRKGTPAEPKKSVRKRKGTPIRDIRPARP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV44	Phospholipid-transporting ATPase	1	694-718	LMHEKRQPSKGKRPAWRPRRSPSNF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXU1	J domain-containing protein	1	470-502	MAEATAKREKKDDKKKEQQHKKHGFGHKHEATD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYS3	Uncharacterized protein	2	123-146, 217-238	QPSPSEPPPKRKRGRPTKAEAQAK, HSSSSSGKRRRARSTKDEPEGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ96	Uncharacterized protein	1	1085-1107	VTNISQPARKARKTKKGDDAAAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3N0	DNA polymerase lambda	2	31-51, 356-375	LQASKSKWKVSKNEQRNMAER, LKLLPKRKSKYQRMQDKFQC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3P2	PX domain-containing protein	2	866-890, 939-964	INSLIKWQTARKRWHSDKTRQKMAS, DADPIAAERKRRQRRQDVLKRTAGEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEJ3	MFS domain-containing protein	1	14-37	ESYSDSKLKHTKHPRRPSIEELDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG16	WD_REPEATS_REGION domain-containing protein	3	65-87, 172-197, 399-421	TPEMSRSQRKAATKKAKRDAETF, LDTPSSSKKDRKAKKKQDKTIVEVDD, DARTIFSRPDRKKQSRRPELTVA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKD1	Uncharacterized protein	1	131-153	GVEMSKWKRIRRKPRPKYDVIDQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLD1	Uncharacterized protein	3	64-88, 144-167, 235-254	WQIECDSDPKRRRKGHEKGSQYDSL, IQGSAKKTPPRKAKDQPRNSQTEG, EYVRRAKRKLRDAKAKDEKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ40	Uncharacterized protein	2	33-54, 168-193	EYQIPHCDKKCRHEYRDHLAVS, GTAHVPRPAPRKPKKGQFVPPQGPDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQW7	Protein kinase domain-containing protein	1	100-119	DSMIRPCSRRTRSPENRSPD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRN7	Glycoside hydrolase family 17 protein	1	213-234	SATADAAKRKKRKRWLIGAIVL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS93	Phospholipase D	2	255-282, 1797-1823	EAEQVDGLRPRRRRKSRRPGQNGGDSQQ, TSLNHTASRKGRRRGTTKSSGRPPPEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PST5	Uncharacterized protein	1	345-367	DGQSAPKPAKPQKKARIQPQSMY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUX7	Uncharacterized protein	1	298-318	LNFNKGLKPHIQRRKVPNAGE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW94	IPT/TIG domain-containing protein	2	63-83, 398-427	DSSSDTSSRRKRKTESESPIS, ICSNCIQRERKRAGRKKTKREEEQQHWERY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX31	Uncharacterized protein	3	85-108, 167-188, 219-241	PKPTTYSTKKPPVSRKQRARTSTL, ANVIKKEPKSPRYKKQKTVSAP, SANSRTPKGKPASKRQRNDFTDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXE7	Glycoside hydrolase family 35 protein	1	1-24	MDPRRIPHEYWRDRRKKARAVGLT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZZ1	Uncharacterized protein	1	128-157	VESRVDKKKLEKAERKLRAKQDKKEFKTVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5C5	Uncharacterized protein	3	133-155, 1251-1281, 1464-1491	AKGDSPKPTLSKKPKRWAESTDS, GGWTEKAKKRYCEKVRKGKHRSGKCEVPKKG, GKPKNTPDHPLKQAHRKRSPKGFEQAKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKR4	Rab-GAP TBC domain-containing protein	1	79-98	QPPASRPTLRRPPPRSVTTN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCG2	Uncharacterized protein	1	352-371	LKACEEKRDREQKENKRLSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEW2	Uncharacterized protein	1	232-252	SLRKGTRKLPRTMSHKIRRHY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG70	Uncharacterized protein	1	603-629	TKDSWTWKKVKASKKWFQTKYGKNSTP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGR9	Uncharacterized protein	1	200-220	KEEWQKEKKDYDKLNKGKKNS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHZ7	ATP-dependent DNA helicase CHL1	1	116-138	RQANDKPVFKRQRRSADVKCNTG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM06	Uncharacterized protein	3	154-173, 469-489, 547-572	ENVKRDLKRAQAKRRNTGVE, NDGNIRRKHAGRPRKQKATLP, SFNPEPEVKKREKKSRKLGGTGKTLF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMD2	Uncharacterized protein	1	119-143	GAMPRRSSRRPSQRVTPIRKQSTSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVC4	Uncharacterized protein	3	128-154, 400-424, 561-580	AESFINREIRERQRRNREKTSPEGKKM, ANLAGKKPAPPRKRRMKASDTSKLE, IAPVKKRRSARLSTEKEIKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVS1	DUF2235 domain-containing protein	1	434-453	IDPKWAKAAKWVKKDTKTYI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWF6	Protein kinase domain-containing protein	1	3-22	ADQFKARTMKRKNVKGLALS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWH5	Uncharacterized protein	1	349-369	STKFSVAKRRRPRQSERPSSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXN2	Uncharacterized protein	2	89-112, 132-157	EEAQDEKSKKRAQKKEDKAEQMAQ, AEQNTRPKKELPKRGRPAKNAKGGKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXQ1	Uncharacterized protein (Fragment)	1	160-185	QEREAKYKEDQKKRAKREAQEQKKKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYK5	Cation_ATPase_N domain-containing protein	2	243-262, 1013-1038	AAALRKKGSRVRPVKRNGDG, GVEFWKWCKRVYFRRQKAQDYQKSGM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZG0	Uncharacterized protein	2	12-31, 92-116	TTTTTKSKRHEYTKDPRVEN, EVLIKRTRRTCRQARSMRRTCRLSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZJ2	MYND-type zinc finger protein samB	3	154-173, 588-617, 641-663	TETTDHRSPRNRRHAPPPIS, WEEYTRQFAKCRRCRRTKYCSKECQKGAWG, HNRHGHGHRSHHHHHHHHHSSRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZX6	Uncharacterized protein	1	1014-1047	ESTKKAKKLTSAELRKKKKDRMARRKRGEEVFSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0J9	Uncharacterized protein	1	17-54	KLAAAKKRFEQLKKEQAKKGKKGSKKKADKVDEAKAED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1J2	MI domain-containing protein	4	27-69, 675-702, 751-773, 826-874	ADSSRKRSSISRSPSPRRNAPALRRRSHSRSRSPPTQNGHGKG, YSSRSDSRSRSRARSKSRSPPSRAVRGR, ASVSRGPPTRRGRRDNSYSRSRT, YDSQSRSRSRSPPRHAPAPKRRRNTSSPESVRPRSPTRRKPVEKAPEDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3A9	Uncharacterized protein	1	690-714	NFPQNAKACKKLRKHNPASQCPKSI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q422	Uncharacterized protein	1	93-115	AEQPKGAERKKERGRMEKRGAEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q534	Uncharacterized protein	1	252-273	NSENHRAVWKKKPKELPKDDDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDF1	Uncharacterized protein	1	202-226	AIQLALSHRRKERRKRSFFRRFASH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEJ2	Uncharacterized protein	1	196-215	DDARRKAKYQAKKECKQNTE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFH6	RRM domain-containing protein	2	16-39, 169-193	SGATRGPRRGKNGRLPNRKAAQKS, TAPKNAAKENQKKNQKKDGPKPAVN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG00	Uncharacterized protein	1	144-166	MAPWTGKDRRRERTKVCTQDMRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG21	USP domain-containing protein	1	962-988	IMERRRLCWQWRRRLQTLKKERRAILE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGF9	60S ribosomal protein L13	1	8-47	QIQHNHFRKDWQRRVRVHFDQPGRKQRRRSARHEKAAKLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH49	Uncharacterized protein	1	157-182	DGSNSSEQSHQRRRSRPRIHKDGLAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH71	Uncharacterized protein	1	215-238	NKTESTTKRGRGRPRKKQDSSDGV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI25	Actin-related protein 8	1	181-201	ATEFKQYRRANKRRVLPNSRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKB3	Uncharacterized protein	1	125-144	VEPPQPKKKQEPKRATTWSH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNG1	Uncharacterized protein	1	154-173	SCTSSPRRTNDKRPGSSRRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNN7	O-acyltransferase	1	32-59	LPVGSKVQRKEQQPKETRASKRYKHIFA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ45	Uncharacterized protein	1	163-186	SLQRWQGKCRAKLDREKEHGRNGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQH7	Zn(2)-C6 fungal-type domain-containing protein	2	38-66, 68-95	MPYTCVTCAKRKVKCDKSGPPCNTCRKAK, TDDCHYQEPAPRKRKRKPEEDLQDRVQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQQ6	MYND-type zinc finger protein samB	1	202-226	GEGRYCSKECQKREWKVHKSSCKKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUM2	Uncharacterized protein	1	120-142	WMGSSTRRKPTKQPQRRAHTLAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX80	40S ribosomal protein S25	1	1-29	MAPAATGGKKQKKKWSKGKVKDKANHAVV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXN3	Uncharacterized protein	2	73-92, 100-121	DPRRWPPSSKIDRQAYRRRQ, SIPSRHYAKPRSRRQSHSRMDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY60	S4 RNA-binding domain-containing protein	2	1-26, 96-116	MPRTKRLHALKRPKLRQDWSKWNLYN, GSGADKKPEPQNQRRNQERGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYF9	Cytochrome c oxidase assembly-like protein	1	20-44	MCSSCTQTNRSMRWRKQFSRSLQTS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ15	Uncharacterized protein	1	150-170	EVRGKHHKRIRRRQDLVVEDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ35	tRNA dimethylallyltransferase	1	417-438	QWQAHTRSKAHKKLNAKLHQAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q160	Nucleolar protein 16	1	1-35	MGRELQKKKNRSGINKVRQKPKSKKKILTNPIIAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2G3	DUF1752 domain-containing protein	1	399-419	IVMIKRKKLPGQKQKKAGSRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q364	Uncharacterized protein (Fragment)	1	91-111	VSSQRSKQVRRHRRSESGIFS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3I0	BZIP domain-containing protein	1	42-61	QEPAQPQKRKGGRKPIYATS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Z6	Sterol regulatory element-binding protein cleavage-activating protein	1	999-1025	RQQPSMPELRQRRHARRNTQAQRENVS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q502	Arf-GAP domain-containing protein	1	23-49	KLEANKTCSDCKRNKHPRWASWNLGVF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q556	Calcium-transporting ATPase	1	1303-1325	SPAPPTPDSRRRGRSRSNSALAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0G5	WD_REPEATS_REGION domain-containing protein	1	495-520	YLQREQKRLTGKTKQQPSRHAKDNAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0U0	Zn(2)-C6 fungal-type domain-containing protein	1	5-37	APRLSHKKTRTGCIRCKARKVKCDEARPKCGAC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCI8	Uncharacterized protein (Fragment)	1	580-603	LSSVIATSRKRREQPDRRESQPFG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDD8	SF3b1 domain-containing protein	1	195-218	EEMNGDEKPKRVRKRRWDTSTGDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDN2	WLM domain-containing protein	1	163-190	PEHLCGGSYRRRGKKRKRGRQGGGGEPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDS9	MFS domain-containing protein	1	493-518	IYIGGKPKSRLLKRARRNTFLARKRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHJ3	Lipocalin-like domain-containing protein	1	13-36	QVPKTLPGRRSKSQSRSRTRESSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ68	RRM domain-containing protein	1	65-84	RSNTAPPRNNRPQPQARPVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJL1	Uncharacterized protein	1	1-21	MAPKTHSKKCKATPIKGPATA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ60	alpha-1,2-Mannosidase	1	1-27	MSKGWTRSRGPKFRWRNVPQQHPLQEY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRX4	Rho GEF GTPase	1	104-126	QYPNGQYSPQRRPQQQPLPQPIH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU36	Uncharacterized protein	1	242-262	LPQLRSTSKLRFERRRHIAIQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0F6	WD_REPEATS_REGION domain-containing protein	2	20-40, 147-170	LNIPKIKKPPTVTPKRFTKFF, DELKPFPKSIRRLRQPGRSRRLLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q199	ENDO3c domain-containing protein	3	36-77, 94-115, 127-146	GKKVSKGSSKVKATKKQEPPATPASSKKRSRKAVKQEDFDVN, DEQDAPPPKRTKRTQKEEDLGG, EEEKPTPKKTPKKANYGLTP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1G4	Uncharacterized protein	1	123-147	ARSILLRRTRRVNKYFKRDRNELCV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1U4	Zn(2)-C6 fungal-type domain-containing protein	1	53-84	TTQPTKSNAKDPSRPRRKKARRACFACQRAHL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q225	Uncharacterized protein (Fragment)	2	587-610, 678-705	MEEWLRPKKREVKKKKETLAGKSL, EAQKVEKGISKKKTKAKKDPQAVPTPSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJ95	EGF-like domain-containing protein	2	20-44, 122-147	DQQHHPQYPPPPPRHRPSGNNSSRI, ASPNVNSSPRKPPRRPQRPDESPLSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XZV8	Uncharacterized protein	1	158-183	LNATAQPSKPKQKRAKRNKWTDEETD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIY2	Dothistromin biosynthesis regulatory protein aflR	2	34-60, 70-92	ACATSKVKCSKDKPTCARCTRRGLTCD, TSHATAQKQQQQRQQQQQSQQEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJS2	Uncharacterized protein	1	251-273	AAPEKHQERLRRPSMRRQRSDST
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJW1	Uncharacterized protein	1	136-155	KSDEDRRKYRGKNKIPMETF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKI8	Zn(2)-C6 fungal-type domain-containing protein	1	17-49	SKMHRRSRSGCFTCRLRRKKCEEGKPACKACKH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YPR1	Ras modification protein ERF4	1	61-81	PDNRRASQKSIRSNKSKKSFA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF88	Uncharacterized protein	2	4-26, 331-350	SPPSPSLARGPPRKPKRSGHAVW, RVTFQRTKGIRNPWNNNKEV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHF9	Uncharacterized protein	1	461-488	TEDLKRLQWTKKQRLRKGRAINAQREEY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHI5	DAO domain-containing protein	1	408-430	GATLRGRWSWPKRRLHDHVWTND
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIS0	NDT80 domain-containing protein	1	527-548	PTDPRDPQTSTKSRNKRYFSAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLP2	Uncharacterized protein (Fragment)	1	74-93	KDYTRFKSRKRANCDRISRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN80	Uncharacterized protein	1	19-48	PADVSHRRIAKHSKRRFRHRTAYARERDVY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPA4	Uncharacterized protein	1	25-44	ESPSPPSPRKRLVRNFSYPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSW3	Uncharacterized protein	1	66-93	SPWPGFPAAFRRKRPQRCKRSMWPLSPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUT4	Sfi1 domain-containing protein	1	910-930	PAYMRTPSRSRRTGRFRSLPT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX52	Uncharacterized protein	1	574-596	VPLYWWRVGGRRKHGRRAEEEEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY97	Uncharacterized protein (Fragment)	4	12-31, 102-129, 1460-1486, 1725-1749	ERPSKKVKPADDKENVKEQK, DEEAAAPAKKKQKKTRDGEKGDKKLKIT, YESEPDAIARKKRKRNKPEIKEDLTGD, ERVAALKMKKRRAKFVFKKWFEFEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZQ1	Uncharacterized protein	1	4-23	ADSKLPKGPKWPTHNAPRVW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1A2	Uncharacterized protein	1	445-483	GKVAPRLEQRERRREKRLDRDVRRVQRGREPRDRNRYGE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q386	Uncharacterized protein	1	510-532	EVRAVEKRDLRKQQRAENRYQAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3B8	Uncharacterized protein	1	237-256	AKHVTDQRRKEERKDRQQMM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4J4	GN3L_Grn1 domain-containing protein (Fragment)	1	1-47	MKVGKPKSKRVPVRLRHKIQKASANKQRKERKDAKKNPQWRSRLKKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKX3	G-patch domain-containing protein	2	72-99, 345-439	IPKMSNRDWKKAANKRKRQKSGLPGDAP, DSRDRRRERNHDYDDSRRRDKDRDHRRRDDTDESEEGRRRRKEKERRRRKGRERDGRDDDHERERSRRHGDRDDRHRDGDRDRRRDRSRDLDRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJW1	Uncharacterized protein	3	67-86, 127-146, 371-396	GPPPAKRRKLTPSEKLEKQH, QDEEKRRKAEEKEAKKREKE, TYNKIRSPGTRRKVRRNPFTRARPDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3X7	Zn(2)-C6 fungal-type domain-containing protein	3	4-27, 43-66, 494-516	ELQPNSKKRRISRACDYCHRASKR, FDQPCTFDRPQKRRGAPPHKDTGP, EYMTLQRHRTSRRQQIRPEAPEI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLZ3	Uncharacterized protein	1	39-65	RDTGSNEDARRRRPKRRKLDSDLAGAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGA9	Beta-ketoacyl-[acyl-carrier-protein] synthase I	1	1654-1674	FQTYKQKVEARQKKAYRYFHD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIG2	Zn(2)-C6 fungal-type domain-containing protein	1	23-53	RTGCIPCRDRHVRCDERKPICKRCDRSSTDC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLN7	Ubiquitin carboxyl-terminal hydrolase	1	64-92	SNHPLAVNIKRTRKRKQRDENEPPNKINK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNB1	Uncharacterized protein	2	419-461, 484-529	QQQQPAAPPKPRPRRNPTREYALQAAQRKKSQQYQNYHHRPKS, IRQYEIKDRKEKKKAAEKRRLLEKAKMKGRKNKKGAKGKNNAANNT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPG1	Fe-S cluster assembly protein DRE2	1	270-292	VIPEACKPNTKRRRACKDCSCGL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQC8	Abhydro_lipase domain-containing protein	1	54-78	FNGLSSPYSRRARNRKKAVSSPIAQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRC8	Uncharacterized protein	1	165-188	PSKICADLRRRAKRMKEEGKQAEL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRX0	Uncharacterized protein	1	25-51	EPDTLRSRSSRTKRKAPKRTYTGWITS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSS8	Uncharacterized protein	1	77-96	FLYRTWKTFGRKRKPGSAEF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUU9	HTH APSES-type domain-containing protein	1	455-493	DTPMASTRAMKKRKRSAAGKETHKANKVKKTANNGPTKF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUV7	Uncharacterized protein	1	2-22	ATSSSHIRKRQYQPSTQTRLS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV88	Uncharacterized protein	4	140-162, 267-289, 348-370, 1401-1424	MVVVSRKEAQRRNNYRDLRKGDD, EIETTTRTRGRKRKQDTTQYVMD, QSDVQPKRRKIKTSKFDSMKSKR, EDVGFTPIKKKKKSRDDGDGSDTD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXW8	SH3 domain-containing protein	3	209-232, 399-423, 569-593	NSEKSRNPLKKAMRRRNAKTVQFA, TEPTDKKKDGKEKKKEKEPKKGGML, KTSDDHDKPKKAKRSKQRVELDDFD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ22	Uncharacterized protein	1	45-67	ASLSRPSSAAKRKKTAKDQAEDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1X3	Uncharacterized protein	1	254-281	APVSKITKPKSAKVPKDCRKDVLRRQLV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q266	Uncharacterized protein	1	372-394	QDVNSRFKRRRSKYGITPNRRDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3N9	BZIP domain-containing protein	1	406-428	ARNTAAARKSRAKKVQERDDLEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5C1	Uncharacterized protein	2	42-70, 388-434	EINATRKKESENKEKERKARKQLEALTLE, PLDMRSERSSRSKKSKKAKSEVSSASKMSSKTKAKVKKEPSILRSMF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJV4	Ribosome biogenesis regulatory protein	1	152-174	EEENKRRPGKPSFQKKNPNGGDV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKD3	Diacylglycerol O-acyltransferase	2	2-26, 169-190	IANHRPAVPRKSSKRSLTPPHSPTP, DDTPRSPTRRAHKRGSSRNLQL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLL4	Uncharacterized protein (Fragment)	2	1-20, 634-660	ETPHRKRKRRVEESASALQS, QSLFQRVVDRKNPRRVAKKNTREFLFE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XM81	C6 zinc finger domain-containing protein	1	12-52	NFPRTRSPDGAERDRKRRRKVLSCYDCRRRKLQCDRALPAC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5J7	Uncharacterized protein	1	14-41	PHTQRTTAAGQHKRNNRNRRNNQGLAEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YK28	Uncharacterized protein	1	43-62	ADRVKSTRYKPERPRTFDRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEV3	Uncharacterized protein	1	17-36	SISSKRGRGRGPKMEKRPSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG33	Uncharacterized protein	1	17-38	YIIRRRTCSKLHQQFPRHNWHN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG84	MYND-type zinc finger protein samB	1	181-200	ECQTKDWKNHKVSKEHKGST
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG86	Uncharacterized protein	1	1-24	MDDIRRPKVTKRERKLQISYQLEH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIE9	Uncharacterized protein	1	391-415	NEYKEKVGKRDGQKKEGSRKSKKAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMB8	N-acetyltransferase domain-containing protein	1	199-222	GAESAAQRKERKRKVKVGRQLGVG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMY4	Uncharacterized protein	1	89-117	SDLRNESPSPRRQRRNRSAPEKRRPAMRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPW0	Uncharacterized protein	1	58-77	LRFAVERSGQKKRRRHQRVA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQF0	Uncharacterized protein	1	131-150	FPSAKRCKRSPNSSIKQILR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSX9	Uncharacterized protein	2	33-56, 278-299	MTLHDKIQERRDKKKQQGIDGGQN, STHIPPQKKGDKPKTRDYRMDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU68	RRM domain-containing protein	1	130-149	GRKGGRQRSRSPGERRGRED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q208	26S proteasome regulatory subunit RPN2	1	942-963	STTAQAKRRRLAKDRQNRRESM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q227	TAFII55_N domain-containing protein	2	68-94, 299-321	ADAGAEKKKRPYQRKQDGPGKSKKRSA, LTPPMRWARKNRFRKRMNHTEAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2B1	RNB domain-containing protein	1	514-539	DEVWGQKREKEEKKKRKDVTDQRSGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XH89	Uncharacterized protein	2	895-923, 1002-1024	VEASRKASSTKKPDPKRRRTMPTFPNLPT, APVAPRSPFRRKKFIPSNFPKAM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XL53	Glycogen [starch] synthase	1	558-582	FMFQYTQKSRRQRINQRNRTERLSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3Y4	Uncharacterized protein	1	116-139	PPLPTGPPRQPRPRPPPRPAPGPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN67	25S rRNA adenine-N(1) methyltransferase	1	1-26	MGSRSRTWKKPSLKYGRPPTAQRLKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEP6	Zn(2)-C6 fungal-type domain-containing protein	3	25-49, 84-108, 716-745	KDPPNPSSVKPAKKVKRVGPRSDTV, GMPHCNNCKKSNRTCRRGVRLNFID, HLQPTPPQPQQQPQPKQKPQRPPVGIPNPL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHE3	Uncharacterized protein	1	1-45	MSYAGPEKKKQKPPAKKSKKLLRSDTGPGRPRKVKAETARNRVRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJV4	Uncharacterized protein	1	27-52	RASTTSQTRSSRKRPAPGVKFRNEDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL05	HEME_HALOPEROXIDASE domain-containing protein	1	194-217	TVQTLAKSYNRRRRERKADGGIAL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL67	Uncharacterized protein	1	1417-1444	AYCTHDKKRNALDKWRKKRRGVISHGTY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM82	Vac14_Fig4_bd domain-containing protein	1	3-22	MAGRALKRRWSRESHPYRNS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNC7	Uncharacterized protein	1	70-93	VSAAPPEQARKRKRTEPVQSSRAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS42	PH domain-containing protein	3	1191-1210, 1504-1528, 1553-1577	SRFLTSPKKRAEKERQEREA, VRDFTKPPPPIRKHSVDRKPVSKSV, TASRPKTPPMSPRRGHRSRDAVKSM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU70	Protein kinase domain-containing protein	1	333-356	KVEVNGRRPKKVPRRGGKEVSIKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVB5	Uncharacterized protein	1	97-125	REEHGGSRRRSSRRNSRRGRRGDGAEQRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVG8	Uncharacterized protein	1	354-373	RKAAADRKAKEKKAYAKAFA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX13	Uncharacterized protein	1	915-945	VQKTTKAKAAKAKKPKTTKSKTAKPSKATAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX60	Uncharacterized protein	2	93-117, 552-571	STTPSMTNKAKSRRRNGRNQALTSQ, YPPLHPPPTHQLRRLRSPNA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXJ3	STAS domain-containing protein	1	871-893	GFDPDHPLPNRRKSRTQSGHDFE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZD0	Uncharacterized protein	1	81-105	EVSACRQRFRKSCPKKPQNECKLLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0A4	Sterol reductase-like protein	1	474-497	REMRDDQKCRRKYGKDWEKYCEKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q163	TLC domain-containing protein	1	72-93	RGGGKRRKAKTLFNRWKRMSLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q317	Zn(2)-C6 fungal-type domain-containing protein	1	45-70	YVSIACNECKRRKIKCNGQTPCQRCG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Y2	Uncharacterized protein	2	680-701, 741-760	YAPTHKKRKRPSAGGANKRRRR, DELKQQKKDMRRGKRTQDER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q414	Structural maintenance of chromosomes protein 5	1	45-65	PDSYRRSPKNKDGYDQQQHKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q454	Zn(2)-C6 fungal-type domain-containing protein	1	13-51	GIAGVRKPRKSRGRGLRTTTGCAVCRKRHMKCDEVKPVC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2V2	Uncharacterized protein (Fragment)	2	4-28, 71-93	FDSATAEMRRKRNQKKHASVLRSLQ, EPEIMEKKRTRRRARPALVEKDV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMJ3	Transcription elongation factor 1 homolog	1	12-36	SETTMGKRKKSSRGPVKKQREVLAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ90	Uncharacterized protein	2	95-115, 319-339	TTVVKRSKKDGYKKTIRHRAC, DLLESSKRRKRKSMSGSPLVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJH8	Uncharacterized protein	1	8-27	KQMATIRKRARTQLRQEHPD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK09	Rab-GAP TBC domain-containing protein	1	120-140	IASMRRRGKRISSKKTKDSGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLJ2	Uncharacterized protein	1	12-34	QQHLVPQRIRRLPQQRRLEHTMY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQK0	RNase H domain-containing protein	1	1-22	MSNPKRHHKRQRGDDRHAHTST
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSE7	EST1_DNA_bind domain-containing protein	1	169-191	AGLPPKHQRRHPLDRNHLHRTNS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSP7	tRNA(His) guanylyltransferase	2	32-52, 249-273	GFSKLCKKYHFTKPNDKRALD, TEGSRSQVEKERKRKLKARIVVEHV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTF4	Uncharacterized protein	4	85-113, 192-212, 319-342, 1712-1734	LSTPEPGDKPPNKKPKRGKSPPWDFGEAK, GDAPKRVSPRSKKQVDKLSTP, ASSPKTPSKPSPRIKLKFNPSRHN, VPPPVRKLDKHGRDPSHRPKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVF9	Uncharacterized protein	1	412-435	VPRGTWSEPFRRLRRWRARRKSSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWJ0	PUM-HD domain-containing protein	1	12-34	EEQYTSHPRSPPQRNPNRWSASM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWW0	AAA domain-containing protein	5	77-116, 136-173, 180-208, 235-271, 363-394	IEEPAKIVRKKSKCHKTKHKKKSKAVKKSHNRKTARDDSD, SEEEVRKKKAKAKQLRKAKEKKKSKKSKKHESDSDSDD, NDPPEDEAARRRKKSKKPKKAQESDTEDA, LRAAPTKASKSKRRRSSTKSAKSSRSKSKSKKVDSLE, LRTYYKKTIKSKIKAEKKKKAVKKLEQQRLLC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY27	Eukaryotic translation initiation factor 4C	1	1-26	MPKNKGKGGKNRRRGKNENDNEKREL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ25	Uncharacterized protein	1	9-28	TDWAKQKVPKAYLPRPKWKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZK9	Protoheme IX farnesyltransferase, mitochondrial	1	16-41	LESSAIQEPPHRRRKRLKAVAVADAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2X0	Uncharacterized protein (Fragment)	1	154-174	CAGNCGSRRRTREFRRRCCHG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4K9	Uncharacterized protein	1	34-55	QSWIPLYKKPMRTPARKLRVAC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4X7	Transcription elongation factor SPT5	1	110-132	EDEDLVSRKRRKTSKRNQFIDVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5B6	Uncharacterized protein	1	541-562	MLQTMRKRMRKWFGWDRKSFME
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBM1	Uncharacterized protein (Fragment)	1	22-49	GTFVYVRSRSLNKKRRAKKSSSGARTEV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDV2	HTH La-type RNA-binding domain-containing protein	2	133-154, 572-599	FEVWNNKFIRRKKPLQNRAVVM, DWKEPGPPKAWMKRQQAKKKGEDGKELV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGB1	Uncharacterized protein	1	157-177	IENRTEDIKKRRSKETKSGDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHC8	Uncharacterized protein	1	90-115	VATAKTRKGIRAKRKVRSNFPRPGEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHI1	Uncharacterized protein	1	5-60	DYDRGRDSRDRSPRESRRRSDYHDEQRRDDRSRSPRYRDRGDDREHRNRRDPSPRH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN63	Zn(2)-C6 fungal-type domain-containing protein	1	28-58	TSCATSKVRCSKDKPSCNRCKRRGMACEYDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNB5	Uncharacterized protein	3	198-219, 372-394, 843-864	AFNKNVKRKMTKQDYIKNIRDQ, VGTLWRKSAKRSKTKRPWQEWGA, LRDGHHRDHTHRHRRNKGSDST
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRE7	Uncharacterized protein	1	249-272	KAKEEELKKREKNRIKDDFYRFQV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRY5	Uncharacterized protein	1	233-261	LPMPPPQMRGGRRRSRRKTGTAPFLYRRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTB4	Transcription elongation factor Spt6	2	70-99, 111-137	DDEDDDTKRERRRERKKRRRQEREDDEVLD, QEQRAPKESKFKRLKRGHRAEPAETRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWZ1	Pre-mRNA-splicing factor 18	1	45-70	ELEKARLQRIDKKRKRDDEEAERNAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX94	BHLH domain-containing protein	1	194-221	HPSHPHDPSKPRGRKRQRIPHTAVERRY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXT4	SAM_MT_RSMB_NOP domain-containing protein	1	346-371	TSDEPTSRSKKRKRASQQPATPKQPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYR0	Uncharacterized protein	1	351-370	IQFLKRHKGKLRGVRLRDVH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYT1	mRNA-capping enzyme subunit beta	2	19-44, 333-353	PESFVERPAKRGRSRKYPERPSWAQL, DSNPNKNKPNRVKDRMSYRHL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYU2	Uncharacterized protein	1	1446-1467	LRDVEWRRSGRERQTYRRSEAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ49	DUF4211 domain-containing protein (Fragment)	1	234-261	GDRLVEREKWNTKKRRKYANKIVDQMER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZI8	DUF3591 domain-containing protein	1	535-558	MKEYKFSKPKHIKRKNVKGREAKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZY0	Uncharacterized protein (Fragment)	1	1030-1051	LAKLSMERKRSRNEENKMRMDQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0T6	Uncharacterized protein	2	1-20, 39-100	MAGTKRRSTRQMASRKRSIY, PEESSAPPPKKRKTVSRKPKPQTRSRVKSKPAGRPMKPIFKVGKPRKPNSKAAPEKKREYAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q296	Uncharacterized protein	1	538-560	QAAAAEKRKREERKQKEREQAGL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2T5	Uncharacterized protein	2	33-62, 724-750	WAGSKSPPKSTGKKKKGKKHAAAKQRVIED, IHLHEVPSRPNRKRKRTKAPVAEKADA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q313	Uncharacterized protein	2	146-166, 195-219	FSKSKKQRRIAAKALKRKQLL, REQLTKAMRVRRRSKIKEDNFLKEM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q318	Protein kinase domain-containing protein	1	11-33	AGAGTTKSRKKRMHMVVNGKIFT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q372	Uncharacterized protein	1	50-71	NELPARAPKKRQKHVLHVFTTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4V3	Uncharacterized protein	1	729-754	GAGTGDGGKKKQRKKRGKKKKSDREF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIB0	HET domain-containing protein (Fragment)	1	5-25	NREASCRPIRRDRGEKQNYKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKN6	Uncharacterized protein	1	148-177	YCCMTRPGERVAKRRRCKSRIGASHRIDQQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YML5	Uncharacterized protein	2	104-123, 475-494	MIIAKGKRINRSNRDRGRST, LEPHHRFRPQPQPHQQRWVD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDF3	Uncharacterized protein	1	48-68	ASISTILPWRWRKRRLFAGIA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH26	Uncharacterized protein	2	243-265, 289-313	AGRDGQKDGKPKKRRNVHLVVLT, QARVDARKRKQSYRAQQRAKQDDRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHS4	Uncharacterized protein	1	10-36	NYLSADTTTKSKKRKRKDKTAPEGIII
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIJ8	Uncharacterized protein	2	384-406, 481-517	VTTRTKKVKRMLKHRMRRKSSVS, EGEKSDKSPDPPRKRKKHHKKKNRKHREKNDDEPLET
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP75	Peptidase A1 domain-containing protein	1	8-27	VRGALKRNPAHKRNGLRSYV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRX6	Helicase-like protein	1	581-608	QKDAKAVKESRREKKEVRRKAETKAKMS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV68	Uncharacterized protein	1	501-526	PDTTDSKSTRSMKKRKSFMSAFRRST
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV93	Uncharacterized protein	1	86-105	IKNWRRPSSRDRDKDKEQSC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX73	Uncharacterized protein	1	191-216	AKLEAKKARERERKKEQERKERGEEI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ58	Developmental and secondary metabolism regulator veA	1	208-230	EQGCRVRIRRDVRMRRREPKSGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4W9	F-box domain-containing protein	1	1039-1062	LLNRLSKKQKAQARKKGAKQSNGV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIF1	Uncharacterized protein	1	123-152	GTQHKNEDEKSRKKREKKERTRREMAEREG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2R0	Uncharacterized protein	1	371-397	RDATGIRVTKRKRKRKRPAKLNLTSAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIT1	Uncharacterized protein	1	2-21	SSCRVERKRAHDREAQRASR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKY6	Pyruvate carboxylase	1	970-992	PEPLRSKALRDRRKMDKRPGLYF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH11	Chloride channel protein	1	80-103	QDAARENQRRKVRRQERADFFDAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIG1	Uncharacterized protein	1	143-167	FEADEKTKEKMRRKDGNGRKFKCGV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRP5	MFS domain-containing protein	1	572-592	RSVKGKQGPTKKDSNDRRSTE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS85	40S ribosomal protein S24	1	96-127	GQASKIEKPSRQQRKQRKNRSKESRGTAKTKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWE2	Phospholipid-transporting ATPase	2	74-104, 1094-1116	NGLLKRKIKSVSEKNKGKRRKVSTDDDSDRW, PVYIGKVIRRRVKPPSYRKVQGV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWM9	Uncharacterized protein	1	110-136	LESDYVKLRPTQRRKRGSKTPEAIDHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ33	TBP-associated factor 4	2	427-454, 477-497	LADRDRKAEKERQKKREARKRKAAEAGD, AAPVKVSKKEQNKKAKEAQAQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ88	Uncharacterized protein	1	407-430	EEKIARRASKKVKGFRKSITKAFK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZT5	Uncharacterized protein	1	463-483	LSKGVKRPRAPPKQHPSKQHT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1F5	Uncharacterized protein	2	94-118, 1143-1175	QGQERRYDPRYQPRAQRGPPPQQHH, RLEELRKNPGKREKNAKDSKLVRNNQKQNEENC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3U3	Uncharacterized protein	2	589-610, 704-731	GALAKRQQRRKEDETPEQKRER, KESPLSMGGKKKKRPARRRPAGAHGVHD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q568	Uncharacterized protein	1	3-30	RGNSKAPAAKSKPKPKVTKVEKTSQSTS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKG4	Uncharacterized protein	2	245-269, 494-517	DLEKALKEKERYRRKLKDQLAQSSS, QEEEEKRSRSKKSKKSGSRPSGGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMQ5	Uncharacterized protein	1	36-61	LALPSQRRWVQKPPPRDRPWASRPGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE97	60S ribosomal export protein NMD3	1	403-432	PDVILVKKHYERRKNKGPSNRNWKLKRMAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGC9	Proteasome endopeptidase complex	1	214-237	LMRNYKTPNTRGKKERNYRFTPGT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIF1	Uncharacterized protein	4	180-204, 883-911, 946-966, 1018-1039	RQQAEARKPGKKIKKKSGDALRKAL, HNESKVKQSKGQRGKKGKSRKIAQKYADQ, EEEARVRRRAQHQKAQREGLE, ALTRYKYKAKMQPGQQKKGKAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJL3	Protein kinase domain-containing protein	1	263-282	RTIYASRKFRHPRRHAFGPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLK6	Uncharacterized protein	2	124-148, 932-958	TGRSNGVQPRRKRSVRFKDHGACMS, EDAPPGVRQKKERKRARDKMLRDPTVG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUB6	Uncharacterized protein	1	731-751	RREVEKKKTAAKKQHANHSSH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV89	Pyr_redox_2 domain-containing protein	1	494-513	EIKDLQKRLRRVKQMGPFEY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVD9	Uncharacterized protein	1	236-265	NKVIKRAIVRCTRRWRRPQQPSTPPPRANM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXN9	[Histone H3]-trimethyl-L-lysine(9) demethylase	3	172-195, 209-255, 534-573	ETQYQHPAKRGERRRNQEKVVRGG, DEDEGNSRPKRRPGRPRRNPAPEHESEDEAKDVKPARKKPGRPSKGG, PPASVKGKPATKKRKRETKKEEPKKKKKIRIKIRVSGREP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2L4	Uncharacterized protein	1	667-739	KDGETFPKSSKRPGKNEKPGSRKRKRAPEGAQKTAESDKAKKEPKKPIDEKLAKRNQIIGRKRAMRAKRKGGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3I9	SP-RING-type domain-containing protein	1	90-112	DRLKEKDDRLKKIRDKHQPGDEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Y9	Glycosyltransferase family 34 protein	1	619-642	WISDTWNQRKKKAKAKHDQEALEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4R4	Uncharacterized protein	1	1-28	MHTFTSNRRKSSQRNKRSRPFGKLTIDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4V2	AP-1 complex subunit gamma	1	605-626	GEATKKRHSKLPAKKKPSQIAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Z7	Aspartate--tRNA ligase	1	112-137	GEPMSRNQQRKHERQAEKEKHRQEVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5F7	Uncharacterized protein	1	282-305	ICPATPVAGRKKRHRQWVWTLDPV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHT8	Protein kinase domain-containing protein	3	121-145, 197-220, 1076-1101	HHLDERSKQRLRKRLQKLTNATQLS, IKEAEKAAKKARNKTQKRDRDSMQ, GISPWRWTRILRPKQVRNQQKSQTLS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y332	Uncharacterized protein	1	55-80	LLPGPVTKENRPRPSCRRQTAMRVLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMP0	SANT domain-containing protein	3	298-326, 359-387, 728-758	PTPTKNRRSTTKKTKNTQRKVKSKAKSAE, AIEAPKKATKPRKTRVPRKKVQRSAHNSA, EKEKAAAEKEKRKTAKKAKRTRQKAAAAGTL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNC1	Uncharacterized protein	1	319-338	GEVRRQRERRREHRESNIAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNC4	SH3 domain-containing protein	2	125-149, 946-966	TPESDREKMKREKSKFRPYSSMKTA, QSPSQKIIRLTRKQEHTSRNV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBM6	Chromatin modification-related protein EAF6	1	149-173	PASTGIKAPNKKKRPAEKDDDDDSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC42	Methionyl-tRNA synthetase	1	580-609	KEEEAKKKAARKAEKDRKKAKKAAERAGQA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCB8	Uncharacterized protein (Fragment)	1	330-350	EKSKKHQKAVKELQKRMRKQN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCI0	DUF1767 domain-containing protein	1	210-235	KIDAWDKQWKEDRKRVLKEKAGWTEN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCL2	Uncharacterized protein	1	536-558	IYACTKVYYIQRNRKRDRVWSSM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD31	Uncharacterized protein	1	1-23	MDPVLQKAKQRHHEKKSHRLTID
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJR5	Uncharacterized protein	2	156-182, 202-222	SEMLRREVKARQPKRKKRIELPSDSGD, LPTANQTSRKSKKPPAPQASR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKH0	Uncharacterized protein	1	105-126	GTGGPNPARRRKDRHAFHQIEQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKR6	Transcription initiation factor TFIID subunit 2	2	675-700, 1470-1489	LEIPYNTKYKRLKRSRRQRERAAAEG, ISAPPKPKLKLKLGSRQNSI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKW3	PlsC domain-containing protein	1	653-676	GGDLRKIKNQPAKQKVLQRRPSEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM83	WD_REPEATS_REGION domain-containing protein	2	2-28, 57-80	SLDSSPEPPRRSPKRKRSPSHGIGTPP, SEDEGTKPKRRRVERPRRLNYVPY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPJ0	Uncharacterized protein	1	6-26	AGKRANVKRAQQKQALKKATK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQG7	Cation_ATPase_N domain-containing protein	2	90-123, 929-949	EANRRSFAKDEKPTKSRKKDKKDKKDSAQFELGS, ADVLTRPPRNAKKDRLVNWKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRM5	J domain-containing protein	2	189-208, 254-273	TEKSKEGRMKAARRRRQQES, LEAKYAPKGKKGKKSADVEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRX9	Uncharacterized protein	1	174-202	DSVDMTVKDHRKRDRRRSRGGKSPPPEAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV19	Translation factor GUF1, mitochondrial	1	623-647	AADVSRRRKLLEKQKEGRRKLRAVG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX95	Uncharacterized protein	2	246-274, 346-367	TVSVQSRKRKMQDRTPKKQRNSHRSVEKA, HQPGSAQTRRRPPKLRVGSQQS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZN7	Uncharacterized protein	1	220-246	HNNHKLPFPPARRPNPRPPHNTMQSVR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3K4	Uncharacterized protein	1	1505-1524	IGKVRRGRVKKVPYSYREDM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Y0	Uncharacterized protein	3	45-64, 165-199, 233-256	EPPRPHSQPPPQHRPPPPPH, DYYRGTSRSRSRSRSRHRRHHYHDRPPTQRKKSSG, GHEYSKKKKSHSNPPSKMRDRSYS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4A3	G protein alpha-like subunit	1	13-32	DPEAKKSKEIEKQLREDQKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJ90	C2H2-type domain-containing protein	1	9-32	SNLYRSRSRKQSNASSHRPRRPEV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0M4	Uncharacterized protein	1	1-20	MGKKRRERDRPKSGPDAPYD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YHU3	Ribosome biogenesis protein SLX9 (Fragment)	2	19-39, 42-67	ADTFKTNKKDKRTIKHNALLN, HAAGISKEKKHKRRRPAKKLNTDVGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI92	Uncharacterized protein	1	93-116	DGGGSPKKKKPTPRMKKATAKAVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJP1	Uncharacterized protein	2	232-257, 262-288	LQDTVKKHHKKEDKHKPHDRRGSSSS, DSGSSHGKRRHGKHDHHHHDRHHHDHH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK42	Uncharacterized protein	1	218-241	LDELLAQKAKKKKNKKKKKSSSDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNU7	Cyclin-dependent kinases regulatory subunit	1	4-23	DYTRRNKKPRLLTDSERDKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT28	Ferrochelatase	1	61-80	YLGPLISRRRTPKIKKQYAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZV8	Uncharacterized protein	1	654-674	EAGPSTTPRRRRPEQADELVD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1A0	MAP kinase kinase kinase	1	181-205	LNTSTRPRNTSTHRRRNPNAEYRAQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q221	RING-CH-type domain-containing protein	1	44-68	PAPEGPQPKRRRTHYPPRKCRICLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3G3	HECT domain-containing protein	3	64-102, 143-192, 1554-1575	TNSTTFSSKRKRTTAPQPSPPATERKTKRPRGSNAATII, TSPQQAPRDSSRRKSSRRKSKEDPAASTSTGASRKSRKGSKKDQDVVMKD, TVSKEFCKKKTKLWRENESFEN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q539	SIS domain-containing protein	1	1-21	MTSPRPTKRRRCSGYISPPLT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJX5	Uncharacterized protein	1	191-214	TAENNASKKKERKRRAFANRLSSL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKF7	Uncharacterized protein	1	40-66	IGPALPSAEQPKKKRRKLPYEKQYIAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2H4	Uncharacterized protein	1	397-418	GMSFRPKSAVKRVRRRTGEVAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIE1	Ribosomal protein S9-like protein	2	1-21, 159-185	MAPRSYSKTYKVPRRPFESAR, TSPFGGGRPGRVRRKKAKAAESKDDGE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBP9	Type 1 phosphatases regulator	1	123-142	GDRCEKGKGKERKPSPNAYE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC19	Uncharacterized protein	1	1-45	MFKDMKLRKDRKETAPPPEETAQADQAQKKEKRRRSGLFGSRRKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD32	Uncharacterized protein	1	30-51	GETAKKRQIKGRKNEIKPVAKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGH6	Uncharacterized protein	3	235-254, 1343-1368, 1435-1458	ASKVWNKNRPQPQAPPKQFT, EDYVKPSKTEYKKTNHLKDRPEAQDR, PDEADKKPSRPRGGRGRGRGGRSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIV9	Zn(2)-C6 fungal-type domain-containing protein	1	28-51	SSSAAKKADKAKRVRVSRACDQCR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIZ3	Uncharacterized protein	1	18-44	KVFVEKRTGKTPPKSSKKQRLLDTLDG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKV3	Uncharacterized protein	1	222-241	DGNLCTKPSRRKSRTSSLSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNI5	Uncharacterized protein	1	125-146	EIQTQLKQRKPRRHLSKSNIED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT98	G-patch domain-containing protein	2	100-123, 126-145	EDSSDEERKRKERQKKSRGMSGVG, STTPAGRQRKHKTTYRTVAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVY0	Mitochondrial DNA polymerase catalytic subunit	3	103-134, 438-457, 1043-1069	PYLRLSKKYARASPPPKPRRWVRRSGWTRYYE, RMVKGKKKGDPPRPAARQKK, IASKPKRASKTGGRKPKKKTVGAEAGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXG6	Uncharacterized protein	2	95-121, 505-533	QSISHRSRSSKSRRKEVKQYLSKTYRD, VEIGSARFTRKRPRKRKRALSPHDFCRAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYP7	Xanthine dehydrogenase	1	258-277	LAFGNKRKRWYRPVTLQQLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZF1	Aminotran_1_2 domain-containing protein	1	64-83	ECNQYSPTKGRPRLKKAIAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1L2	Uncharacterized protein	3	102-129, 226-245, 1144-1168	AVRPSSSMTTRPRRERERPERYQPQPAT, ALSPLKRKPGRPPRRPEAML, QTPARAEAIKKANKKKRGRRQHWSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1V2	Uncharacterized protein	2	21-43, 327-351	EAPFPATKKGRGRPRKGTPVVED, GASSPAKSPKKKSNGKVAERFNPWK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q214	Uncharacterized protein	1	1208-1230	GMLVCCCKSRRRTNPNPASQATT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q378	Uncharacterized protein	2	389-408, 812-841	LLFLRWRKTKAKRKNGGYLE, AQKPVQRRSYGRRHSTRQSRKSQPDLNTDM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q572	Zn(2)-C6 fungal-type domain-containing protein	1	126-164	PQMSGGRHKKEIKRRTKTGCLTCRKRRIKCDEGHPTCRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLG8	S5A_REDUCTASE domain-containing protein	1	165-185	VSEQQRHNWKKRPQNRGQLYV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y231	Uncharacterized protein	1	736-755	SPPSEKEKAPTRPRIRKSVV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2K8	Uncharacterized protein	2	69-91, 95-114	CVPDQITKSRRPRRRPLGAALCF, IVRGRECRSYRQCRWSGKSN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIA4	Thioesterase domain-containing protein	1	39-61	AADHDSKKKLKRSRSSQSPSTHP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM13	Zn(2)-C6 fungal-type domain-containing protein	1	30-61	TTACDHCRAKKSKCDGQRPCSRCKRHGVDCIY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCI5	Ribosome assembly protein 3	1	1-26	MAPKSEEKRKRRNKRKTRTEVSSSSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD36	Uncharacterized protein	1	30-49	GSLCRKRCLGEKRYRSMQEH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG66	Uncharacterized protein	1	472-495	LILTKFRKSHWHWQERRRYRPWMS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH23	Mitochondrial genome maintenance protein MGM101	1	236-260	MVEHAVTKKRRKHWMRKEDELKYPL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPN1	Uncharacterized protein	1	499-518	DESDHWWSLKKDKRKKKRAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQB6	Uncharacterized protein	3	160-192, 219-243, 263-285	KYGRARPTYKHLFKKMKERRRRRRDPLTGELML, THMGLPEPAKRRRRKRDPRTGELLP, LALGVPYKRPRRRRHPVTGELMP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS99	Zn(2)-C6 fungal-type domain-containing protein	1	34-59	VDGCVYRQRPFKRQRRSEHESRSPPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSI3	Uncharacterized protein	4	78-100, 638-663, 730-756, 855-878	FDGSNKPTFKRNKKVGGPGVRVA, TAVRPKKQADSQKTPQRRKRPSDEVV, PGKLPDSVTKRRKKAPLKRHQTAPVHG, QTSAVRRSPRQEEAKKKRIQLRAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWH3	RRN7-type domain-containing protein	1	529-548	MERRLIRHEKDLRSQRQDKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWZ5	Uncharacterized protein	1	63-85	TQDSVRQRKRRGQRQTPIKQESD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXQ6	Specific transcription factor-like protein	2	40-66, 107-130	SPAARGGQNVKPKQKRNKPTLSCLECV, PSNKARCITKPSSKTRKPNSITSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q044	C6 transcription factor-like protein	2	40-74, 85-107	KPNGMRPAKSVKRRASKACQCCRARKVRCNVVEHG, VECIVSESKRKKKWSNSGIEGSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1H0	Uncharacterized protein	1	596-615	DMHLQHFKKRRREDDFDIMT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1M1	Amidohydro_3 domain-containing protein	1	16-41	PFDQYAGTRRRGRSKRRLIRLAVAAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2S2	WD_REPEATS_REGION domain-containing protein	1	87-111	STPTASPSRKRQKLKAGDRFIPNRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q440	Uncharacterized protein	1	127-154	KPGKQEQPLKPAQKKTRRRLPTTPEREV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XZK7	Uncharacterized protein	1	241-261	GQEAKTKRKEEREKRFGLSRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0U5	Uncharacterized protein	1	18-42	GGQINAQQHKHKKRKEHASTGFTAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y1W8	Uncharacterized protein	3	60-84, 97-121, 176-195	SDSDLDKKNQRPDVKRTRSNWTTRT, QEEPPIKRKWTQRLNPLRNGRPPPV, KLYSNLAKRRTRPGRINPLI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2K2	PINc domain-containing protein	1	186-206	ATNDRDLKRRIRKIPGVPIIS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y459	Uncharacterized protein	2	90-115, 136-162	MKNTNDQKRWFSTRKKKSINSDSTTY, QPLDAKKSCSHHRNKLRKLPPSRTLQH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM51	Protein kinase domain-containing protein	6	67-100, 138-168, 198-219, 231-259, 597-627, 946-976	TSRSPSPDRYHHHHHHRRHRAKSATRRSSRSPVS, TSRSPSPSTSHHRYHKRHRSRTLERHSSPSR, AADQRTPRRRRSWSEESRRETD, RYWRGESPDRNRRRSRDRRYSRSSPAEQR, GPPRQPSPPRTQKKMVRKKRIKTRPQLSEEH, FESKALRKEKERQERETRRREREGEKRKAEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCC0	Uncharacterized protein	1	1-21	MYKKSRRPNGQRQRSESRWGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCP8	Uncharacterized protein	1	20-44	TDQALRKRAQNRLAQRKHRRIVGEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDG3	Uncharacterized protein	1	38-59	KDLTLAKKPRRARKEWLRGLDV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJF2	Uncharacterized protein	1	544-563	LAKAMCRTRRQPEHDVERGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL47	Uncharacterized protein	1	500-528	AEGGSKGDGKKKRKPKKRKGDANNMSDIM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ19	Uncharacterized protein	1	69-90	LKAVPKKKTSHMKKRHRQMAGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU50	C2H2-type domain-containing protein	1	175-206	EQEEREREEKRQKRNAKRRKTKDGLGHQEVKM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2N3	Methyltransf_11 domain-containing protein	1	118-138	LSTSVKKRVGSKDPKLRCPSL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4N2	BZIP domain-containing protein	1	103-129	EGGSSKIRKRRRNTEAARRYRQRKLDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5C2	Lysine--tRNA ligase	1	42-69	VTGEKVSKTEFKKRQKAREKEAKKAEAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WN78	Uncharacterized protein	1	144-170	YFSSTAPRSRSPRKRRRTPPSENASPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0L4	BZIP domain-containing protein	1	27-77	RPSMPMPAMPQRKKKPGPKRDSKPAPNEKLERNRQAQRTHRERKEQYTKDL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJQ0	Uncharacterized protein	1	100-119	GNYALKQKWQQKKQDCDNQY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YK15	Glycosyltransferase family 20 protein	1	20-39	ESELPSRRRSPPFQLERRGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCN3	Structural maintenance of chromosomes protein	2	43-69, 530-554	GEPASPTKKAAPKRRSVKDARAARQSR, VVKIEEKKKHLKNKEKKLEKTRDSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD81	Uncharacterized protein	2	93-126, 189-211	KYGPHSLHKRLHRPTKPRPSSVRKHSRNDDQRHA, QIQPCRRLSKHRCRTIRKFPWEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFN0	Uncharacterized protein	1	72-114	SQIPYQRTTNRRRPRNRRRHRQRHRPRSRRRRRQSPIAKPLWD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKF3	Uncharacterized protein	2	162-184, 209-241	ISRTKLINKERKRHECPDCNKSC, VQSCTYNTRRKDKMKEHCRKMHKHKKGVETFAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLB1	Protein SSH4	1	431-454	KVFDNPKKNKVSKVKQNNKRDDSM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLU1	Ribosomal_L18e/L15P domain-containing protein	1	167-189	FVESKGRKFERARGRRRSRGFKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMV8	Uncharacterized protein	2	7-31, 198-217	MIKRQFTKLHHKMKAVKNRNEDEEN, PTPDLFKKPKKRLPAEQKME
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PND3	Uncharacterized protein	1	72-100	SPMPIATHPRGRKRKSCDECARQKKACNG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPB0	Plasma membrane ATPase	1	64-83	KEDEAKPKKAWQFWKKSDDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ44	Uncharacterized protein	1	301-323	HPSSSPSPPPRKQLRPHISKPLH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR02	SCA7 domain-containing protein	2	120-146, 182-206	HIEACLNKKQEKQRKKKEAKDARDAAA, VDDGGPSKKKKKKDESKGKAARPKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTG9	Uncharacterized protein	1	317-337	LTKRKVKDSSLDKSRKRRAVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTR9	Uncharacterized protein	5	105-125, 237-257, 456-477, 874-894, 1055-1082	LRKINTKRDNAGKLPKRRKAE, PETEKGAKKRSPQPLKKSESI, PRTAEKPKKAKAPKKKPQTITD, APDQMKRPRGRPKKIASVDKE, KIELQRLKAHPKTKSRKKKSASTVADEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU33	Protein kinase domain-containing protein	1	261-283	IMAWMKAEKAKRTKHRDESSESA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUU3	DNA topoisomerase 2	4	45-73, 286-309, 1283-1302, 1398-1419	LKTTTKTAPKAAPKPKKRAKSESDDENDD, QLDTVDRKTKQRYRQTWRNNMSTM, EELKREKKVKAKGRRASAKL, ADGAPAKKRGRPKKVVDPDDSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXM5	Uncharacterized protein (Fragment)	1	21-62	ASKPKSKSGPRPPPTQHKPKPTGISKKKKPPHLRYTEKELKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY19	Uncharacterized protein	2	161-181, 196-232	GSVPNHKRPGKKARVKTRTML, ELKEAAEREKRTRRNREKKAKKKQREKAKKAEGQAGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYD3	Glutamine amidotransferase type-2 domain-containing protein	1	1627-1653	DKTKGFMKYQRRSEKYRQAKTRTRDWG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYY3	Uncharacterized protein	3	44-66, 439-466, 477-503	KEDHVERRPAYKRRRWQIGMFLF, DTPRIETSEHQRQRRRRRSTSGKALDSN, ISRSSTMPANRRQSRRRKSSHHSGALF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1K4	Uncharacterized protein	1	371-394	GRVRVLTKDKSQRVRKPEWTEKDL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2P8	Uncharacterized protein	3	54-76, 107-129, 288-336	RDNDDMPKRRSRRRYSEDDSDDR, SYDPINDRPRRRRSRADPDRGVD, ASTERGHSRSPPRRHRSRKEDYSPSRDSYSSRDTRRRARSERRHDDAPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3S8	BHLH domain-containing protein	1	301-326	PPFSTQEAKRRRRRESHNMVERRRRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4N1	Uncharacterized protein	1	44-68	SKETAKKTVKAVEKKSKKKAAATPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5A2	Uncharacterized protein	1	201-222	MAEQRRAKKEAKDQRRLGKDAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y1V3	Uncharacterized protein (Fragment)	1	22-47	KSLRGKACKVRLRWRGKLRKRCMETG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEM4	Uncharacterized protein	1	1-22	MASTRWRRRWSRGKQTSYAPLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFA4	Uncharacterized protein	1	64-88	EMNLDSLRKKRCKRLGIKGVKTFNG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHI4	S5 DRBM domain-containing protein	1	150-171	ETERSYRKERTRRPTSKQDTEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHZ4	MYND-type zinc finger protein samB	1	87-112	RVRYCSRSCQSKAWKREHKYECKVLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI45	Peptidase_M24 domain-containing protein	1	374-408	LEQPLSKEAKSKPKNKKKKKKPAKKAAPKEEEEEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJI0	Uncharacterized protein	1	224-245	RGYSPRRDDYRRRTPPPRGYYD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKI1	Uncharacterized protein (Fragment)	1	1-35	MARGKRHKRRASKDLNALPKKAQRAKKTPVKRMAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKZ1	F-box domain-containing protein	1	41-60	DSVRHLRRLSRTCRRIQHLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLZ6	DRIM domain-containing protein	2	10-42, 2466-2519	GKTGKDYKVVKPKKSTKHTTPHTRNHRFKSFND, LAEARTEAKNRRDERRQKRRIEAVSAPEKWASGKKRKYEAKKVKMKAKGQEARG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP61	PWWP domain-containing protein	1	108-134	TGGVPEHKSKKANKNKKPPPQMHLDCK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPZ3	MFS domain-containing protein	1	44-63	NTQHICLKKLRRKLDWHLVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS54	RING-type domain-containing protein	2	316-337, 342-362	ASTNTRRRKRRATQSPASPRER, AHPQLKRPRLRRPPNAAPEQP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV24	Photolyase/cryptochrome alpha/beta domain-containing protein	1	11-32	VRPDPSPSKKRHIEVKREPSNG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ09	Uncharacterized protein	2	873-897, 946-968	EKERQRAQRQAERHLRRQRKEAAAS, VASQIVRGRHRERPPKKRRKEGF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZV1	Uncharacterized protein	4	260-289, 349-378, 390-412, 425-449	ERKAWSVIKQRQKRQIRRTKVKTNRAKGPA, KAKAEKKAQDKIKKAEKKRKRESKDSFAGV, DADAKDKPVKPAKKKSKTAADSG, GDVTKADKAPRKIQKRKNGAEEEDG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q145	Zn(2)-C6 fungal-type domain-containing protein	2	13-38, 58-80	LATPDSEKLNRKRQRQPRNSACQGCA, MDRDCVPAVPKPRKRRTESGIAF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1K1	Uncharacterized protein	2	56-79, 191-213	EENEIAKKKGSKKKRNIKDVVSTQ, FATQRAKPAKKRKRAAAEPEPED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1X8	Uncharacterized protein	1	97-121	METSRSSRSTQRRDRHRCKECDSRF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q469	Uncharacterized protein	1	84-113	VSEKVEKNSSKPTKKRKNAAEPKKPAKVPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q474	HMG box domain-containing protein	1	94-126	STSKSRVSKSPAPKSRREKKSKLDRSKTPKLTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI05	Uncharacterized protein	1	354-376	MVGVKQRKKCDHCKKGCGPFRGC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC20	HAUS6_N domain-containing protein (Fragment)	1	279-298	NRTRQQKQRLQRWHRFHDKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF86	DUF2013 domain-containing protein	1	426-449	AKVTKQKPSVPAPRRGRKGSKAVG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGC5	CUE domain-containing protein	1	105-127	SQFAEVKKPKDRARSKAKEESSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJH9	Uncharacterized protein	1	13-39	ATQEKRPRLNPARRKSAKAKEHSQTAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLI1	Uncharacterized protein	1	22-43	IERIQSKLRPTSKRLPNPPLSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN53	DUF2439 domain-containing protein	1	25-48	DFNCLYTHDVKKKAKKWQDGLLRY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNX4	AB hydrolase-1 domain-containing protein (Fragment)	1	12-31	ADIHKFKRIKPDDEKENPFV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ09	AIP3 domain-containing protein	1	140-164	INLLHGLKKKQQRLRQRSNREGAGE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRB9	Uncharacterized protein	1	167-188	STEFSFWYRKHHCRKCGRVVCA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRJ3	Uncharacterized protein	1	80-104	TFPTTKECIHLRRRHRSLSKAPASR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRT6	ENTH domain-containing protein	2	6-31, 223-246	SSSHLLSTGRRRRRHSSAFRDIRLQL, SDVDRIRQERKKARQTKNKYGGVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT57	Uncharacterized protein	2	70-89, 399-418	PETTRPRRTASRQNLRNDSI, KIESKRRNSEAKQRSRQNSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTC6	Uncharacterized protein	1	319-343	NYDPMPPRRPYRRKKWQDRYDDGDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW85	Importin subunit alpha	1	11-41	RNNYKAKSTFKPDELRRRREEQQVEIRKQKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWY0	WD40-repeat-containing protein	1	436-459	EMTLVAQRRRHRRKPTPQQIASLH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWZ3	Uncharacterized protein	4	121-148, 1085-1107, 2638-2665, 2745-2768	GRLWRRLTETKEKIKRLHRQIRWLRLVD, GDKSPNPKNSQRHSRRKIRYDTD, DKRVSGRANSHEKKRKVKDKSKEATSDD, IIGNKFSHHKPSRQQQFRLRELAN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXY8	Uncharacterized protein	1	218-239	RLNDWLMKKKRRQLKEVGYELQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3C5	BZIP domain-containing protein	1	55-86	AERRRIQNRIAQRNYRKKLKKRLEDLERRAGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4A1	Uncharacterized protein	1	309-328	EERFQKFKASRKPCTVCGKH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLY2	Uncharacterized protein	1	44-63	SDTSQHSRSCYRRRIHRAAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XM07	ULP_PROTEASE domain-containing protein	2	246-265, 1028-1050	TSISKKSRNKLPWQGTEQRA, RPGTATSKKSRKKAPAPRTYDPD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y494	Splicing factor YJU2	2	15-37, 239-263	FDPSKLERRRGPKQTGPKQQTVR, PAVPTFGRQIKKKKKEPVSLLGIKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YK44	Uncharacterized protein	1	31-55	IDHEIERARKRRRHSSYNPRSWSLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBZ0	Glycosyltransferase family 90 protein	1	147-170	LWDWWSVQRKTKRRRTISESDDDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC63	RNA polymerase II subunit B1 CTD phosphatase RPAP2 homolog	1	248-269	VEGYQTRRYGKKKQDKDSDEGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PET7	XPG_I_2 domain-containing protein	1	542-572	GEDDHEDQGPKKRRKKLKKSPQGSKTIDKLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJV2	BTB domain-containing protein	1	215-242	QTTSVHKQPNFPRRRKWHKHADAAEFLQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNQ6	Uncharacterized protein	1	778-807	IQAKHAVDRERSRRHWWKKQDHKQASWMDQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUN1	Mitochondrial distribution and morphology protein 12	1	1-44	MCWTRFPQPQLPRLRRRLHLCESTPSPKPPRRHHHKLYDTTSMS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV72	HMG box domain-containing protein	1	327-349	SYAGTPTNRKRKHRDEEDDEQPT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVC9	Helicase C-terminal domain-containing protein	1	277-299	RKSRISTKPGFLRKKDNNKQGAI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ63	Copper-fist domain-containing protein	1	73-97	VVARSACPHKSKKGEKRSGECRCDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ74	Zn(2)-C6 fungal-type domain-containing protein	2	29-65, 84-106	DPSPRKGPGDGKKHTKHARRPSRESKRKDAAPRKAAA, GCATCKAKRLKCGEEKPHCTNCT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Z7	Sen15 domain-containing protein	1	157-179	EEQRGEKDSKWRRNLPKRLLLAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q110	Uncharacterized protein	1	56-75	RKRQASTKGRTYPHRKRTVA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1F0	Uncharacterized protein	2	399-427, 466-485	ESGRGRARAGKARPKPRRRRNSEYSEDED, VEQARERTPKRDRARPGLTT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1V7	Uncharacterized protein	1	80-100	PPDGVRPRRIPPRYTRRPTRM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3F6	Uncharacterized protein	2	76-95, 412-442	VDTAWRTKRHKGSCRCLAYS, DDSSDDEKSRRHKKKRKRGKGQPVTDSNFNF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WK55	Uncharacterized protein	3	110-131, 139-162, 505-525	VSTSRDRYRRPTTASRNAQRSP, EGETRRLQKRMPEHRLPRKSPSTS, YESLRRSKSRSRSRGPSSRAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIW9	Uncharacterized protein	1	1-24	MSAGGTKKARKQKVKAQRTKGMGV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y208	RING-type E3 ubiquitin transferase	1	763-783	DESAGKGKGKKGKKQVLFNWG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YID5	BTB domain-containing protein	1	301-322	QKQDSNPVRKPRCHYHNHSEGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIE5	Cir_N domain-containing protein	4	174-201, 233-252, 267-287, 297-321	VEEDEKKDSHRKHRHRHRSHRHRDDGAG, SESRSRSRSRRSPRGNDGDR, ASRSRSPARRRDRGDCRDRRT, SSDSRSRSRSPYKQRRDDDRSSHRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBY5	Uncharacterized protein (Fragment)	1	2-30	QPPEREAAKQQSNKKNKSKKTPATSAQEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCS8	1,3-beta-D-glucan-UDP glucosyltransferase	3	285-314, 329-348, 1820-1846	NMKLGKANRATRKARKAAKKKATENPQNEE, AEYRWKTRMNRMSQHDRVRQ, QIRPPIYSLKQSKLRKRRVVRYAILYF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDY2	DUF4110 domain-containing protein	2	1-45, 310-330	MPKAKDAKKKAEKKARVEAKTAKKEKQKEKKTSKKPGKDDDSDAE, NTPPAVRWERRKRPVNTPNPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFL5	Zn(2)-C6 fungal-type domain-containing protein	1	43-64	LACDRCRLRRMKCDGLRPSCKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG76	tRNA 4-demethylwyosine synthase (AdoMet-dependent)	1	86-109	ATISKGPRRIQGKRISRPKQEAGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGN1	BTB domain-containing protein	1	8-35	SKGDRAGKARKISKRSFRDDAKQRLREQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGT1	Uncharacterized protein	1	27-46	LSKLTRYNSRTKNKGSRYYH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIH3	Uncharacterized protein	1	282-304	RWEARHSDTRRERQRQEQRVSVG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIN5	MIT domain-containing protein	1	299-321	DDVNGHRRPRNRERSEKDKKTML
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMY0	Uncharacterized protein	1	2-25	ASNTSTPRSRSRSKRSTTNLSDLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNY2	Nickel/cobalt efflux system	1	351-371	LSVLLYKPWRKRVDRNREAIV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR38	DUF155 domain-containing protein	1	18-44	VTDARDTKDNRPQPPRPQPQRAGTRII
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRX8	Uncharacterized protein	1	95-114	GTFLHSARPRRQRRLTGPLD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PST4	Uncharacterized protein	1	7-30	RSFCADKSRHRAPGKRQHGWLKNN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT01	Uncharacterized protein (Fragment)	1	110-129	VEMPKAVIRKRKRDDQSTEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT73	Clr5 domain-containing protein (Fragment)	1	190-213	ESDERLQARKRRRRIRGYGKQLTS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUI8	Lysophospholipase	1	741-774	KEQTKRTIRAVWQRKRAARLRREKEQREMQRLVK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYL5	Homeobox domain-containing protein	1	40-72	QNNASRRPPRKSTLTQQQKNQKRQRATQDQLMT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1H3	Uncharacterized protein	3	28-47, 75-96, 143-162	LVHPRASPPKLKKRDSTLTQ, EEYEEPRAKKRRKTLGSSTKAG, PPSAQPKPARPLPRRRPAPD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Q8	Serine/threonine-protein phosphatase 2A activator	1	12-35	NLSNALPKLTPRRRPRTEEAPLNP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2S1	NUC173 domain-containing protein	2	203-225, 997-1023	VEEANGKKRKQRQRDDTQHEPGL, EKLISNIRKTRERRKKKRDAGEEDEDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4G9	Isocitrate lyase	1	1-23	MFRSAARVLRQRQRCLRQPVVTE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM47	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	3	168-190, 382-408, 538-557	TAFSKAKYTLRKHKKYLKRFVAM, AWKSGKRGTYYKKRRRWERCRIIVDET, RGNFGSKKRKIEKQAMEVDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMA6	Uncharacterized protein	2	5-24, 31-51	KTFRTKVKLAKAQKQNRPIP, TGNTIRYNAKRRHWRKTRIGI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBJ8	Protein kinase domain-containing protein	1	54-82	NYQKCVIKVLKPVKKKKIKREIKILQNLS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBN4	Uncharacterized protein	1	1-33	MSNPKAKQLPPPQTKPPHSKPSQPKSQLTKNPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBV7	Uncharacterized protein	1	5-29	DAASSKAHFKRPKKGPRGHSRHGLC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD57	Uncharacterized protein	2	44-64, 609-629	LSASRAKQSKRDEALRKKLET, EESPSIRRRDRKSAAAQPVKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG04	Fatty acid hydroxylase domain-containing protein	1	297-319	TESGPEAAKRRREKKMAKAKKAQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH34	Uncharacterized protein	4	305-329, 662-683, 697-720, 738-758	EPTEGTQKPKRGRKRKSQEAVQEQD, AAKPPAKKGRGRPPKAKPTGKV, EESVTKKARGRPAKAKSKEKVFED, IDEPPKEKRPGRPPKAQPGID
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHW1	Uncharacterized protein	2	40-65, 746-769	ANTPSRVSEKPARKRRKVDYAGGDGS, SDTHDTFKCKRCKDGRQVMKAPAM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ21	Uncharacterized protein (Fragment)	8	23-66, 105-133, 351-373, 392-415, 486-506, 740-759, 780-799, 917-948	IAEKNARKWRHERSRMDSNNVAPKRPSKKRRKSPEQPQKELQDV, RAHMAARAKEEKRRKRRAKTAARKAKEAT, DATEIKSKKRKIRRSGLSEKEEG, NVTENEKRPRKKSKRAESTRSASV, LVEVVKPRRKRKKTSDAVDDE, LGGKREGKRCREKYHKLMAR, DETVPKKSKHRDVSARRALE, KGDIQQFKKQQQEQRRAKKPKPEMQKSKEYVA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJB3	Ribonuclease H2 subunit B	1	382-405	ALDKGEAKKRKKEEEEARKKNTSH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKN7	Uncharacterized protein	1	35-55	EANGYRWRHGRRRSIVNNVLF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNN4	Uncharacterized protein	1	403-430	RDGSRRLFKAKQEKLRKQRERNWWEVDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP38	Zn(2)-C6 fungal-type domain-containing protein	1	30-63	VTAAGKKRTRTGCLNCRRKRRKCDENKPTCEGCQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPE4	Uncharacterized protein	1	146-172	EHTRHREPERPSKRGRKLAQRKCQEPI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSL4	Autophagy-related protein 2	2	109-142, 1746-1774	ASPRRSRRSQSPATTRTPQHRKMNRRLHSPTTPY, YSAFGGPARQRQRRRLKLGRSKNHKISFE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PST1	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	1	19-62	SSQLQRTGSGHRQKKPQSRQLLSCTKCRERKVKCDRTKPCSACC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTG8	TruB_N domain-containing protein	1	42-75	LQREQDKRDAEKHNQKNKRKWRGRRETSVKMGHG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY03	DNA helicase	1	668-692	KEVVEDGKRRRKRAKRSPDPEAMDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q437	WD_REPEATS_REGION domain-containing protein	1	741-760	LDSRSCKRRKSEAADQGLKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4M6	Uncharacterized protein (Fragment)	1	33-70	CGRVMSSKKLSKKQNEVKYCSDRCRSRKPGAKDRQIER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLZ7	Zn(2)-C6 fungal-type domain-containing protein	1	1-35	MPSRRPHTKTRHGCNTCKARKVRCDEEKPVCRNCT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMU3	tRNA-splicing endonuclease subunit Sen2	2	25-52, 363-383	HDHPATPSPLKPRKRKPNYNLIHRKPLP, RTEQGAKERRVRQNNDWWWMH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YPK0	Uncharacterized protein	2	91-120, 290-312	ETHHMDHRNKAKRGKRKCRNRVAWICARNS, ISPKSITRKPRAYKGKVKPRATA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCD3	Glycosyltransferase family 31 protein	1	5-24	ASDWRNTKRRPTSQCCIVLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD88	Uncharacterized protein	1	108-127	SSTSRPKKKLRVSTKSDSRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDG8	Uncharacterized protein (Fragment)	1	85-113	RNPPIRRLPDQLRPRRKWRPSPEPLPAAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDW8	FAD binding domain-containing protein	1	97-116	KMCLKEYSKKWKKPWLSVHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE29	Uncharacterized protein	1	240-259	DGDHRQPKNKDDKRKGPRSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFG5	CRAL-TRIO domain-containing protein	1	56-79	NDTVEKKKKKGLMGRFKKDKSDKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFM3	Uncharacterized protein	1	9-29	LEKVGSREKRRQRGVDEGKLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK60	Uncharacterized protein	1	47-73	ERYESTIQKRWLKKTKEQKRRILLASW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQG5	Uncharacterized protein	1	261-283	AIFAWRLWGKKKRERLPHDDAID
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRP0	5_nucleotid_C domain-containing protein	1	606-630	ERELRIVRKVMRRWRRSARIEGHAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV53	Histone deacetylase	1	520-544	KDLQDTKHERERRWKERNPAGRGEL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWG5	FHA domain-containing protein	1	489-512	SLGKTSIRTARKQHKQYYWKRPRH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q006	Uncharacterized protein	1	16-43	ERSPTFPSYHSTRKKPRRWPLVLRFIKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0I3	Zn(2)-C6 fungal-type domain-containing protein	1	40-67	AGRVCVFTPLQKRRQRKRTDTRVAELEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1A9	Phosphoinositide phospholipase C	1	258-281	AGTWLTKLTKRRQKRIRLWLDSHS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1T5	Uncharacterized protein (Fragment)	1	8-42	NPAQAQRKAEKQREISKNKKNLQHQRNEKLARRNP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5I0	Uncharacterized protein	1	415-439	DHERLAKDKPTPKKHRYRSGLGSVL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNH3	Cation-transporting ATPase	2	144-164, 1341-1366	SMDSRPRKYSRKSSGYSRSSR, GKVVQRFSSTPKKRKEYKIISKEMRI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XI40	Uncharacterized protein	1	69-92	PDELKTKGERKRWREQMRARAIQA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIC3	Uncharacterized protein	2	11-37, 129-148	PGGPMSFKSNPQRNKTQKWVKAPTYDY, SDIPRSRSRPRDFTNPEQVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLI3	Uncharacterized protein	1	66-92	DTNTSTFSAKKKRKRTTEKKFNFEWNT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLK1	Uncharacterized protein	1	5-33	EPAPPLRRLDPQTTKKKKDDDKQDIHDVF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBN0	DUF2415 domain-containing protein	1	404-423	YIEARRRQRQHRQDLTNQRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBU1	Mediator of RNA polymerase II transcription subunit 14	1	417-440	GVSTGKDSKRRSRRPSNPQLSVRW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCV2	Uncharacterized protein	1	921-945	PQKKGFKAFFTRKKATQKKAWETYD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCX8	Uncharacterized protein	1	45-68	YSTFYARCPLKRKQQQQQHLETND
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGD7	TRAM domain-containing protein	1	7-30	FNEGQRHFKKSKKQKTSTVAEGSN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHT6	DDB1- and CUL4-associated factor 13	2	405-425, 429-463	MPEIRRIARHRHVPKVVKKAG, GVELKSIKRREENERKHTRKGQKARRSEREKMVLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIR0	Uncharacterized protein	1	51-72	NELPKKTPTKGPPANKPPAKKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN96	Uncharacterized protein	2	321-342, 345-371	AEERRTQSDKLKKEERDRKLSR, ADEQKKFLEKEKEKQQRKGMKKQTQRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPW5	Histone acetyltransferase	4	60-82, 252-273, 338-370, 961-1004	FVGAVKTRSARPRRGNPSKDESD, IDEPPRPANRKRRRTTPLEDEE, DQIEKDVQKKQKRRERDRQRRLRNNQSRRTVTV, APPAAKRRPGRPFGRRSGTRNSYNSTPRRSRPGNSRRHNHSPSQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSB6	Trehalase	1	521-544	ETSSTWDRRAKKRRQQMDKLMWDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTL0	Uncharacterized protein	1	17-37	QQNVKHNSPRIKRPVARSDTV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU43	Ubiquitin carboxyl-terminal hydrolase	1	300-320	DAKTATKKRIEDRQKRGQGGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXS0	Uncharacterized protein	1	18-37	VSLVRMKKGKKRYEIACYKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY90	Smr domain-containing protein	1	193-219	SEDNVAKRGRKKKTKANKVRNLDDRRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0N5	Uncharacterized protein	1	147-172	AACREQQSPRRRRQRLLAKRGRPGSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1P3	Uncharacterized protein	1	169-197	DREDRLARSRQRLKRCRPDRPNAQQAPKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3H6	Probable lysosomal cobalamin transporter	1	287-308	ADLTRKLKRARHRKGRFQDEWT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Z2	Uncharacterized protein	2	107-130, 916-936	PSFEEPRRAPQPPKRPPRPPSELF, VTRGLSTRKTRNPVAKARRLF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMR7	Uncharacterized protein	1	320-339	IRSLVQKEGKSRKRQSDVGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5X0	Uncharacterized protein	1	61-87	GGGWPGKAVKRQRHHVRDWRRERSAKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKZ7	Uncharacterized protein	3	14-66, 289-308, 877-906	LPQTQCSPSMDEPRRRRKHDDRDRESKSSSLRDSHKHRSSKKSASSSKLRSES, SIAPDRKPSRAQRRPPNIAT, DDSASQISVNRRHRHRRERKTPNPETVPEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMY9	Uncharacterized protein	1	81-103	IDDGKCRRRREWRTLSKAQQQDY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG43	Uncharacterized protein	1	36-60	VQSTRLPTPPKSNRKRSFTRPAGIE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG65	MFS domain-containing protein	1	80-100	ETPLAGGRRRRRRSSAQSFEL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH75	Kinesin motor domain-containing protein	1	617-637	FVYRPRTKIRRPALQSLHRPT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ32	Zn(2)-C6 fungal-type domain-containing protein	1	7-34	KTGCMTCLARKKKCDEKRPVCSHCERLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJS1	MutS protein homolog 3	1	21-41	SASLRTKQHVRNQVQQHPQTR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKD2	Uncharacterized protein	4	80-103, 271-293, 340-359, 379-402	QADERDKKRLDKTQKERDRIQTAI, EFASERPAKRRRLTPRRPIRAIS, TTPGIKRKGKWKQKAAVTTE, QSWVNRRSAARQRHKERRRESTQA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL61	Uncharacterized protein	1	453-483	ADPKASRRTSERTPRRRERRQRENERDVEYY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLW6	AMP-binding domain-containing protein	2	5-27, 79-98	MGRKDLKTLVPQPKNYKRPPFTV, LGKRKLIKIHVENKKIKKVI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMH7	Uncharacterized protein	1	154-174	QGSSTDRQRKCQPCRRVSLVS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPS2	Mitochondrial distribution and morphology protein 34	1	348-374	SLGSGASRTRPKKRKNRIVNLRKTKED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPT2	Uncharacterized protein	1	197-216	DAANRKMHDHRRKLREAKSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQS5	Uncharacterized protein	1	63-88	PRPHSTQKAPSPKPRQKQRAQSTPFS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUN3	SNRNP27 domain-containing protein	1	17-58	DTRNHRPRYEQDRSRSPRGRDRRDDRRRDRSPPRNNPNSRAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXI1	Uncharacterized protein	1	50-71	TPKMEVKKRKTGKKTMASRPIP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZW9	Uncharacterized protein	1	183-208	SRDDYIPRRERRGRTRRREDERLTLS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3R6	Uncharacterized protein	1	5-28	TVAPTRSNPPRSNSKRKQSLDVDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4C3	Uncharacterized protein	2	76-96, 703-729	EETAAHKARQAQKQKKTQAML, GAYGDGEKQRKKKGKKHRHATTSSSGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4E2	Arginyl-tRNA--protein transferase 1	1	59-80	EAEKNFPKTKEEKKRSKDSFDL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKZ1	Uncharacterized protein	1	1027-1057	DDGWADMKKKREEKKRFKWGKKSPSQATAEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGW9	Uncharacterized protein	1	45-64	LTRTPRRKFRICCKLQNRDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJH0	zf-LYAR domain-containing protein	4	76-95, 128-152, 282-310, 362-382	GDVLTKKKLDPHRNQCRGAS, YRPEKDSQSKKAKFEKRKSMNGSHA, YTTPAPKEHKREKKDKRTGEKRKRNVDEL, PTPISPSKRSKREKDAKEGAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0N2	SURF1-like protein	1	37-57	PPPFICTHCIRRNPRLRPSSI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD60	SH3 domain-containing protein	1	63-86	KYEPPVPSRPTRPARPKQETVPVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF58	Uncharacterized protein	1	49-71	QMAYKLRKTTKCKRLHTVKPQAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF98	PepX_C domain-containing protein	1	20-39	TTTLPAGHRKRPQCRPLATD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGJ5	Uncharacterized protein	1	332-356	EFLLYHPHKARQRRKEHIKEHFDET
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHU6	Uncharacterized protein	1	28-47	NSSMPSKEPKGKRSPRTLCS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK27	Uncharacterized protein	2	31-59, 1142-1167	ASPNLKKSSTMRWKKSKKQLPELKPQLDL, APPIPPINPKRRGTRKLFSRNRLDTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKV7	Zn(2)-C6 fungal-type domain-containing protein	1	27-78	AALKAKLSRKRTKTGCLTCRKRRIKCGEERPVCKNCIKSKRHCDGYNQRVIF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN57	Thioredoxin domain-containing protein	1	10-34	ALPPLPPAKKRAPAKPKAKKDDAAQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN83	Uncharacterized protein	1	7-39	VYSVRPSRRALPRIQNRDPKRRRGDTDKDDSED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP27	Probable cytosolic iron-sulfur protein assembly protein 1	1	278-297	SDDKTIRVWRRKPREKDEAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQT2	Zn(2)-C6 fungal-type domain-containing protein	2	1-35, 47-71	MEASSSRHGRKYKSRKERPCDACRRRKVCCIRDSG, QVCSYDQGPTPRRRRPQPVVAGLPG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSD1	Ribosomal protein L15	2	61-80, 177-202	IYRVRVRRGGRKRPAPKGAT, GHRYNNTKAGRRHTWKRQNTLSLWRY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTF7	Uncharacterized protein	1	55-78	AELTLPTKKQQRPGTPKNWDKSNW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXN5	Uncharacterized protein	1	406-435	NLVAVGNKKHRKKKRKRESEPTGRGKRKQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY98	Uncharacterized protein	3	70-90, 110-141, 151-176	GDDRRNRSSKDRYTNEREEND, SANGSVRSKRRSRSPRPDSRRGHRERRDDYYR, DDDFHYRPKGDRRRDERPRSRDRGSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZR2	Uncharacterized protein	2	78-99, 326-352	HSTAARRRPLRQQAAQRWRRAR, YNAYCRLITREHRHHRQCPRSNTSFNS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1W8	Origin recognition complex subunit 1	2	105-127, 678-697	FSSEKEIKNKTKKRTDCLPNELY, LTPSKRGRQATKKEVDKAAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3I1	Ribosome biogenesis protein NSA2 homolog	1	40-67	QNLRGLRAKLHQQKRHKEKIQMKKAIKQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q478	Ribosomal_L2_C domain-containing protein	2	68-87, 341-370	LKTYKPRTPGVRHLRRPIND, IWGTPSKGGYKTRKKRNPNKYVVQERVRNQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	20	147-169, 209-235, 268-291, 308-353, 434-455, 482-507, 565-588, 607-631, 741-763, 886-906, 1069-1100, 1135-1156, 1323-1343, 1428-1452, 1581-1600, 1616-1640, 1726-1748, 1760-1829, 1833-1858, 1876-1917	IRAHANKKAKKAAKQAQMSKWAD, GDDWNSGKKGKKDKKTKKSIWDDLEEE, SFASVGKKGKKGKKGKIEPEPEPE, ADDWGFTTSKKKKKKGKDSEPEPEPEIGNKKDKKKKEGKNEPVVAE, FTSTSKKAKDKDKKKSAFDFSF, EDSYWSSSKKDKKKKKGTMLEPEPIT, LWSSFSTKDKKKAKKKGLLAEPEP, DPWSSFSTKDKKKAKKKGLLAEPEP, DAFGKTTSKKDKKKKGAFDWSEE, SWSTGTKKKASKKDKNKGITE, GSSSKSKSSKKENPKEQKEREKKEKKEREAAE, APPPKKSSKDSKKKGTDKLSKV, APEKKAKKSSSSKKDNNKGLS, EEESKEKSRSSKKERPKVVRDTGTS, VSRSKSTREKSSRKVPDPYA, AKDMAEPKQRKKSSRSKREPSYMSG, EDDNAKRLRREDRKVNRSRMPSD, DEAEAREARRRERRERRDREAADEEARAARRREKENSRRERAREEEDQREAERRRARRAEKEARRAEDDR, EEEQAREERRERRREKERQRAEDEAA, EDDAARRMRREERRVRRSVDPSADMERPRPSRRRSDYPAADG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIJ8	PAC domain-containing protein	1	586-605	LEKALKHRKNVTARVRWLNQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLK7	Diadenosine tetraphosphate synthetase	1	132-155	SDEPEDPKKKKKASKVKNVAVKLD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIH5	Uncharacterized protein	1	204-223	EVVRRIFKLRERAKRGMRMV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBF8	Uncharacterized protein (Fragment)	1	123-150	KEDCHEPTTKKRRKKHESREDHKFKSKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBP1	RanBD1 domain-containing protein	1	80-101	QEAISQPPRHHARKRSRDSTAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDK9	Uncharacterized protein	1	173-193	ESSISKERKQWRKQEADMKDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG97	Uncharacterized protein	1	182-203	ISHPPRTSKYPLKKKKPPLLTS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI20	Uncharacterized protein	2	57-78, 473-497	ERATKTFKSDKHYKNDPRYLKI, KLNMDSPQKPKSKRKKSNGPAEPTM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI98	Pre-mRNA-splicing factor	1	748-773	TQPAPAPAKKSKKRKHDQPNGPEPGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIH4	RNA polymerase II transcription factor B subunit 2	1	474-495	YFKNEAAKKKERRDAAERQKMG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJT3	Uncharacterized protein	1	27-52	TSDWQILQSRKKRAPCKREVIRMGTE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKM3	Uncharacterized protein	1	571-600	SKTLGKRKFGTPSKKRHKVNPKESKKDEEV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLZ0	Uncharacterized protein	1	153-175	QNEDARQKTERRQIQQRIRSFCW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQE4	Uncharacterized protein	1	2-24	DNNHRTTKDTNARKYDRKRGMHA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRC1	Uncharacterized protein	3	134-159, 489-508, 610-632	SICHPPPESKARQKLHRRPRSLLQLH, RAASNRRKNNQQATRRPDLD, LLSPGRSKSKKSISSRLKRLLCG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS06	Uncharacterized protein	1	109-129	KTYTRAEHLRRHQQNHKPGAY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT97	Uncharacterized protein	1	4-31	TQDAKPSKSSFLKKSKWGKIFKEQDTNN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVS7	Uncharacterized protein	4	9-32, 58-88, 202-224, 342-368	DESSGGSPKKRAPKKKDILLQGSL, NKALNEAKTRRFKRNDRKRKRKNHLEEGLLD, SGGDDEKKPKRKPRKPSPSTVDH, AEPVDRRTGGRRRRSKDEQQEKSPAKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q049	Copper-fist domain-containing protein	1	38-64	GRPVTQCQHCRLERKKRSAHVKCDCGE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q063	Uncharacterized protein	1	177-196	APPRHKMDRRAEHMKKYGKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q170	Uncharacterized protein	2	74-98, 481-513	VQNAVRTWRRRTGKKRPLNKSTCSV, APIQAKPRSIKRKPVPSHFRKIRKSRLQADLPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Q0	Uncharacterized protein	2	24-44, 53-79	TLKNPPKQRTVQQQQKQDKLI, IDTARSRSSSRRDRRKRIKQAIDDGTY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3T2	Uncharacterized protein	1	105-124	VDATRLKQGGPRSKKPRRLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJG0	Uncharacterized protein	2	26-46, 113-133	EVKKDELRKGKPKKAAAPKTP, LTELKPKKTKKVKNSLNLQAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI51	EHN domain-containing protein	1	20-41	QEEVNRLKRKLKDSRLPPKEIV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCN7	Uncharacterized protein	2	14-43, 351-376	ETVRVERRRCRCSPDKLRQGRKPPAHDTCH, DVVPQGKLTAKRRKLKDGKSIDLSRH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH25	Ribosome biogenesis protein NOP53 (Fragment)	3	1-26, 268-316, 399-426	APATHSQPSRKGKRAWRKNVDVSEVQ, EKQSYTQKQKSRKTPAERNKVKARKEREAREKWERKQKEKDAQEKRINE, NGKLEVRKKVGQVKKKQTFRTEKWTYKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHE0	Uncharacterized protein	1	33-84	PSANDGRHDRKRSRSPYQDRRQDEVKRHRSRSPHRKHHHHHHRHLHRSSRDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHQ5	Uncharacterized protein	1	10-29	TKSLRKLRSLRSIKQKHESA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIH7	Adaptin_N domain-containing protein	1	241-269	LMTTYSRKCFPRRTQRVKRATNQEQRAKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNB0	Calcium uniporter protein	2	37-56, 459-488	FSVHPSQRLPKERKHFDTKS, GDEKVREALRKERKKNDAKKEKEDEKEKGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSL2	Uncharacterized protein	1	2-27	VKPLTFKGDNPAKKRKRTHDDDAATD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTX5	Uncharacterized protein	3	1-22, 114-135, 143-170	MSHPRSRHHHTHLTRHARQDTR, KSALHRYRPISRHPPRDKVPLT, KPITWPPRGVTPPPKRPKNENKPTSSII
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU32	Uncharacterized protein	4	27-53, 195-221, 286-305, 336-386	RHDDRNDRGRPERQRQQQQQPQDQPYF, FEERSRQRDRSRDRERRRKRDEDSIRE, EKQVEKRQNRKLYGNRRDSG, GSRDEVRERDRRARRRSQSFVSSVKDRVRSLSRRKAPSRPQASRRRSSYDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVE1	Uncharacterized protein	1	83-105	AGGGIHHHRKHRKEETKDAPYYW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWB8	UBC core domain-containing protein	1	152-181	IEAGKMWRENKKEFKRRVRRCVRDSQENAY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYU7	DAO domain-containing protein	1	437-456	AYTRLFKWRDVPKGKRNGLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q026	DUF1308 domain-containing protein	1	482-501	RSLVGKEKRGAPKQVREADV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0V6	Uncharacterized protein	1	1160-1187	DQSEKDINRQNKKTEERKQRGLMQWKPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q196	Uncharacterized protein	1	48-69	AKMEKARPSKKSRRTVSHEADS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q398	Uncharacterized protein	1	35-77	RDSRSPSPEKADNKRKSRSSYFAKEREKDNRQLRPKTQQRFSW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q460	Uncharacterized protein	5	246-268, 711-737, 1033-1059, 1222-1248, 1298-1323	QPEHRPLSHKKPRGGHNTKRSSF, SGTTTPKKKAKANRKKKPKKSELLAEA, LSVFSSKAKKDKRKVSKSTKAKGSIKG, DITNGQLKSKKKKIKSRGKKEAQADVT, SKEEYIVKPKPLRKTHKRVASSRLSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4I2	Zds_C domain-containing protein	1	747-766	DERKKDGKKLAEPKKEKEKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4I4	Uncharacterized protein	1	295-316	DSSQPRRTTRGAKPTKRANYMT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Z5	Uncharacterized protein	1	77-102	KGRAATPSQSKPKSRRRSIFGGRHDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5H8	Uncharacterized protein	1	256-280	VEYYRDLTKHARRKKARGGPPPSLY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIS1	PCI domain-containing protein	1	367-386	KENKKDPKAHQRWLDFRKRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKU2	Protein kinase domain-containing protein	1	346-374	ALLLDKEQRKERRRERKRKEREAEAKSIR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XG31	Uncharacterized protein	2	12-36, 41-61	SAEPSQSPSKRVRRAPPPKPYDSQL, QSQSVQSKARRRMSPSKRVLS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y155	Uncharacterized protein	2	650-673, 706-726	RLYWSPQVKKTKKAHLFKRHDTAA, VRELNRTRKGYKKQPPVSMEH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDZ4	Sister chromatid cohesion protein	2	1708-1733, 1822-1847	AQKYLGKQKTTKKADKDDNKKEQKLA, DGGANGPPKKRARPRKSSMAKRDSDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE47	PH domain-containing protein	1	92-111	NNTLRKKSSVRRTTSLKRSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHA9	Mechanosensitive ion channel protein	1	837-860	RGLLHRQSTRGKRKPSTEQSRPAF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMR0	Uncharacterized protein	2	70-94, 111-151	ATNGSSMPRREKPKESKKKYALISM, RTRDSERRSTHRSDRERRRSRSGERHSKKIRRRDGDFDDRW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN74	Uncharacterized protein	1	46-96	DDSAHHRSRHRSRKENDSETSTKFRFKHGEEMPRKRKHRSGDGDGRRHRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP54	Uncharacterized protein	1	32-51	TSTARRDMNRHVQRNSRQVA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ62	Glycosyltransferase family 90 protein	1	94-116	HDAARAYRTRRGRQPPPHFDLWF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRJ4	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit	1	170-197	LDEGKFKGRTKEKKPKENPWQKASRGKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRJ6	Nuclear cap-binding protein subunit 2	1	14-40	DKPSSYTIGKNKKQKRGRGNPNDDSTE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRZ6	Uncharacterized protein	1	562-587	PKSPSGKILRRLMRDKEREKMKKGSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSX6	Uncharacterized protein (Fragment)	1	694-720	ETSEERAKRIRKEQRRKLRVEFKKGED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT46	Uncharacterized protein	2	399-418, 598-624	AVQGPAKKERKPRNDREYGV, FVGIRKDRENRLRKARAFNKGRGKGRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTX4	Uncharacterized protein	1	38-63	KGDGSQVNKIRKRRRRKTDLVWVQST
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVV5	Methyltranfer_dom domain-containing protein	1	1-29	MTAHRRFWMPWRSQKRSRTSQRIDDNDGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXB9	Uncharacterized protein	1	28-64	QWKHSNPERREKSKKHSRKQRERDNKRKDHNKGYSVT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY53	Histone deacetylase	1	707-732	SYWATEYARKPKKRFGRVSRSEESSI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Z5	Atypical serine/threonine protein kinase BUD32	1	40-68	PDTPAALKVRPKKHWRHPTLDKRLTRQRI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4D2	Uncharacterized protein	1	531-550	ERESRLRKIKDLFNIKRRTT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XMA0	Uncharacterized protein	1	80-107	QIAKSRGKGAPKKKKTAEQSSKNRKKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4C2	Uncharacterized protein	1	115-135	VSGIIKDKYKQQRHNDDENQP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFA0	Uncharacterized protein	1	43-65	ELVRSKKTSSSKKPSVKERHPME
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHE1	Zn(2)-C6 fungal-type domain-containing protein	1	9-34	VVEGSCWTCKKRRLKCDLTRPICGKC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL33	Uncharacterized protein	1	121-148	EEVGGASEKKKKKKKKKGREVEAEKVTV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN98	LysM domain-containing protein	1	422-447	NPAVSPRRPTPPRRTRGRRASNAMNG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPJ6	Zn(2)-C6 fungal-type domain-containing protein	1	48-70	NGQPPCTRCKKRGLSCTVNKSLQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPJ8	Uncharacterized protein	1	465-485	RGPPCCRHKSAKLKARLQSSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRG0	RNase_PH domain-containing protein	1	82-101	FSGMDRKRRGKNDKRVQEMQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRY1	Transcription factor domain-containing protein	1	32-65	TTNFRNVSACNRCRNRKNRCDQKLPKCTNCEKAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTC4	Uncharacterized protein	1	258-279	LPEPKRQLPKQKQELNIQPPKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTR6	Uncharacterized protein	1	63-91	QPHKITADASKPKKRKSKKAAASEKINLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV62	Abhydrolase_3 domain-containing protein	1	8-30	SAFKAACSRSARRRLHRLALARP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWS7	Uncharacterized protein	2	37-63, 83-106	APKGQKAPESGRKRKRTGTRDDRQDDT, LDDGESRKTKKKRKTGDTSQDEPD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZH2	Uncharacterized protein	1	109-128	SQAPRRCRTRVQKKRFGFNR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2C7	Uncharacterized protein	1	59-84	SRNQKHEGASDRRRERRKSRWLGDGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2F8	Uncharacterized protein	1	373-393	IEAQLSKQEKQRKMQEKKVKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q365	Uncharacterized protein	1	303-330	YETSINKMSRRQRKLMRRAERRAAKLAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3T7	LisH domain-containing protein	1	102-124	DALQARVRKAQRKYRWTNIDARE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5H1	Uncharacterized protein	1	6-26	SIVLPARPKKQLRRLSSQDAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XM03	Uncharacterized protein	1	89-142	EDWNARKSPRAQKARSATPQTKKRGRPPKQVAESSSVPSKKPVRPKRVIDSPPD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD44	Jacalin-type lectin domain-containing protein	1	6-25	KDISLRRRSKASSKNTKGDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFI3	Uncharacterized protein	2	67-89, 172-192	LGKREHKVFIKKSKQKRQCCSAP, KGSLRRATRRLIRLSRPQQRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFZ5	DUF2235 domain-containing protein	2	7-28, 484-512	AEPSRARSRSRGPSRSQSRALS, AYVKQPSGVRQRKSQRKSRGNSRHSTGLS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGH2	tRNA-splicing endonuclease subunit Sen34	1	147-168	MFAPRVRKPKKAEKKREENDVA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHX8	TFIIIC_sub6 domain-containing protein	1	297-320	VVATGQHPRKRRRKLTHAEKGVER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ14	Uncharacterized protein	1	1-20	MKRFPFKKARCRARNDSSSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ57	Uncharacterized protein	2	31-73, 171-195	VENTRPSSSTHRRAQNQSDNENTPRNGKGRKPKSKPAPPDLTT, PGTWKEVKRTGSKRHRHHQRFLFLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJE6	J domain-containing protein	3	40-65, 250-283, 289-319	PVGPQFLAHARRRRHKRTFSEDEKIE, DNESRDQKRHMERKNNNNRKKRKNEDVQRLRQLV, QDERIKKFRQEGNKEKNKKRHEKEAAEKAAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMI2	rRNA adenine N(6)-methyltransferase	1	316-336	EADKKARKMMDNPNRKRKGKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNU0	Uncharacterized protein	1	331-356	EEWVKVRQSQQQRRTKAPKIEGSKYE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPL5	Zn(2)-C6 fungal-type domain-containing protein	1	52-74	TDVACWPCRKRKGKCTGERPICQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQS0	Uncharacterized protein	1	497-523	PVFSPLTTRHERKQREKERKAMRGAAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVU3	DNA-directed RNA polymerase subunit	1	125-144	ALKLRDPKRRFEQITRLCKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYA5	Uncharacterized protein	1	10-31	VEDKTRQHRKIDRQHSKSVRQH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYN1	Uncharacterized protein	1	91-113	LDASRPSSPIKKRKKFDEDTIPV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0E2	Homeobox domain-containing protein	3	30-56, 89-112, 381-401	LPPNVDDRPSARQKRRRTSPEDQGVLE, AIWFQNRRQSSRRKSRPLLPHEVA, QPGPAKRSKLDHKRTSLQRSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1U0	Zn(2)-C6 fungal-type domain-containing protein	2	29-56, 60-79	GRVRAACLTCRRKKIKCSGEPHCRTCRD, ECEGFPERKRPRKDGPNASN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q281	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	1	3-44	AWSELKTKAGKERKRLPLACIACRRKKIRCSGEKPACKHCLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2C6	Uncharacterized protein	1	722-741	AESTVRRHPRQRHYLHRVGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4T9	Uncharacterized protein	4	63-82, 85-106, 404-423, 515-542	DVRNDPRHARDRPKSKHALP, EPWILVRTKYRRRFVHNTHTKE, TPKLYWPEFKRKYKKESEMT, EEQRAEEEKKREEKRRREKAMADRERQV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Z2	Methyltransf_11 domain-containing protein	1	13-41	HSLEIGRKSRGKKRSRRVRTILRSFQTLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKQ7	Uncharacterized protein	1	29-50	PITGRDSKPAPKKLQKRFPGED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKR4	T5orf172 domain-containing protein	2	132-153, 172-199	IHEGRTRPTRTPKPPRKTATTD, EEHGCRPPKRDSYKRKKNKEQGFWNSLC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y297	Uncharacterized protein	1	17-36	FTTARRTKPGSRKSSLKDDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4E8	Uncharacterized protein	1	72-91	AKTHPKKKTPAKKAAGEKRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJN8	MFS domain-containing protein	1	469-490	MLEAENKKRRAGKRNHWLEGKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNR5	Histone acetyltransferase	1	363-390	AATQQDGSPKKRRRKPLTGRIIPRQPRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBZ5	Uncharacterized protein	1	86-105	IQQRARSHGRGNRRERRLSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC69	Transcriptional regulator-like protein	1	77-122	IACSNCAKTKTKCDKKFPCSRCAGRNLRCTLRPTRRASKNANRMGI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEA4	Small nuclear ribonucleoprotein Sm D1	1	82-101	DDTPKPKNKARKEQDKSAGV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFB5	F-box domain-containing protein	3	919-942, 961-982, 1073-1100	AADQYKSQKRRMRRSERGSNNGGE, FELNREKEERKKDQQRFAGRFG, SSAYDIPIRHARPKKRKDSSARPSPQVS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHM3	Uncharacterized protein	1	45-66	IPPLRVSKSKVKKPIHVPDHTF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ20	JmjC domain-containing histone demethylation protein 1	5	351-372, 427-449, 1132-1156, 1238-1264, 1623-1653	GEKRNGTKRAANRKKTPDASKT, VHPASPVKKPRSKPKINPETICA, RVACDACRKRRIKCKHKDLVQQATP, ANKRGRSKACFECRKSKRRCIHDESGN, GTSSSPKSVTSNKRKRNSTSHTPGPKRVKAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMU8	PKS_ER domain-containing protein	1	1-23	MPDRPSRRFRPNKSPRLRSSTPT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPX2	Uncharacterized protein	1	73-100	TDYTQRCVQCNKKRKTARQTNGCSRCHG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRY6	PseudoU_synth_1 domain-containing protein	3	39-89, 96-115, 344-367	RGEQRHDKPYQSRHNQQSDRKRKGNWNDSSMQHGSRRGGRNDNKRHKKGDM, ATNPDKRRRNEEATEKRLRE, EQPEQERKREKKTKQKPEDEKTEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT74	Uncharacterized protein	1	1319-1345	GLDKQPKPPKARLPKKSEKGAPKQTQL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWP8	Protein transport protein sec16	1	1893-1914	AQRKAGGTVKGKKKTQRYVDVM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ51	NET domain-containing protein	1	144-166	GAAASKPEKKRPKANRNVDMEKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZF8	N-acetyltransferase domain-containing protein	1	163-191	SDAYDMRKPLKRDKNRKTVRPNGENIKVD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZK7	Zn(2)-C6 fungal-type domain-containing protein	3	53-89, 731-753, 829-850	GGDTRDPKRRRIARACDMCRKKKIKCDGKMPKCSHCE, KAEREMRGRGKRKQAEREREKAL, RSSSTSRPPHNQHLRHQQPNNQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZT7	Uncharacterized protein (Fragment)	1	1-23	YYDCTWRRPTGKKHKTWEGDGFA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0S2	Translocation protein SEC62	1	324-359	AWHEDEKAMKKRKKEERERKKERRALKANEEKKGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q113	F-box domain-containing protein	1	115-138	KSGGRTNWKKQYKLRHNWSRGSCA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q406	UmuC domain-containing protein	1	534-559	SPPPPTKPTTAQQRPKKRVRFDETLT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q501	SAGA-associated factor 11	1	263-291	GGVRKKLLKKGLKDKAKKEKPNGKLPKSL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJD5	Uncharacterized protein	1	18-37	TEPDSKLPARRREKFEKMAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5A9	Seryl-tRNA synthetase	1	12-31	GGNPEKIKESQRRRHAPVEV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YHZ9	Uncharacterized protein	1	230-266	QKENATRHKAPKHGRSEKKYQESREKLRRKHAEQVLN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCV8	Uncharacterized protein	1	88-111	NDTSKLSRSKRKKLAKTVERKPQT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEJ8	Uncharacterized protein	2	2-45, 1177-1208	LRLFRSISRGRRKQDNDDTPSAFTQSPERSRHRRVARNIEPYHD, GGNDKSKAQRSPRKAVRPNSKKGKENDRPSSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFY6	Uncharacterized protein	1	256-280	AFQAERISKKQHKKMNKNRTKGYED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGA5	Uncharacterized protein	1	672-700	KANTSSKLTKDPEKKEKKKHHFGFGKSHK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHT8	18S rRNA factor 2	3	29-52, 103-125, 250-271	EGRGALGDRRHKRRKVGSAFDNSE, RSDHDRKKPTKAKKDPALKKVEA, ERAARIREDIRRQRKENKAFVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLM0	Uncharacterized protein	1	1-21	MPAGNKKKKTKPAANPARGFA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLQ4	SPX domain-containing protein	2	136-156, 571-601	ATQRTAFRKLLKKYKKWTGST, ELGTPPIKSFRKKRKRRSHPRDENQQTQRYW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMP1	Zn(2)-C6 fungal-type domain-containing protein	1	15-41	TAACAVCRAKRQKCSGVKPRCDQCRMH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNI1	Clr2_transil domain-containing protein	1	122-144	SPTNPCPCHRCGKKRTKVETGVV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVA1	Zn(2)-C6 fungal-type domain-containing protein	3	40-60, 62-98, 105-124	QRTYQACIPCRQRKVRCDLGS, DNPHDPPCTRCRREAKECYFSATRRKKKNGSGENTGS, AYEARHQRKRLRTSAPPESE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXZ7	Uncharacterized protein	1	51-71	DEHGRIYHRKRSKSSREHISP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZP6	Uncharacterized protein	1	631-666	GARGRFRRMAGEKKKVQKEERRRRVRQSRERVEVGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0C6	Pre-rRNA-processing protein IPI1	1	1-36	MGSSAKKKKEKKQDFQKPKLKVGKTRPKNTNATNTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3K9	Uncharacterized protein (Fragment)	1	32-52	TQTLKRINRIKRPLNSIPQHH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3L1	Uncharacterized protein	1	169-188	LWHAFRYRDQRNNRDRRPFD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3U9	CN hydrolase domain-containing protein	1	254-273	IDRERLRKVREQQPLLRRTD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIW3	Zn(2)-C6 fungal-type domain-containing protein	1	35-77	TSTPARGAKKPRAPHTKSRQGCLRCKRRRVKCNEEQPKCRACQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJ90	Uncharacterized protein	1	170-194	VTCAMRRTLVSRKARKKRIAENADM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIZ7	Uncharacterized protein	1	252-277	FVVVWHWWIGRRKRQREKNTAVRGHF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBY3	Uncharacterized protein	1	190-212	IQPESRRPAKKSKKAPTRMTARE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC84	Uncharacterized protein	4	8-36, 396-424, 427-452, 462-492	KSSSTKQKDASAKKARPTKPTKSTSKSSG, PETAIAEKSKKRDKKKKRKSEDLIDGDVE, NGELTPLSSKKKKKKQEEELERVISK, DETPGERARRKEQKRLRKEAKKRAKEGESGV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD11	Uncharacterized protein	1	213-244	TEEPQPKKKNTIKQWLEKRKDKKDADRRASAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDK1	Uncharacterized protein	1	99-119	AAASIRRAERQKRYMERRTAQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEU3	Brr6_like_C_C domain-containing protein	1	145-173	AKEMRVKKPRDLARQRSKRRRHSVSESEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHD4	Uncharacterized protein	1	52-72	EEFLHRRRRKVWKPVTSHRVG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIL9	Zn(2)-C6 fungal-type domain-containing protein	2	1-34, 42-67	MSQNSRAHSRTRRACAQCKNRKIRCQPSTESPST, GQECTFPEAKKRKRPVQLRTRLDQLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIT9	Uncharacterized protein	1	84-106	ASAHSAKKKQKASKWTQDTTRRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ84	HET domain-containing protein (Fragment)	1	64-83	RNLFKGLRRIRGRRDPARFW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMP8	Uncharacterized protein	1	1-24	MPKVPAKPRTKTTRDKPITNPTAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN46	Uncharacterized protein	1	15-35	IAQRRHYGRVRSKMQRQSGKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPI0	Non-specific serine/threonine protein kinase	2	24-44, 526-553	SPEQPPPKPARTKKTTAASKQ, QVYWPSQWKAPSRNKQKQEYVLHKRAKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPK4	Uncharacterized protein	1	165-186	TKASLENRYRRKKPSNPEKDLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ72	Uncharacterized protein	1	48-67	TDSLRPHSRYRKLLRERLGT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRV0	Uncharacterized protein	1	437-473	ASKQDKSLKQYKAKWEDIKKSAKEKERAKREKSEAEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSZ0	CAP10 domain-containing protein	1	411-437	VQEYDKVKKKEVKKRKPRGAPFESYAI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYN4	Pyruvate carboxyltransferase domain-containing protein	1	3-28	MLADPSKKYRKFKPLDIPDRKWPSKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q316	UDENN domain-containing protein	1	30-57	EEDQDLDAKRKRRRRRRKAIEAGEELPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3I2	Uncharacterized protein	1	177-210	DRPSRTASEERRRRERRKEREERHRREKEKIRAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q587	Uncharacterized protein (Fragment)	1	67-91	ATAVPVKRKPGRPRKTQSQPEQLSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIC3	Acyl_transf_3 domain-containing protein	1	33-61	LKLWQSKAGTNSKKQRPSKQPLRRTAYLD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEK5	Uncharacterized protein	2	89-111, 118-150	SEERIERRRRVPDRISIKRRLTQ, RVYSQRPRRNGNTLSRKGRKRSARDSPVPSRST
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHD0	Uncharacterized protein	1	604-626	VDPTPKKGGKGSKKTKKTQTGEI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHW8	Uncharacterized protein	1	12-43	RKHQCEHCPKSFKRREHWQRHSRSHTNEKPFE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ04	Non-specific serine/threonine protein kinase	1	316-344	QCVLHPGTIRRRKPAKRRRISREELCEPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKL4	Uncharacterized protein	1	22-47	DLALALRQRSDRRRRRNGVFNPKMAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM16	Uncharacterized protein	1	148-167	HDQQRQRSARYKRSTRQGAW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMD7	Uncharacterized protein	1	104-125	HVETTPKKKGRKSKKEIAAEVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMH5	60S ribosomal protein L27	1	52-74	QITRRMSKTRQNKRSKVKPFIKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN54	U2 snRNP auxiliary factor large subunit	1	5-28	ERQTARKSASPPPRKPKEPTPDLT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN66	RING-type domain-containing protein (Fragment)	1	58-81	LDARKEGKRWIRGRVRVRKGSEGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRM4	Uncharacterized protein	1	33-55	SVTSGRSATRRHRHARSHHGGTS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRN2	Spindle pole body component	1	859-884	MNFNDVYQPVRKRRQKPTGVDKTQMS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRN9	Uncharacterized protein	3	13-39, 102-128, 183-203	SDDSSFESPKSRRRRRARSEESPYTER, REKRRQFEKAKAKRRREEDRREKEREE, SEDEARTRRGRPDRSRSKSAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTH0	Uncharacterized protein	1	96-119	EESTPSPSKRPKRSTGKIASCKTP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUJ9	Uncharacterized protein	1	1-38	MTKTRKRKSRESNPEDNSGSGDDGKKRGRPRVEKPDAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVR5	Uncharacterized protein (Fragment)	1	104-131	AEKERAKMKREQDEKRRREKRETLPNVG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW96	TRUD domain-containing protein (Fragment)	1	53-72	GDRKRKRESDGQDGNKKQRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYE7	Autophagy-related protein 27	1	63-84	DICDTLKKTKDKPKEQCPTGTR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q053	CBF domain-containing protein	2	675-701, 804-834	FNAAGNVKKRKPSKKEKKARDDDEDSE, DEKEEDTTARNKKKRQEKKKLKSLPTFASAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q081	Uncharacterized protein	1	379-403	KRPDYVPERSSRKRHRHEQDDSEDV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q421	Homogentisate 1,2-dioxygenase	1	436-455	SWEPLKPRFRRPTAGKAVNG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4B1	Uncharacterized protein	1	1075-1111	TEGGKDDMKFRSRKKKKMTKKDKKEQEVRRRLRHIEW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIN2	Uncharacterized protein	1	16-61	LSDSPKPQKSKSTKRKREADDESKKAARKKKRTKKKPDDVDDSSLD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YP53	Uncharacterized protein	1	122-147	LDAQKAAPKKRGRKPKQEKNEEASED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBY8	Uncharacterized protein	1	127-151	TKEHETRRPERRKEDARAYNRRGRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCC9	Uncharacterized protein	1	384-413	VCEKRFQYKKDLGRHAPKHDPNRKKYYCSF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJL6	Uncharacterized protein	1	227-262	ASMLKDKITRSRKQGRPRRRLLKSMTMRRREDRRTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN21	HDAC_interact domain-containing protein	1	600-619	APTPASKDNKRKRNDRQGTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNG8	Zn(2)-C6 fungal-type domain-containing protein	1	1-21	MEHKRRRVTRACDRCRILKTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS36	Uncharacterized protein	2	597-616, 844-870	MTMSSAPSKRRRRRISEASS, DIRVKQDIVRRCRRSRRDRASNASRTM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTT4	Uncharacterized protein	1	147-166	KDEPRSARRHHNKKHAHSAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUQ9	Enhancer of mRNA-decapping protein 3	2	255-279, 323-344	QPELNGKKKIRRGQKSKKQATTPGE, PSEQVNPKKSRRRQKEEMDVLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW59	Uncharacterized protein	1	277-297	TPDPRRGRSTRPTRGKGTGRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXE0	RNB domain-containing protein	1	204-224	DANGRRRPNGRERRSFRVRSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1V8	40S ribosomal protein S8	2	11-37, 132-152	RSATGAKRAYYRKKRAFEKGRQPANTR, EEEVKKSKSVEKKQTERTKTS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2U2	Kinesin motor domain-containing protein	2	46-68, 1041-1061	DSVASSRTRTPKRRVPVEVEKES, AESPRKRSPTKLSPSKARSSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3B4	Uncharacterized protein	1	58-77	ARMKRGLPEKKPIRNVRKVV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q467	WD_REPEATS_REGION domain-containing protein	1	140-164	APLPVKGSKKDQRVKPRNNIIKSNS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4W0	DUF1713 domain-containing protein	4	28-54, 80-102, 251-271, 356-391	RTSSCIAARRPHQRRHSSSKTSCPPEN, PTSQQRTPKRISRTKRSPRAAAV, QSSASLKKKASKPRQRSYETT, MLLISVKRQRKLKMKKHKYKKLMKRTRNLRRRQDRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5A9	Uncharacterized protein	1	227-252	KENVGKRHRIHKSRDQKAKPARQRSH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WHR0	Uncharacterized protein	1	93-112	EYIPNDRKRRRDGMRDGDGH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XZM4	Uncharacterized protein	1	140-161	CAKPERCTSRARRKASRSSHGF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4K7	Uncharacterized protein	1	1-24	MAEKASSKKRKRPSNGVDTPSKKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEJ0	Uncharacterized protein	1	378-404	NVTVENGRRRGRRRVMKKKTVKDEEGY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF46	Histone H2B	1	33-53	AAATGDKKKRTKTRKETYSSY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM19	Uncharacterized protein	2	1-20, 129-155	MTEPRARPRPKDRTNFSDPD, AEEELKKKGRGRGRRKRKADGNAEGEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQC3	Uncharacterized protein	2	1-20, 42-68	MSPTKRTTRRRAPAVTAAKP, NAMFDPMKPRPKQRKEHDRRDVLKPAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQX7	Aa_trans domain-containing protein	2	175-200, 494-513	QPSERRPLLGRKKSSKRMRREGNAGT, ASGKKSSSVKWKKNGLRTGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS35	YDG domain-containing protein	2	34-58, 595-616	DAANAAKKERHLRKQQAQATQQRAE, IPVRFIRSSKAKNKSKYAPSLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV58	Uncharacterized protein	2	13-32, 141-165	DGTRGRCKPRQPWLSIRPCQ, AASNYREKQTRARHRRRSVVSWLCT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVW5	SWR1-complex protein 5	1	80-106	SGDEATIKERKRKRRRKDEGPDNEDSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVY3	Protection of telomeres protein 1	1	385-415	ELITKKERREAKKERIKRKKRGEQDLKAESE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXM0	EH domain-containing protein	1	461-494	SEDDPHPYAKHKKKRLVRKHPNKHHEGDRKRWRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYY2	Uncharacterized protein	1	32-56	FIVFGDDKKPKKNKQPAPNLPSASD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3U0	Uncharacterized protein	1	424-448	DAVKIIQRAKKVKRRASVMEFFKKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q405	Uncharacterized protein	1	1-28	MTAGKPKQFTRPPPKKKPPKASLLESVD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2X8	ULP_PROTEASE domain-containing protein	1	241-266	IIDARRKEGERRRSRSHSPNVSHSKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJ62	Ubiquitin carboxyl-terminal hydrolase	1	201-220	AFPARALRSRRRRQTLHSAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMR7	Uncharacterized protein	3	3322-3342, 3445-3464, 3556-3580	QEEKKETEQPKPKKPWEHTEA, VKLRRWRDKLAERLDRRPNT, RIFNSTLSKKKESRRRNLQFHLPVM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN51	SMI1_KNR4 domain-containing protein	1	363-388	RWRSDQKFGRRIPKKKPLRINSNVSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBK8	Uncharacterized protein	1	29-50	VFYLHQRHQRRQRLETIARQNN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEV5	Uncharacterized protein	1	267-287	VPTHRDLKKRAERVRQLRVGV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI36	Uncharacterized protein	1	20-43	RSSKSSTKSKTSSKTKLKRMSTDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIY4	MFS domain-containing protein	1	490-519	YVQGFRWRVKRAAKKSERKGQSKRETEGER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ51	Uncharacterized protein	1	11-39	VNVPKTRRTYCKGRDCKKHTQHKVTQYKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKX2	Uncharacterized protein	1	6-25	GYNQLKCRAGPRRRQFGRGC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMC7	Uncharacterized protein	1	375-394	AIIQPSKRPMRVKVKKTFGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN51	Protein kinase domain-containing protein	2	23-53, 85-106	DLPPKRRPSLLRKPKEWLRRHRGHSNGPLSP, IPSLPRPQTFRRQNSERRERLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPX0	Uncharacterized protein	1	569-593	SLSGSVRQCRRRSRSKKSKSMLSTY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPY6	Uncharacterized protein	1	94-116	GIEPGTTRISRHKRRVPKRVSYH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR86	Uncharacterized protein	1	1004-1070	AGPSSTSKGKQPKKDRKGKGKAKKKGKKQKSAVTLAELKKQGTRNKAQKKKYLRRLRKDWQSSAKIE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRF5	Zn(2)-C6 fungal-type domain-containing protein	1	59-80	VSCELCKQRKVKCDRGQPSCGW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRU4	Histone-lysine N-methyltransferase SET9	3	314-334, 527-551, 797-823	EEPPVKRGRGRPRKYPRPDEA, PQEDPPKKRGRGRPRKYPRPEDTDP, SKPDRASRLRGSPRRSESRRKLARMTM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU30	Palmitoyltransferase	2	396-433, 438-462	DAGLVQREKPHKKDRRPSSSHNGKRKRRLDVGWKDGER, VSEKEARRIRNEWRRRANQGQLGQH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXJ5	Uncharacterized protein	2	15-34, 166-185	MTDRARKKAMHTPRLHKQAQ, IGRLKDRKGQFKLENRRLRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY80	CENP-C_C domain-containing protein	4	14-33, 81-104, 280-305, 388-415	ALTSRKTPRLPPTRQSPLKH, VDSRSPFKPRKVLRRSMNARPDPF, EEAQPAKKRKGRPPKGKKNAAPKERD, AEHVEKPQDNHRRKRRGRKRTGGRLAAI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ55	Uncharacterized protein	6	76-101, 121-145, 156-176, 186-210, 255-278, 643-665	DTQPQRPRTTRQTAAKRKQPRTFESP, LLVVKKLTARKGRPKRDHPATPIND, GQARIVKKRGRPKQATSRSEE, GDAIRQPAKPSKKRGRPPKALAAAG, HIKPSIKKRGWPRKAQPEHNKPAA, QAPAAEKKPVSKRRENKDEEINA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ86	Mediator of RNA polymerase II transcription subunit 6	1	295-324	EKSNGDRKGSKSSKKDRRKSRPATSPTTPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0H0	AAA domain-containing protein	2	57-83, 1043-1064	TTESARKPGLGRPRRRRDNHASEPPEP, DEQFGDRKGRKKKTTYGFGTGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1J5	MFS domain-containing protein	1	518-540	FVQWRGRNWRKAKASPPPSPRVD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2F3	Non-specific serine/threonine protein kinase	1	74-93	ESPAHKRISQLSKDERNPKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5F4	Uncharacterized protein	1	168-199	GTAGGEPKRRRNRGKKSKRRNKREEREGVSGT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMF0	Uncharacterized protein	1	496-515	RQEHDKKDRKWKKLVNRVMV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKY3	Uncharacterized protein	3	1153-1172, 1185-1240, 1289-1309	ARKQARIARRSEKKESRLRD, SEEETPQPKKRGRKPPRDSGKRKQEEAALDSAPEPPKKRGRNPKPVEKLNKDDRAT, IKKPICMKNIEHKINKKQYQS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4Z0	Uncharacterized protein	1	26-61	TKTDGTVQEKKKKTKIIKRKRRPARPQQDPSTFKTE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCH5	Uncharacterized protein	1	202-225	AFFGERRKKSRTPRQQLQHRVNSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG42	Uncharacterized protein	1	1107-1134	RTLPASQPAKKSPRGRKRYAAKEKISGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ56	Acetolactate synthase	1	680-700	LVYDEAKEKERRQRTKERSGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK55	Uncharacterized protein	2	70-90, 107-141	TDGKSQDKDRKKNKDKIKLST, VCKAGMQSLKKRDRSKRKKDKKGKKKEPSAGEKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLB5	Uncharacterized protein	1	219-247	GGDYYSDREKKKRYRRSDREKERGGSKCV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLE7	PWI domain-containing protein	1	146-165	AGKLRRWTRARDADDRKCKF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM46	CULLIN_2 domain-containing protein	2	4-23, 741-761	LVGRGRAKIRPPRRGLNGGD, VENDRERKETEKKNNDSRGFV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMZ7	DUF2431 domain-containing protein	2	1-42, 250-277	MAKNKKRKLHNKSQASSRSHSQPLKAKPKDTQKKQQRSSLIV, GVPLRQQQLREQDKKKRQRDEDSSSDEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN81	Uncharacterized protein (Fragment)	3	25-53, 84-110, 331-361	ADYAQRLAKKQTKEKQKNKLMIKTQEGRL, GVADLQPKPKPKKPRLPPKEEIRLAKE, KPDENFKKPKFKKEFRTKREKKVMRERKQVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSK2	HMG box domain-containing protein	4	114-139, 275-297, 332-355, 363-388	GFNADGTKKKRQYKPRDPNAPKRPLT, LPPPPVVKKTPKPKKATAKAGAD, EATPGESEKKKKGKKSNAEKIAAE, QLVPESSEKPKKEKKEKKKRKSEAAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSZ4	Uncharacterized protein	4	64-90, 151-175, 656-677, 734-754	QEQSTGDGSRKRRRKHKVVIHTSPFLR, ARRALDGHSQKKHRRSKLRVDAFLG, SSRPGSSNAKDRPKRRNGDVDG, VRKFDPTPKRRWTVNQNDGYH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTL3	Uncharacterized protein	2	16-45, 169-197	LWKIPWRLSAPQKLRHRRRMRRVDNVVSVL, DKKVRGYRKGVHKLPKWTRLSQRLNPPGF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWK4	Uncharacterized protein	3	1-25, 53-80, 181-205	MPKFVPRERKHRKLARQKSAFSQQD, KAQQPESKISGKKRKRLDKYIDTKLKKE, VDESGRPVIKKRRRQKKAVVEMTPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXL0	Uncharacterized protein	1	33-55	AERLRIKPRSHSNQQVKPHHIKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY61	Uncharacterized protein	1	109-148	RIEFGLSKKWKQRKEKKMQRQQTQQTQQPQQQQQRRQTVA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYN8	Uncharacterized protein	1	856-886	ATDLSNKEPKKKEHRLKKLMFWKSKHRQASS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1X5	MICOS complex subunit MIC60	2	14-36, 121-144	EQGARHSIRRQWQPQPYRQPLIR, KTGPSSAPPPPPKKKKGLFRRFLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2G4	WD_REPEATS_REGION domain-containing protein	1	496-525	LKNRGRGKNSSLRKYLRKKGNKNVIDEHKM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2J4	Protein kinase domain-containing protein	1	473-500	SPLARRTAKLPPPKRATRKPLSRAKTAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3F9	Uncharacterized protein	1	53-72	AEPPYRPPPPPRKRLTDEEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKT0	TPR_REGION domain-containing protein	1	586-608	ALHQTRATGRRQRRHLQQGDDMD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0Y7	Uncharacterized protein	1	327-347	FQSKHRRKLLCDKMTRSRSRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI34	Uncharacterized protein (Fragment)	1	102-126	DGLSTKPRVARRTRRTSLKAWRISH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJD6	RNA-dependent RNA polymerase (Fragment)	1	956-982	KMWPHWSEPKGKSKRKVYTSKKVLGQL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YP58	Uncharacterized protein	1	264-291	QDLTVKVESKKQRNKNTKQTRIVKKTIP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCF4	Uncharacterized protein	3	1-29, 377-406, 637-660	MGKKKAQNGRAKQKQKAKAGNTPRTPKAN, SNESSKPSKSSKRRNKRGRKKDNRAMRAAI, MDFDRPSLRPRKKGRKGQLPEELE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD07	Uncharacterized protein	1	4-23	EPLLRRSTSHKRPRSYARIS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDS0	Uncharacterized protein	1	117-138	QSTSASSSSKKKRRSSTEKPKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF04	acidPPc domain-containing protein	2	32-53, 414-433	LSHYERRLPKWRYQVRHRLIPI, IANRAQQRRDRSRSPQKGLQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIG7	Tyrosine--tRNA ligase	1	358-382	AYPPLPPPEKKAKKAKNLGSRFPGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJA1	C6 transcription factor-like protein	2	28-52, 59-82	RISQACTPCRDRKTRCDGRQPTCVA, ASTCRFDHARRQRARPSHAPRPMP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK78	Uncharacterized protein	3	151-178, 207-229, 376-396	LWQFERYNPARRNKHARRRSSVQRRLDI, LEEIERETRRRRRRLSRMSAAGS, RDIPRQPPLRQRRRAEKARAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLE0	Uncharacterized protein	1	193-213	HSSIGVPEPRRKNRRSSGGYR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNS2	Uncharacterized protein (Fragment)	1	183-206	GHHSQRYRDRDVRQYKKERPARVG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUQ4	C3H1-type domain-containing protein	1	503-525	AVKETHKRGKSGCRIRRPASFSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUY9	Uncharacterized protein (Fragment)	1	116-138	DVIMKHLKRHKLRSKFKLRLLDN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVJ5	Uncharacterized protein	1	232-257	ATFYTGVLWKKRRKRGQAPAKRFFSL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVZ7	Uncharacterized protein	1	426-450	AKTVREAQKNSKKRKRSGVNGLDNI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX10	Uncharacterized protein	1	220-240	TTQNTGFKKKQQRPKAQAFGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYG9	Zn(2)-C6 fungal-type domain-containing protein	1	103-128	QAGTKRSRPCDACRRRKSKCVTEEGN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0D3	V-type proton ATPase subunit C	1	349-372	GGNAISKDKKGRPKQDDSSTQQEM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0K7	Mitogen-activated protein kinase	1	250-269	VQSLPKRERQPLKNKFKNAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q115	Uncharacterized protein	1	559-582	SNGPVRHSRNPMRRPPKQNRTSAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4D8	Uncharacterized protein	3	78-97, 218-239, 350-372	KENAAKHSNKKRKTAVQQGH, QEVETKKQRQNRKKTEEARLAR, GWNQVKVSKKSKKGTSHSNAKGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNT4	BRCT domain-containing protein	1	1374-1400	LSAPPSTSPKKRTPKKQHGNEHEHTGL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3U3	Uncharacterized protein	2	110-131, 245-264	RAVEIKYPPRKRQKIDAPSSDE, KYDFDKKKVEKRPNGPRRVH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4Z8	XPA_C domain-containing protein	1	286-319	DEEFEKRQKDAKDRKEKKFKNKLQELKKRTRVDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLP0	Vacuolar protein sorting-associated protein 54	2	31-51, 202-224	QDPASRQPSGRYRPRRDSSAS, ERPGQPRRKSSAQYRRNRNEPTP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNR9	Carbohydrate-binding module family 48 protein	2	277-298, 433-454	TFCNWEKKMKLHRDKGKKNFSA, QPTPAPPKQKLPRPQYNNQIPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFM4	ANK_REP_REGION domain-containing protein	1	25-49	LETFRTALKHRSRGRLRTIPRSEQQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGM9	Uncharacterized protein	1	482-501	EDEEATPKQRKKQARVDGRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI03	Uncharacterized protein	1	526-549	VEGVTPWPKTKKRRRTVASSELGF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL51	Uncharacterized protein	1	35-56	MTYKELSKEWKRQNNRDGQCDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL93	Ribosomal_L16 domain-containing protein	1	1-31	MARRPARCYRYCKNKPYPKSRFNRGVPDPKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLE9	Uncharacterized protein	1	251-271	LGLPRHFGKRRRFDRWLAATS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNA1	Uncharacterized protein	1	632-658	LWAQRLLTEKQRKRCMKWGLERSNFAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR81	MFS domain-containing protein	1	493-513	LLLRWRSPYWRAKKKAAAAKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWI3	Uncharacterized protein	1	180-200	DYDPKLPKSKQKYRVHCSEGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX22	Uncharacterized protein	1	284-307	IWRAEPKPPKKQKEEPTAKRKKLD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZT3	Uncharacterized protein	1	48-67	ALASRNTRRKVKDTRALDRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0E7	Uncharacterized protein	2	52-71, 614-641	EYQGRKRKEFEDYVRRNRLN, DQETVSKQMPRRVKKRRKLDDDSFEEYM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0F8	PX domain-containing protein	1	63-83	GVKPAPSKTRGPRRHGNLTQS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2E8	Uncharacterized protein	3	222-241, 363-387, 587-614	EEKGKEKERKEKLREDFRKM, ANEKLQQEKRLKRRRERQARDGFGQ, DRNGSRRDDRDRSRDRRHRTRTPEIDAY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2K3	40S ribosomal protein S7	1	108-128	PKRSNRSRTSQTQKRPRSRTL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIW6	RING-type domain-containing protein	4	59-82, 232-252, 548-573, 709-733	PAPRNNQTAKAKHKPGKRFRSLDE, AAPPPDKKARWKKCPICWDSI, LEEFKPMLDRRRKRNEEKETREEKDR, QASKPSGGGKKGKKNKKITLMSTAN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XI06	C3H1-type domain-containing protein	1	13-35	KDSLRATKQQRTRDDKPRAIRDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKZ5	Uncharacterized protein	1	9-31	RLPGLKRKASSPLRRPRQTFPFL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL89	Glycosyltransferase family 8 protein (Fragment)	1	34-53	LCTCDVSKRKRDRLKADGAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNR1	BHLH domain-containing protein	1	21-46	PETVRGCSGTRKKRARHFSSDERARH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBG1	Eukaryotic translation initiation factor 3 subunit G	1	48-77	SLNDDGKKVKRTQRVRRTVVKKRENPRVAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE61	Double-strand break repair protein	1	535-557	AHARGELKRRRRKGTIKPKPTYW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE63	J domain-containing protein	2	179-200, 208-227	AEIAERKRKREHEQNWEKTRDE, FQKKQGGEAKGKKKKMKTLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEL3	Uncharacterized protein	1	201-220	HTFPRDQRPHRQRDLPPPRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEN0	Uncharacterized protein	1	260-285	IIVLSVMRRRTKKRRASTMPPQRDGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFW8	Uncharacterized protein	1	187-211	RDFAQSRPSEKPRRKQSALRKQPTM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ18	Uncharacterized protein	1	1377-1396	APAPKNSKPIKETKDKQSTG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL00	Uncharacterized protein	3	529-555, 574-604, 612-633	FKDFRVRKVDPLRYKNKLDRARRLPDT, ACETCSRAFRVTKRKKSGKAATTGRRQRKAA, VEKNGRARRSGRARRKPVQYGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQI8	Uncharacterized protein	1	34-61	DSADGTQRPPAPKRRRHNKPAIDEETFQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQS4	Tafazzin family protein	1	284-309	FEPYRQRWREMKERARRKRLGFFQHV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT71	Nucleolar protein 58	1	510-565	TTTSSKPETKEEKHKRKAEKAARKAEKAARKAEKEAKKAKKAEKEAKDSGKKRKAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTH1	MYND-type zinc finger protein samB	1	56-79	SYCSRDCKKADTKKHKKICAKAAQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTR4	Uncharacterized protein	1	98-124	PEANPVPDKRPRRHIKKSRSYDYESPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTU7	BRCT domain-containing protein	1	75-99	AEIVLSKVKQKKRCQFDLRGKGLPT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU20	Uncharacterized protein	1	163-186	HRSSHHRRHSHETKQERRERQGRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXZ3	Ribosomal_S17_N domain-containing protein	1	19-43	IFTNQKVKSRKTPKVGKGGRRWYKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0I9	Uncharacterized protein	3	29-56, 93-115, 127-149	SAQASQKSSKRTPKKLGQKNQQQQPTPD, QPQQSRQQSRRRQSRGRGRKGGQ, QSAQGGRRQRQRKNKQQAQTKDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q159	Uncharacterized protein	1	57-81	PSSQYLNSRTRKRHRDNRPDAQQIH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WM54	CP-type G domain-containing protein	1	670-700	EVDAMNSKKHNKANKRQQKKVRSATIKDYDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJ20	Uncharacterized protein	4	90-113, 212-237, 589-616, 712-742	LYTSKAFKTPPKPVRKPATTKGEP, ASAVRSRRKLLREKPERKERPPSKVK, SVRTDEGRSKRARRRSRSKYRAGASRSR, DLFKNKDWMPPPPKKRDPKEFMPKRKANGDP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJ12	Ubiquinone biosynthesis protein coq4, mitochondrial	1	254-275	LREIRKALRDERRREKEPKGSI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKA8	Uncharacterized protein	1	9-34	EEEYYRVPTRRRTVKRVVRNYSPSPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCM2	Uncharacterized protein	1	10-31	TLIIERCKKRIQNYRKRLSSCV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHF2	Uncharacterized protein	1	690-712	ISKTASPVFSKRRRSRGISITGM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJR0	Zn(2)-C6 fungal-type domain-containing protein	1	56-92	VSGRARVTKRNKPTLNCLECVERKSKCDRVRPSCFTC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKI0	Uncharacterized protein	1	196-219	CEGAQRKTSQGRNRRQRVPAHLLN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLQ9	Uncharacterized protein	1	132-151	HSHPSHPQHQRRPQHPHNTR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMH8	Elongator complex protein 1	1	1156-1187	LATDVTRKTSKNRRREERKRARGKKGTVYEEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPM2	Uncharacterized protein (Fragment)	1	32-51	NSLSKRSRVRHGKRPQLHRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPY3	Ubiquitinyl hydrolase 1	2	1069-1102, 1186-1208	TSGRAQSQPSWKRKKNKKRRKGGKKGTWKAQGRS, DPDLAARKQRRSERKKHGIDLED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRF9	HET domain-containing protein (Fragment)	1	41-65	ASTPDLGKERRRRRQRESDDCFERA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVA9	Uncharacterized protein	1	420-452	MDETPEHRANKKRERLRKEMQNKHPVKKKKRKF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYR7	Uncharacterized protein	1	175-197	DYDYGRPRKLRRAGNRESWRCHG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0K3	MMtag domain-containing protein	1	137-172	VGLGDKEKERRSRRERERSRDRRRRTQGRGGKPFTI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2A5	Tr-type G domain-containing protein	2	79-105, 525-547	KNATTTKETKKEAKKDKPKNKFDEAAQ, DVKGETLKKKPRIVKAGQRAVIK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q320	Uncharacterized protein	1	111-131	AYPSPKAQKRAQSPRHEHSKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJ18	Uncharacterized protein	1	219-243	KDTGKKSYFGRKGSKRSTRERGSFI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YK84	Uncharacterized protein	1	214-237	VEVQDARRKDRKRGKEFEKKGSKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDD1	Zn(2)-C6 fungal-type domain-containing protein	1	22-52	ACQECRTRKVKCDGIRPKCSRCQQRGISCDY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDR4	Uncharacterized protein (Fragment)	1	298-327	DAVGPQKHGSPTRRRKRQPKKEAVDIEDED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIK8	Uncharacterized protein	1	341-365	DLKWVRTHFHPDKFRRCPEEKRAVF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK06	tRNA (guanine(26)-N(2))-dimethyltransferase	1	92-129	GEDWMDRKRLRNERNKDRHNKKQNKKRKLAESKHDTTE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN43	RING-type domain-containing protein	2	156-180, 225-251	IHDPRLSKAKSRSKKKQIDPETNVE, RAIERITRKCPNCKKNIQKNGGCRAMQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPG0	Uncharacterized protein	1	353-373	EKREAEQKRRRWEERTQRVVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRF3	Uncharacterized protein	1	1271-1292	LIESKRTKLKKRRVIVEKSKSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW97	AAA domain-containing protein	8	50-76, 104-127, 211-236, 268-294, 382-405, 548-572, 702-727, 1107-1126	HDETQNKPKRTTSKRRQKNGDQCSTKG, TSEPNLNTARQKRRHTNEHEAAEF, KNSGEPKPEAPKRRGRKRTSVVTSYN, IITMMKPKTTPKKRITRQPKATHPFFA, TLRLRLPSRKRKQAEVRLRHNESI, AKAEAAERPKKKRKKKPHDLDDFLV, MMSFFKPKAQRKPKPAEPRKVVKEKT, MTDGRKAKRVRTTRAARSAL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXF2	Uncharacterized protein	2	76-99, 122-146	AAPPCSIYCKRAKPQQPQRHTYLA, QSDEREPRAPTRRERKLRHANVVTV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY16	Glycoside hydrolase family 3 protein	1	1-20	MNNTKRQRRWWVPSRFLCFL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYE4	Glycoside hydrolase family 63 protein	1	202-224	TEGTSKSRPRHQHPSDKGKPLDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZF3	Uncharacterized protein	5	90-109, 145-168, 190-210, 254-273, 703-725	ASTAPERKGKLKKLNHLGLT, DGPPQPSPLKKQRKAQRIQQRAET, IKGAPRRSSRKTKGSERDSSP, AQASAQKRPRGRPRKHTEAI, RAEEGKLRKKWKCLHDSRRFVEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0F0	Chloride channel protein	1	67-88	KDSYRLRSTRGKRGLRYRFFDL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1G7	Kri1_C domain-containing protein (Fragment)	4	33-58, 403-423, 464-490, 555-593	NEDFAKRFEHNKKREEKQRLEEKYGS, EAGDSQKRKPKKPRWDDDIDI, EEGTSSKKKTTKKDRGKEKADAKRAAR, IKKLHAFRDEDRKKKDKKKLSKKARLKQWRKETFGKVDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1T1	Uncharacterized protein	1	30-79	PEAARQTRAGGRKRRRSDASEQSEQSQQSAATPGKRRRRGKVATEADKEH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Z7	Uncharacterized protein	9	38-57, 225-249, 318-342, 412-431, 441-463, 570-594, 786-806, 888-908, 2168-2196	SPSPEPPRKRTEPDQHPILP, PTSTAVAKRKLRARKPNQLNPYQYD, ERDMTSGNRPPKRRKLGDRAHALEI, SSTVRTRSSTVKRLRRRVSV, ESDLEMKRFRRERKRIKGVLPAS, LAGPSRSRNTKKSRGHQPRITQGPK, LIKSTSKRRLRPSMRPWRLRD, VTIPYRPKKRQARRLNVEARE, VSNFCKTYDATRNHRCRQRHASKACDDIL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2A7	HMG box domain-containing protein	1	213-236	HQQQYPTYRYRPKRSGRRNSLSSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q312	Uncharacterized protein	3	23-54, 92-111, 590-620	MSTSATKRKLKRSEFGQKKYLLKQKKKATMAA, GDTHECSKKRRDTVKAAARL, CIKIRQSDPRKAKESRKRKKKSIQQPEDVIA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3S0	Nitrogen response factor-like protein	1	823-851	PPTNAPTRPVAPRRTRKPSRASNNLGQND
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3W9	1-alkyl-2-acetylglycerophosphocholine esterase	2	12-37, 550-575	SEKTSQVPNAKKPKARPPRGWRDTVL, ISPKLFRSFKRWRMEQKGHSPQRNDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4J2	Magnesium transporter	2	62-84, 89-111	RPPPSIRQSCTNRDRTRHRSFSV, GADPFWRRLRQPRNAAKPARPDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNI3	Uncharacterized protein	1	90-114	NSHTHRCSSRDRRPGQSRKLCLTPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YP91	Uncharacterized protein	1	48-71	EVEAKLKSKRAKRRSRVAVRMKAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD53	Uncharacterized protein	1	112-133	DESPSKKAKTTKVKPEPKADAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTF9	Uncharacterized protein	1	635-672	ESPINYPWTRTKRSYRKGRAKWSRRLHLGKKRKEEETT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU62	Uncharacterized protein	1	709-728	MPPPPARRPRAKSKKSTSAY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUJ7	Uncharacterized protein	2	332-355, 357-377	TQQGAQQTERKRPRKLQVRSDGGN, RPQPDVPIEKRNKPRKLETRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV38	MRC1 domain-containing protein	2	461-480, 1008-1030	GFTGRRKKCAHRPSVNPQAL, DDLAVRRRQMRQREEARKRKLLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVB3	Uncharacterized protein	1	655-675	PTPQHSRTPSPQKQGRRVVSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVZ5	Uncharacterized protein	1	1-22	MSTPRKTFNRLSKWTRRLNALK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYD2	VWFA domain-containing protein	1	1-20	MFSSLKHKFSRKNDNSIERG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1W5	WD_REPEATS_REGION domain-containing protein	1	103-122	SLAARRKKPKTNEQASDPRM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Y3	Zn(2)-C6 fungal-type domain-containing protein	1	220-241	TSTSPRSTSARQRRHHRPSARR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2A0	Uncharacterized protein	1	86-109	LRVQDDPRTRRRRTQRPDLSTHLH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2V0	BHLH domain-containing protein	1	194-219	APASAPPKKKGGRKRKAETQLQPQPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Q6	Uncharacterized protein	1	33-58	ARVQEKRRKETAKLQKKSRRPATTAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIC1	Uncharacterized protein	1	75-105	KRGKKGKATAKSKPKPKPKPRKITKSTTGRI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y1B2	Mating type locus 1-2	1	133-158	GYQYQPRKPSEKKKRMTKNKLAKLAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN59	Uncharacterized protein	4	131-151, 748-773, 899-920, 922-945	ESHEQKMKRRLEERHDRQFVK, GQPRSIHEHKHPKRTKSKSPEPSADP, KAKSPPPSSRHARNSSHQRENV, TETLAPKQHSGKKRKSTTGTSAAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCD5	Uncharacterized protein	2	9-30, 695-721	HVYPTFRRITRRYPFLRKASLT, GEDDKDEKWKSRKRTPGRARRAFNEFV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCH7	Uncharacterized protein	2	3-33, 61-83	ESKTKRSRAGCETCRARKVRCDERHPICYNC, AYPGTGLKRKRTYRSCAECRTSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDG9	Zn(2)-C6 fungal-type domain-containing protein	1	56-119	AMLPPSQQSSRSRRRQPQGAEHVKHRRTRSGCYTCRQRRVKCDEAHPVCERCRKGKRECTYPGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI65	Uncharacterized protein	1	31-51	ASAVKPKPKSKAKARIMTKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIQ9	acidPPc domain-containing protein	1	27-58	LPSLPIYVPHRIRRRFRSTRSKIRSRQAPTSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN11	Uncharacterized protein	1	223-242	GEKLREKYYKDRRANFPPDH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNT7	Uncharacterized protein	1	4-23	VSEKEAKKALRKQIKDKVSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQQ0	Pre-mRNA-splicing factor CWC24	2	5-25, 282-307	AAPIFKKRANKGSNVRKRPAS, GVAKKLKGLLEKKKQREEEQKEKEEN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS66	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	1	268-292	VEYKNKITLKKKKWPAPKSEKYLRW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZW3	Uncharacterized protein	1	224-244	WKDYGDHLKKRKRHEDEMVAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Q9	Uncharacterized protein	1	406-425	CTYAKCRVCREHTQVQKEKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIS5	Putative epoxide hydrolase	1	72-93	NFSWRTFEKKLKKYPQYTVPVK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI49	Uncharacterized protein	1	1-22	MKSDIQRRKRKQNFPHRTICAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIS0	Uncharacterized protein	1	27-101	PVDLTHSPPQKRRGKRKSVDTDDFIDQPPKKRRAKRQAPSDAEDVENRAKGEVKPKNKEKRLRRWRDKAPQSYGE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL79	Uncharacterized protein (Fragment)	1	9-29	QSDRRSCPKPKPSSRVLPRRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBU6	Uncharacterized protein	2	312-334, 338-358	LNHWDRYWWRHMHKRERRFYTVD, LDPKRRRMRFGPWSACRRIRY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCZ7	SET domain-containing protein	1	316-388	MMRKAGFHSHQQRKPKKGTGKKNHKRSEQRVLKEVQSEFHQQKHGKKENHHQKQEKKVNHHQKQEKGDKQDAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDE3	Uncharacterized protein	1	346-376	EYEDCKHRAQGFKRKDHWKRHMKGVHNWAFP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDI3	Zn(2)-C6 fungal-type domain-containing protein	1	45-64	CDSCRGKKIKCNGQRPCAKC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFV0	Zn(2)-C6 fungal-type domain-containing protein	2	40-69, 71-94	STTTTSAAQKPKQRSRKKHLTEDEDNSKRR, ISTACIACRKRKSKCDGNTPACAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGF2	Uncharacterized protein	1	76-97	NPSRVPRRGSRVQRRDRTPQSL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGH9	Uncharacterized protein	1	302-325	RAEIEKRREEIRRKSAKRKADEFL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGV5	Hva1_TUDOR domain-containing protein	1	152-176	ANGNAAPKKDVKKKEPKKAATASGE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ06	Uncharacterized protein	1	563-586	STNHSTRAQRKQGKMLRQLRNIDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJG7	Uncharacterized protein	1	230-251	DRDAKTGKPTKKKLKDIPKVAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMJ0	Uncharacterized protein	1	95-118	VCQKRICRTTAPRCTRQRQDYERL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN27	Uncharacterized protein	1	81-111	EVSGTKRKHTGPKKSAPDKRRKTSAKGRLTE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNW4	WD_REPEATS_REGION domain-containing protein	1	357-380	LDPRDAVRPKRSRGRKSKAGSITN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPB5	G-patch domain-containing protein	3	1-23, 81-110, 134-163	MFKPTNLGKKNAKPAPKPKPTFA, YYEKPRHGQSGKNKKKKKSKQVQEQAWSWD, NEAWKQRLYDARRRERRRKGQDTKRSYSDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPY0	MHYT domain-containing protein	1	684-708	AFAPLFARKLPKRHRKAKLSVVLAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRH4	WD_REPEATS_REGION domain-containing protein	1	437-460	MVWDRKENWKWRFQRPQGRAMKLW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWF7	Uncharacterized protein	1	544-566	AAAAPRRAARRPRNPFPANPRAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXD8	Exocyst complex component SEC5	1	1030-1049	GEFGCFRRERRGRREAGSRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXU3	Uncharacterized protein	2	1564-1592, 1675-1698	RAAAPQTRDTRDRRRRARLKDRHQVRVAS, ESANDERAQRRARRRGQGTSTDTT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q518	Pex24p domain-containing protein	3	39-61, 97-123, 476-503	EEEQRDRKRDRLKGHANKIKGKW, DDSTDAPRKKDRRSKKYVKRPEFGPRL, SNGFSGHKRGEWRRRRWMRLVEKRASDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WHL9	Uncharacterized protein	1	9-42	QERATRARLKKQIDEERRARWKARGPKGDSTRSF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJ24	Uncharacterized protein	2	29-56, 93-113	QGKTLRAPAIKEKKKKNQPREAPPGSDN, LAKARGQKKESWNIRKKPLTT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YHT9	Uncharacterized protein	1	281-301	YTTHSHRAFHHQDYKRRRPDC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNH6	USP domain-containing protein	3	1-29, 721-740, 835-868	MSGVHRFLSRREKKNPRHASPHHRDKFGS, SNTRRGSKPSNSKSKSRPTS, SETRPLTRKEREILKREKRKSKKHGEEDRDCVVM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCK7	Uncharacterized protein	1	521-545	LHPTDPEETRRRRRQSSSSSVRPSI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEW1	Uncharacterized protein	3	3-30, 686-712, 750-770	APYITGRTRPTKVKKHQNTLKRKRDDVD, EDKALAKEKRRSKKEKARERERAEHES, DDAPRKKQKKWFQEEGRRKDL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFT1	Uncharacterized protein	1	84-106	TTYGKKKIKTTNKSNTKPCKKSF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGB6	Uncharacterized protein	5	1-22, 57-76, 301-320, 347-372, 842-861	MPIWPFRRRRRGTQGNNNDTDP, PSSSLPRHSERKRPASQQDL, SQRKEKDKGKQKEPDKERTF, IMERDAKRKEQRQKERQEKLERKLRS, GSVRRKPTLVQRDPRLKSRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI84	Uncharacterized protein	1	110-129	GQQRHKGSPKPKQIARKPIG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJR1	Uncharacterized protein	1	184-214	GSSKDKQDRIERRQRRLEKARQKRKEKEGAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK46	Protein kinase domain-containing protein	2	13-41, 54-73	AEDARRKAEKEEKKRLKAEKQRKAEETQR, DDNERPSKRRRISHEDQEDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMD8	Uncharacterized protein	1	26-56	PAFASIPKTTSKKKKKKKKAKNTGGTETPEN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PME5	Uncharacterized protein	1	1-20	MTFHCTHGRQRTRRMPCASV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPM8	Peptidase_M14 domain-containing protein	1	60-79	SSTPNARPHCDKPRPPPQTF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQN1	PPM-type phosphatase domain-containing protein	1	537-557	GTKERRDFRKREADDPRSRRQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT65	Uncharacterized protein	1	22-41	APPLRRRKRLIQNISADWKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUK9	Glycosyltransferase family 2 protein (Fragment)	1	446-466	WVPSGDSKAHKNNKYRNMRIL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV27	Uncharacterized protein	2	43-65, 579-598	LEDTLKKEIKKLQRSRDKIKGWA, ALKSQSWRFHKQYQTWFQRH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVH9	RHOMBOID-like protein	1	97-125	DDPFVRDVDPRKKKHRTDRGKQGWFKGKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVN2	DH domain-containing protein	1	66-86	DEAARKRSMKRRQTIEELIRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWD4	Uncharacterized protein	2	246-278, 532-554	PWFHSFVRRRRWLRMRKRKDLKQHTKEKGHQLT, TSDTTNRTKKSKEKGKARALDGV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX09	MPN domain-containing protein (Fragment)	3	35-65, 157-183, 481-502	DPQAAKLQEKKQKWLRQQRQRFAEKRRGGFV, TMWVVMRREKSDRRHFKRMRFPPFDDE, LNELHKKPPKAQNKQNLCRSLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYT5	Uncharacterized protein (Fragment)	1	10-29	MDRPLDAKIKRNDRRRLLTG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q041	Glycoside hydrolase family 16 protein	1	674-698	NYDGGSTKRFKKTKRSSETTRSWLP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKX8	40S ribosomal protein S1	1	1-29	MAVGKNKRLSKGKKGLKKRTDPFARKDWF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y599	Uncharacterized protein	1	527-550	VKTHSANCSKRRKKGRRDDGAEIV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJX8	Uncharacterized protein	1	1401-1457	RAKLYSAKKEELKRKKKDIKKDLKKAQRSLTERLEQRKKEKEERRVKRAKWEEENEN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL21	RING-type domain-containing protein	1	271-292	VTATPRVPKSTKAKRKWTKLTI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC68	ARID domain-containing protein	1	106-127	MQTQQFRPPQQQQQQQQQPPQP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG01	Uncharacterized protein	1	50-75	LTLCHPGSCYRRRRRQRVLGKPTTWS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGF3	C2H2-type domain-containing protein	1	94-140	SRLLIRPSPKQKKATNPYSCSHCSETFSKRADRKKHIRDKCPYLGQG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKN0	Nuclear protein localization protein 4	1	137-156	KLDGKITRKKDQRMCKHGPM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPN9	Uncharacterized protein	1	243-266	STAIKECRWRPRNELPHTKRSMKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPQ3	Uncharacterized protein	1	1-22	MPSLGFLKKKRTKDSSQGSDNS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTS7	Septin-type G domain-containing protein	1	1-25	MSSSPAIKLRRKKNVKKGIQFCLMV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTV3	Biotin carboxylase	1	2153-2173	WQNARRFFYWRLRRRLNEEYV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU12	Uncharacterized protein	2	124-146, 150-174	LSTCSPRRWARHRPHMHTKRLEN, IEASRLRSTRRRSRQPVLRRAREMY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUP8	Uncharacterized protein	1	7-34	SRPPNASRPNYQNRPPPRQGSKKDVDPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXN8	Uncharacterized protein	1	144-171	VTRSVDARFKINKKCRRWRDSVGWTEEQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYV1	Uncharacterized protein	1	193-217	NYTSGFGKKKFWQRKPKDTTIRDTE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ01	Uncharacterized protein	1	314-337	ASGPTKAKDAKRPTRRGQQSNATT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZM5	Squalene synthase	1	346-368	CEVFRRFARKIHRKNKPSDPHFL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0F9	Uncharacterized protein	1	6-30	KSSATRPTTRPAQQRRRPRATFFSL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2S6	ATP-dependent DNA helicase II subunit 2	1	561-580	VPPKAAGKRYSRKEAPKPLS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4G5	RNA polymerase II transcription factor B 38 kDa subunit	1	59-78	CPIKGCSETLRKNRFRQQTF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4J7	Uncharacterized protein	1	74-123	EEEERAEAKTKKRKRNEKEAIDNIKKAKASASKKGKKKAKKDDSDDSNEY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIU6	Uncharacterized protein	1	66-98	PGTSYPPSTSSRRKRRGRSSSRKRNNAGNIPKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMR2	Elongation of fatty acids protein	1	280-300	FYISTYKKPVKKGRGRATSAL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y271	DNA mismatch repair protein	1	324-344	ESPPPAKKGKKTPARGKKLTP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YK24	UBX domain-containing protein	1	350-373	RYSLKMEKKNPVQKQRKESKKDVA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKL1	Eukaryotic translation initiation factor 3 subunit M	1	414-439	VQNGQGYRPDRRQRNAPERQQQQSIE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM77	Uncharacterized protein	1	136-156	IDNIREHYRRRHGQRSGDEEF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMS4	Uncharacterized protein	1	551-602	TVLSAPRRKASPKRRAANPRKRSVKERVRVLDGNSKRKSRKSVNYRDDREST
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC25	C2H2-type domain-containing protein (Fragment)	2	1-25, 63-90	MPAIRGPKSKSKTRRHTRDLDQVHA, ETNFVKHQKGKPHKRRVRDLKEEPYSQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCH2	Uncharacterized protein	1	415-439	ASKQRESSSKKKRKQANQVRSQQPL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCI2	HET domain-containing protein	1	391-410	RARVRRCKIFWKPERYSYRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD91	Uncharacterized protein	1	8-28	EEPQHVKTLKSKPNVRKEPAF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDC4	Palmitoyltransferase PFA4	1	104-123	CEAFKPPRAHHCKTCKRCVM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK6	Transcription initiation factor IIF subunit alpha	4	32-62, 190-211, 415-439, 555-575	VVNIFNSKRKPPVRKAPPPTQQKPNPPVRAL, SDPVKAGKKKPSKKVEEGRDNS, EQAEAKKQKRARRLLRKNEHQGQYE, TDTSRKGRTKLKLKNSPPGSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH41	Uncharacterized protein	1	60-79	SISFKRYAKALKEERHKLRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHD7	Zn(2)-C6 fungal-type domain-containing protein	1	14-37	QAPPPPPPPHHDPRQQQHQQPSTH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJZ2	Uncharacterized protein	1	500-522	RELLKFVKEKKVRYKAVKEIEFI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKK1	RING-type domain-containing protein	1	78-102	IDLGQMPHQRRRRRDKKLMSMEEVN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM21	Uncharacterized protein	2	1-20, 32-53	MRLHSQKRRMSKVRVSPIGK, DEVPQFRWQRKQRGRRHDDYNN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM51	Uncharacterized protein	1	5-28	VVSDVPKKATKQKRSMKKDEDSLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM64	Uncharacterized protein	1	133-156	VDMERRGSSRRRLEKKNHSPEDAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT66	Drf_GBD domain-containing protein	1	590-617	VKEHALKASPKKSPNKKQEKPPQLAAPM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUW9	Uncharacterized protein	1	12-34	VPVADRGQRYPNRKLRRTCSIVL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWH4	Uncharacterized protein	3	26-49, 1354-1379, 1395-1416	LTTRVSPSLKRRRHTTHVQRTVPA, KRTSEEMLRRAKQRRRRTFTLPFSGG, QSSRQRKEERAAEKRREALRRQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX57	Serine/threonine-protein kinase Tel1	1	419-443	ESEMEISTRPRKRRRREDNLEELAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXK7	Uncharacterized protein (Fragment)	1	16-45	PKRRRLAKACESCRARKKRCIHFAEANNKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZY2	SEC7 domain-containing protein	1	311-332	APTTVSRAKKHGKRPSRSGSGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q236	Dolichyl-phosphate-mannose--protein mannosyltransferase	1	6-25	GSLRNRGAKGHKRPTTPNGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLE5	C6 transcription factor RegA-like protein	1	147-167	KCEEEKPCKRCTKKGIPCNYT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKK6	Uncharacterized protein	2	20-49, 55-74	EPEYEVKTPAPKRRKTKSASKKKTEVTPTD, STTVIKKPKASAKRKTQSSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4D7	ABC transporter-like protein	1	102-126	LSHISRQQSRTSRKSDKRINELVRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJC3	Uncharacterized protein	1	60-80	YADNKRLRPKARKSTTSWSRY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJG1	40S ribosomal protein S4	1	1-20	MGRGPKKHQKRLSAPSHWLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YME7	Uncharacterized protein	1	185-206	KMNDDDDRRRERRREERVEDEY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFX0	Uncharacterized protein	1	420-441	LQTPAYAGKKRKRTCNEALSEQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIJ6	Uncharacterized protein	1	686-705	AIALRDKKSRRDSIHLGKEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJQ6	Uncharacterized protein	2	336-357, 755-775	SEKAWKDKTWKDKRKTRFCGIP, YEPNTNRKWKRTAPGGCHCQW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKA6	Peptidylprolyl isomerase	2	284-304, 323-346	VPSKADKKAEKKGKNKRPAED, VNGEEKLTKKQKKQKKNDGTAAAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNC8	Uncharacterized protein (Fragment)	1	171-190	KEWTRWCKRWVKDPEKAVKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNY9	Uncharacterized protein	1	96-117	YQNKQNEMEKWKKKNNIQVVQQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNZ9	Uncharacterized protein	1	298-323	DEVEKPISKREAKRRAHKARQEALAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSU4	Uncharacterized protein	1	1487-1509	EDTTKHRLSKRRDKLKQWHSEEL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUA0	Uncharacterized protein	1	528-551	GEAKAPVKTRKVKKQVRKGDLPLS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUL8	Uncharacterized protein	1	157-183	ADKVAGSRIARRKRKGREPKIEASGKQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUN2	RF_PROK_I domain-containing protein	1	117-138	ADKASKKKASAAKKSRRKYRGL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWT2	Uncharacterized protein	2	46-69, 243-264	QPTSNPTPPRHSPHRRVLSNEKLM, ALDPSFRPKRGRRRNSETEQDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZS9	Uncharacterized protein	1	570-589	SQTSSGKKTRTKPIRNAEGI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZZ9	Uncharacterized protein	2	9-33, 112-140	RDDGDAKDERKKQRKGFRVGPDNLP, EETQPRRTDREPRRRKPKPMPFKKEHEEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0X7	Uncharacterized protein	2	721-763, 808-832	FRPRNRKRSLDHQRNSRDSRSSKMRKSNSRRSRDRPSQDTRDS, ENGRGLRLPRKYSKQRQWDQMEFPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q150	Uncharacterized protein (Fragment)	1	381-403	IFQPEKQKPKRPRKDGVEQPEKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q382	NUC153 domain-containing protein	3	19-46, 635-678, 703-729	TARPLPEWLARKRKRSLKKDAEYANRVE, IGSTSYKKSGKRSQEQRRGPVMQVSSSNRTKSRPQDRRSKSFGD, EKEVTFAPTKPQKRRHQQQQASADDGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Y1	Uncharacterized protein	1	98-121	VKQGYLKSLPRRNRRRPKTVGIAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4X5	Uncharacterized protein	1	163-184	GPNVRLTKLKKKRGLKDFGMKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q553	Uncharacterized protein	1	71-97	NDINSPRREWRKHGKKRKMYGLRKLAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJ61	Uncharacterized protein (Fragment)	2	604-629, 700-722	GHPHRLGSKRLLRRARKEQAKLNLQD, AETSRLQTRKMYRSKLPLRKQKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHI8	Palmitoyltransferase	1	648-673	GDTRLGHTRTKKQRIEKAKEDSKRYS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKX9	Rho-GAP domain-containing protein	1	592-614	YEDGSKPRSRDNSRPRENAKPAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL59	Uncharacterized protein	1	40-66	RSVRSHVTSKQHEKQRKRAAAEQARRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBX5	Uncharacterized protein	1	25-51	GGAIIEKIKRKRAQKRAPPPPRLLEES
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD56	RING-type domain-containing protein	2	367-387, 398-430	AESPPPKPVKVSKRGKKAVGE, SPETKANREKQAVRREKRKGLEQKKREMQNPSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDJ7	Uncharacterized protein	1	127-146	TQKVSKKERKAAKKVAKALD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFS8	Mitochondrial intermediate peptidase	1	7-29	QQAWTCPKCLRQQVRQSRRSLVT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH35	Uncharacterized protein	1	159-183	GETMKAASKKGKKNKARSSASQEAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHC0	Uncharacterized protein	1	318-339	AKSAIGAKRKWHDRFRPHKKTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ35	Uncharacterized protein	1	157-185	VEEKERDTARKKQKKQKKMERKIRAQMDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJZ6	Uncharacterized protein	1	25-50	DQLVWHKKPQTTYKKFPKKLSSGDSH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKA8	Topoisomerase 1-associated factor 1	4	328-349, 559-583, 933-995, 1057-1086	QMDSSKRWNKPQYRGKVSREFD, NVDMQIRSKRRARKKQKPKDSGEAG, AMFPPNIKEKRKKRAEGDQDRPRKRRRRNSNAIELTEEELNAKRKAKEKKDREKNSKIKSNLY, AKAKAALKSAKKPARKKRKANDRDSDEDQI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKC9	Protein kinase domain-containing protein	1	920-944	VEGRDLTVRRKPRKSEPRSPASITS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMB2	U3 small nucleolar ribonucleoprotein protein MPP10	3	44-72, 319-342, 618-650	VATQQQERLKEARKKRKRRGEERDEEEVL, APPAQEKSKKNKKGRPNPHNFPAS, LPKAREEMDRDERKRRRRREKERIRKAGTNEGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRC6	Zn(2)-C6 fungal-type domain-containing protein	2	33-58, 61-88	KMPYACQACTKRKVKCDKVTPTCFAC, SKAECVYQAPPPRRRKRKLIDDVTERLV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU34	Uncharacterized protein	1	1844-1863	NSIQKKGPKVGRQPPYREKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV40	Zn(2)-C6 fungal-type domain-containing protein	1	532-565	DEEDLSSKPRCQRCRKSKKGCDRQRPCGRCKDAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZN0	Zn(2)-C6 fungal-type domain-containing protein	1	9-46	QSPQQTTAKRLRKGTKSCIECRHRKIKCTWQSHTDKVC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3N6	Uncharacterized protein	1	176-198	ASDARKQEPTQRRPEPKKSPSFF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q576	Uncharacterized protein	1	10-34	AVSEQQRRSGRQQRWQQNRKQMPLD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLV8	H/ACA ribonucleoprotein complex subunit CBF5	1	446-496	GETNGEKKEKKEKKRKHEGETAEEKAERKAKKKAKKEKKAKRESMVTNDSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHT3	APH domain-containing protein	1	266-288	TEEQKGWRYKKPRDLNGNIVRPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLY4	DUF4203 domain-containing protein	1	335-354	MKIWKVVKEQKQRRDAQRLQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC73	Uncharacterized protein	1	341-364	APENDRTDRRRERNDRNPRQRAAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDE1	Uncharacterized protein	1	199-224	RGPARMHSGRVKHRHEHNRSQSRAQT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFE0	C2H2-type domain-containing protein	1	256-280	EEFKEIRKEWKAKKKEEENQRKAEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG14	Uncharacterized protein	2	38-64, 691-710	KLDSLPRIKTDKKWRKKVHPGISTFGD, HMTRSHSRRASPTRKSPLIP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH95	Uncharacterized protein	1	50-73	DTLIGRFRKSEKNRVKNVYNHVES
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKY1	Uncharacterized protein	1	250-273	VSDSTKRSSEPQRKTERNRQVSEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKZ2	Uncharacterized protein	1	441-464	LLNRLTRRPVPRRKLQRVQHQSPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNA3	Nucleolar GTP-binding protein 1	1	506-525	RNENKMRKSLKNRAVIPRSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPC8	Uncharacterized protein	1	276-305	GMCCCCASRRDVRRGKKRGSKKAWNTETVG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS74	PH domain-containing protein	1	157-180	TKAQAPSMSRRQRNQPAHRVHDIE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT55	Uncharacterized protein	1	148-172	RESETSSKRARTRPRLKHTLDSNTY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTB9	CDP-diacylglycerol synthase (Fragment)	1	421-441	KYVGEKRSKGQQKAKTAPEKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTC7	Uncharacterized protein	2	350-372, 710-735	APSTPKVSTIRRPKKKRCGALTP, TNKSDDSATPKKPKHRPPGINQSGPI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0V3	Sas10 domain-containing protein	1	557-599	IEKNKGLTPHRKKDVRNPRVKKKKKYEEKKKKLASIKPVYKGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q144	Uncharacterized protein	1	217-238	ADKDKCKKCKGERTIKQKKILE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4A0	AB hydrolase-1 domain-containing protein	2	384-407, 619-642	RQSSKSPASGRRRSKNSKRHSVTP, LGPPSQPKPAKKPKRSPEHRWTVH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q565	C2H2-type domain-containing protein	1	477-502	KVKSRECDLRKHTKRHTRPYGCTFPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIU2	ABC1 domain-containing protein	2	83-106, 542-561	LGKPKAAKTYRRSQKWLRRLVRLS, KTMKGIKKLSKMDQKQRQFE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WN90	Uncharacterized protein	1	319-339	LMSRKERERKKLEKAHPEIKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5H6	Uncharacterized protein	2	25-44, 217-240	HLFHHRNKNQHRRSIWWRHF, TATMSDGSYKKKRKRGNAIDDIFG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC70	Uncharacterized protein	1	340-359	KPSIRDKKSCLKSKATPSAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDG4	Uncharacterized protein	2	168-187, 235-261	AEPVKKKTKVKGPKGPNPMS, ADGAADAVRKRKRKRKPKENVGSEEAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG71	Uncharacterized protein	1	198-218	ADFRVRSRGLRRKMWWKNVRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGL5	Uncharacterized protein	1	553-572	GKRWTEQRRKSSAPRNHNLH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK04	Uncharacterized protein	1	113-137	ESYLPMMRQKEKRRRLKVIEKSLAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLX2	DNA-directed RNA polymerase subunit	1	261-283	VEMQKLKRAENNRKRKRDMDEGV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN17	RRM domain-containing protein	1	52-77	TTITSKANGKKTKTKKKVIEEPAPDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSC5	Carbohydrate-binding module family 21 protein	2	31-52, 500-521	DNVPRSPVSRRPQPPRSQSSAS, DSPSNTIKLKPKSKRPAFPASG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTM2	Uncharacterized protein	1	85-110	TMNTPPPDRPHRDKRRRQQSTQPNAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV26	RNA-dependent RNA polymerase	2	675-700, 779-803	KMAPVRKIFRQGMKRKERKNNWEIVM, IMPQYLILKPRKRKRVEVVEEQDNE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV33	Uncharacterized protein	1	17-42	ESPTSSPLKRTSRPRLERPSGKRTGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWA4	PseudoU_synth_1 domain-containing protein	1	37-66	TLSHSASSAPRRKPKKPSKGFDPSKYNTRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYH6	Uncharacterized protein	1	184-204	EASAKEKKKAGKDKDPKAPSV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYX7	Uncharacterized protein	1	246-270	KDYGGEKPKEKPKPEQPAKKPDGYG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZB4	Uncharacterized protein	1	31-52	DATATAILKKKKKPNSLIVTDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q120	Uncharacterized protein	3	100-128, 153-172, 310-334	AEAEKDARHARRKAKRRKRGITVSPDETD, TPLLSPAKKRVRQPEIQRKG, FSNWTADKKPRQRPRVSGKTPKDSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2Q8	Uncharacterized protein	2	184-208, 275-294	QQLWNRILLRRRDRRKKDPHAVAVI, NVQHRNKKRNWDARQIPKDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4P8	Uncharacterized protein	2	43-62, 768-790	GPAGRPRQTARKASPAPRRH, SVGSTSPSRKRKRGSSARQSEDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Z0	Uncharacterized protein	1	44-73	KSLNPEKKQTKDGQPPKRRGPKPDSKPALT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIV4	Uncharacterized protein	1	10-31	GKSRGRSKSPSGRDGRDRSRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMG9	Uncharacterized protein	1	40-64	RVEKAQGRSKTGKKRQRMTEHEENC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIS3	AAA domain-containing protein	1	355-378	ASASSPTKPAKRRAVRRSNTDLQS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE43	HET domain-containing protein	1	46-65	DLDRARQKRGWKKIQHTILQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHU1	EH domain-containing protein	1	23-47	RPTNGAGRRKLHRHAKHPRSGPSHL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI40	HMG box domain-containing protein	1	15-35	VDKSAGGKKKKDPNMPKRGLS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIA3	Uncharacterized protein	1	39-58	RYGQPTTKYPRRPRVLNVRY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIL1	Uncharacterized protein	1	142-161	APASHKAPTRPQNQHRTDRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNH0	Uncharacterized protein	1	158-179	SIVYRERARSRPPRREERDEID
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ97	Transcription initiation factor IIE subunit beta	1	245-276	TSQVKEIRKGNTQKKERKRINRIGTKITNKHM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWL2	Uncharacterized protein	1	174-196	DHTILLRKRYPRKPPSQTFKDPF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWU3	Uncharacterized protein	1	21-40	ADRQCQSDQHHEPREKKGRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXF4	Uncharacterized protein	1	119-146	ERKYRNRAGSHQPRKRSRSPIRARPAQA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYH3	Uncharacterized protein	1	175-194	DVNALSKKKQRWRQVFNPAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZS7	Spc7 domain-containing protein	3	16-44, 153-175, 409-428	DPLQRKGSSLSPKKNGRKGRSKSVGPGTL, QTSPAKKETKPKRRSSGIPPMDF, GSPAKQERRKSLRNRRSSGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZW2	Ubiquitin carboxyl-terminal hydrolase	1	393-415	EDVERAKKRQKRMQKESEENGDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0F5	Uncharacterized protein	1	324-345	QFQQRTPRPRHLQKQHHQQGFQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0V2	Uncharacterized protein	1	10-35	GDISPPPSSRRRKLASPRSPQRVPEC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Z4	Spindle pole body component	1	3-31	GGVWTWSGRPRKRSLRSLKAPKEGQRRLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1H9	G-patch domain-containing protein	1	238-259	ILTTNRAKAKPKPKPLKRSGFG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q433	Uncharacterized protein (Fragment)	1	1-21	ASTELKRKRAFRKFSYRGIDL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5A4	AAA domain-containing protein	2	2-32, 1408-1430	AYDVPKPVSLKRKRRSRRRREDKPAVSARIY, MNLTNSPKKGKGKGKSREIANSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKS6	G-patch domain-containing protein	4	3-23, 194-217, 221-247, 259-290	LSGVKKRSRLSQDPNNNNWSK, NLYAIPEKQKRRKDKKNSPEEDPS, SSKEDKAKEVKRPKKEAKKADKAAKAQ, LKEEKRAMKLERRKRKEDKRAKRAAKQNADSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJQ3	Glycerol-3-phosphate dehydrogenase [NAD(+)]	2	26-47, 69-93	RIFTRQSRFHDRKPPSAQNFRS, VASNTPAQRQRQRQQLRRIHQPQES
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCK0	Uncharacterized protein	1	48-70	TTETDTQTPRKRRCPNPPSEDSL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK1	RING-type domain-containing protein	1	4-32	QDSADEAPKKKQKKKLRRRGCIICCNDVA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGY2	Uncharacterized protein	2	206-232, 292-322	QTRHVRLRPPLRRRDWQRVIKNRRSMW, QSTVIGPKPKRAKVKKCDKPESSRSNFPRPG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHN0	OTU domain-containing protein	1	393-419	SASQTKLLKKQAQKAARKERHQADSKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLC9	Uncharacterized protein	1	105-126	RDSTEKRRSPKHSPPLDKSRVS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PML9	Uncharacterized protein	6	254-273, 287-306, 319-342, 904-926, 1032-1055, 1101-1120	MPESAQKKKKAKEPRLSLPT, ASGTPKRQRRSSPVRNKIGS, WTAEGIVRPRKRRRTKTELANGTP, QESQRIRIRSPYRTRKNSSDQSA, ALNPISAKIRSRRRSRRIAIGGNF, FVQSTKKMAKRRSSGRTFLD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQL8	Uncharacterized protein	1	69-93	VYVRPQERAKWRKMKQDRIRVYAAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS12	MFS domain-containing protein	1	40-64	RRIRVRWCGFYKHKRPGPSRPPSVW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS69	Uncharacterized protein	4	1-22, 24-54, 270-301, 346-368	MSSSPEVDKKRKRDVKSEDELE, DVNLPEPPSKKAKRKEKKAKTKKSSAEEAEL, SDESEEGKKKPKRKTHKPRKWFINRYNGRTMR, RDDKYKKMGKDERQEVRRKKFDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTD9	Glycosyltransferase family 1 protein	5	115-134, 150-173, 241-263, 830-851, 1092-1112	RSSTLLQKMRHRQPNQAYQY, DEDAAKGKRTRQPKPQRMKATAGA, DIPNQRTTGRKHRQHLHDHPKID, RKKAEVQRRKDNREAKKQERNA, GNIVSRIKLHKEKKRWENAGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUZ6	Uncharacterized protein	1	74-100	DIKNKAKITKRKPMSRKKRKVESDSDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWY7	MPN domain-containing protein	1	349-368	EKTDKEAKEEPKKDDKGKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXK9	Glycosyltransferase family 15 protein	1	32-57	SEKITPRLSFFKKRIRIRGNSKISVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZU0	Uncharacterized protein	1	455-479	RFGGTDKRKIYNRKLRRSAQESSEF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZW5	Uncharacterized protein	1	42-65	YDQRDMRRLGKKQELKRRFRFFSI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2B0	Transcription factor BYE1	2	136-165, 222-246	WESRNKLWQNEKKMSKNRKSKNRGGDDGKP, EAEAKPSKSARQDKRRKSTPAESKM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3L9	CCHC-type domain-containing protein	1	217-239	EYGPDLCRPRQTRRRTYCFLCGF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3M9	Transcription initiation factor IIF subunit beta	1	237-262	GSMTSKPGKGHKKKPLKEKAVRMTTN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q401	Uncharacterized protein	2	28-55, 167-190	DKLLKPAEKTVPKKKRTRSDRSEETQRS, VKRPPPSSRRSGRSERSRRETRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q516	Uncharacterized protein	1	68-96	WDDAHADKRKKTRQRRKKIIQTQAPENVD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIK5	Uncharacterized protein	1	959-984	SSQESRNGPTPKRPRPRRSIMVPATA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJK5	Actin cytoskeleton-regulatory complex protein PAN1	2	1320-1340, 1421-1446	ASAGKSKPPPPAPRKNRSESL, QVKAGKVKKAEEKKRREAAKKEAQDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGJ5	Uncharacterized protein	1	90-115	GGDERSRSPRKERRRKDERREREVYS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGV7	Ubiquitinyl hydrolase 1	1	63-82	QQQHSQQQRQQQHHHTPQHS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKM0	ATP-dependent DNA helicase	1	14-39	TVVRKLSQPVSKRRKVHNLTKATTFK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF23	Uncharacterized protein	2	163-190, 452-474	AGVRERDREQRERQLRRRESTLRRRPTA, GSVARRARNKTKKRLFGRGKWNF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIB5	Uncharacterized protein	2	1-26, 286-310	MAMNRSKSKKKRARKPRKVSSAAATT, FDELYRKQCRKWEKKSLQQQLERAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJW0	CENP-V/GFA domain-containing protein	1	103-126	AESWFRWRTRKLRHREDGLKRARE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNI9	Uncharacterized protein	2	175-194, 267-289	PENPLQRRQRIGKNKRTVIT, QETLTKTGKKSKKTRNLGEKLVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNV0	PHD-type domain-containing protein	2	586-606, 674-696	AGMVRSRSKRKGKPNGEEPES, AAERERRRASTRRPVSRRNTINM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP92	Homeobox domain-containing protein	3	12-31, 230-249, 285-308	ASTYKPPSLYPNKKQRTGTF, YEYQHGKARKRSNLPKQSTE, NWFINHRRRCPELRDRRERGRGGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ48	Uncharacterized protein	2	24-50, 99-119	STCTSSRSRAHHEDRRHRRTCRGDIGG, VSTSRRQQTRRFSSHVRRYQH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQC2	Peptidase_M48 domain-containing protein	1	35-70	IPFQQPRQRTHWQRTWQQSQKRTYRRGQPLSYQRFK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS61	Uncharacterized protein	2	112-136, 358-377	YWNMMKTICKDRRKKESQPSARGLG, WAEQHRPRKPKYFNRVQLGY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSM4	Protein kinase domain-containing protein	1	493-512	QEEETKRRKNFKQGYRGGNP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT22	Ysc84 domain-containing protein	1	524-546	VEVPKRPPPKLPPRNPGRKGPFD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU88	Uncharacterized protein (Fragment)	1	7-27	IIKGPRSRYNNKKVKPSLRRY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUB4	Uncharacterized protein	1	300-328	GVVSRDPRRVERKKPGKLKARKMPAWVKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV82	CULLIN_2 domain-containing protein	2	7-34, 65-89	VHTATSNQQHDRKRKRPSRQAAPAPALA, PNHSCSPNSPSKKRLKADRTAPPST
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYR8	MFS domain-containing protein	2	103-122, 233-252	CIERLKQKHHTIAKLHRERF, LSARRDKLVAEKQQRERKLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYT6	Uncharacterized protein	1	3-65	MTDQTRSDRVNKPRDRRSSRHRSTPKATSETQPFRTTPTRQTRSQRVRQKGGRSSRQERQPKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0P8	Uncharacterized protein	1	677-697	IKKFEEKRKKHHSTIRAFIRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1D9	IU_nuc_hydro domain-containing protein	1	375-399	QWTRGMCVIDRRSRKKREDDHDGEI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Y7	Uncharacterized protein	2	62-87, 199-222	ETEYRVKRECIDKNRKEIKRHEHDVA, ANLQKHVKKIEKNHKKRKALLEEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3W5	Uncharacterized protein	4	746-769, 862-883, 913-932, 949-974	DYKETRERFARRKLRQECTRPITP, HETDRDRTPRPSDRGRRRSGTS, REAARRQKLQQKPDSKGPYT, VTSSSRSGSRREHRVHRKEGGRSGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q538	Uncharacterized protein	1	170-191	PPSPARRSRRSGFRHRRIRSSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y343	Eukaryotic translation initiation factor 3 subunit J	1	77-98	KANQKPKSQRIEEKRNERLRQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIG8	Uncharacterized protein	1	12-44	WTLKAVRRSKFDGQKHEKKHDLQRDQTPRPNAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDF5	Cytochrome c oxidase assembly protein COX20, mitochondrial	1	165-185	EKKAREQRKEQMREERRQVKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG80	Uncharacterized protein	2	5-30, 89-129	LSCPGPQPLSPRRRHPARQERGFESG, RARNHQPAAGRRRPRNSRGTKQAKKRRDARRNERKHAVQML
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIE0	Uncharacterized protein	2	109-131, 164-185	VDDRMGRRRKISREEREQRERED, VGDLTGKNRRSKQNKNSRFYAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJB6	Uncharacterized protein	1	144-163	ADEKRRRSAKWKAKGRSGLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNS8	Uncharacterized protein	1	3-26	ESIPERFNHRSKKGVRNQASKVEV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPQ4	Uncharacterized protein	1	156-180	VTSHNPQKRTSHRPKTVRINHEENN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT94	Uncharacterized protein	1	1-22	MEKDNLKKQFQPRPPQDESRYL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTI2	Uncharacterized protein	2	149-169, 198-219	STEREERAKKRQQTENKDNFA, VERKLAALRRARKEKEKEKEGM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWL9	IF3_N domain-containing protein (Fragment)	1	147-166	EREKAKKKQAKEQKKVQAIS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXY5	Uncharacterized protein	1	215-237	TYINAHTKKKRLQALRRKYQDSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYU4	Uncharacterized protein	1	25-46	LYNKHLKEAKSRRYRWRWVGSC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZL6	Uncharacterized protein	1	695-740	KPVNGKSCTKGRRSPKKTDKALCSHGLEKRKFKKALEERHQELKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZV2	Uncharacterized protein	3	14-37, 445-465, 717-744	PPDERTPRSTRTPCKPHAYNKADP, HITRPTKVKIHRKRRSHGTGL, AIDIFKGLEKKRQRRKEKLYQKACAKAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3J3	Uncharacterized protein	1	1-23	MNRPKNRQPRPPRDQSRGGRGGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3S4	Alpha-1,3-glucosyltransferase	1	1-22	MANSHRPRKRRRNEISTSSSNG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WHQ6	Uncharacterized protein	2	50-69, 198-227	QCSHQSCWGKRKSEKVEKTA, SNTGRVPGRRRSLKRQKKKNFPRGTSFQKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJ37	Zn(2)-C6 fungal-type domain-containing protein	2	60-86, 107-126	ATDRARAYKSRNKRPCDFCRYKKAACH, ESPAKRRRPNEQTTDQHKAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMT5	Enhancer of polycomb-like protein	2	1-28, 241-262	MSTRGQARHVRQRKLNTKQPLRIIRENE, DPYVCFRRREVRQTRKTRGRDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLQ0	Uncharacterized protein	1	50-78	NTRAALHSDRHRVRRKKSDGQAKFRAKRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE30	Peptidase A1 domain-containing protein	1	424-443	LWFFLWRKRRSQRGDSQVPV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEM1	Uncharacterized protein	2	31-51, 63-99	QDVRSRCRARCVRQCLRQSSR, ETDDRRRARRYRGDRRRRSQIRRRRRRPDRREILQNF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEW4	Tr-type G domain-containing protein (Fragment)	1	39-64	EEAEARKREKASREKRQALKAQQSTP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFA8	Uncharacterized protein	2	362-383, 928-949	DETRQYLKKKWHPDAKNKIMSD, SSVYKEVKKKLQAHRDEQRKTE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK4	Uncharacterized protein	1	82-104	GEEGTPSKKKKTKKDVDVNEAEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFR4	Uncharacterized protein	1	722-749	EVPQDPTWRERRERRGSRGDRYNRGQDQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGE3	PARP-type domain-containing protein	3	187-206, 211-232, 265-287	AEPPATKKPRGKKAKAEDAA, AAPAPVKKKGRQPKASKPTEPS, DEPAPKAVTKRPGRSKKAAAVAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL39	Uncharacterized protein	1	26-46	EFWGIRKKPSSQAQKQRQSLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLQ0	Uncharacterized protein	1	318-342	QLPSTKRAEPEKRKSWLGRRFSKKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM31	Uncharacterized protein	2	157-181, 294-318	DAETRREKGFQKRAEKKWQERAVRF, CQQANEHRFKPKPKKHRNHFYSAMP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPL3	Uncharacterized protein	1	184-207	RPATRGTEKPRRSPHPDEKTSRYE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQA6	HECT domain-containing protein	1	60-80	ASSRIQKVWRGHQARRKTFKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQG0	Uncharacterized protein	1	364-385	VAYYAIRKRKSKRGSVAQMDGH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSU5	ATPase GET3	1	275-295	PCDQCNSRRKMQKKYLEQIDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVG5	Zn(2)-C6 fungal-type domain-containing protein	1	39-59	GSPHPKRRRIGAACLTCRRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVQ6	Uncharacterized protein	2	311-337, 424-447	DPQRISRKGSRCSKRSRKSQHEGKAWF, GDHFKTHLKSQPKGRRNPRFTFQV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY28	AAA_16 domain-containing protein	1	332-355	ALYFMKSTERKRRKKGGGTARSGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYB1	Uncharacterized protein	1	398-418	VEWPPRCRCRVHCGKIKWTSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZN2	Uncharacterized protein	2	40-62, 362-381	SDRINNGAKKANKNDKNKQYVPI, TPDHRRSRSREAKRDSRVER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1L5	Patatin-like phospholipase domain-containing protein	2	73-115, 149-173	TALNDWRPVRQRQIRRHGDNRKSKVGKRKPRRGRDETREGWTY, QYVTWRGQRDRLRKRLRVQENYEDW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2S9	Serine/threonine-protein phosphatase	1	501-526	DSSALKSHIKKGRNKRQNMLNSPPAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4M7	Uncharacterized protein	1	1840-1867	DELGRAPLRQRSPKRHVKRSSKLGTEMM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKV3	Uncharacterized protein	1	22-45	GILDRRRCRMRQRGRKISRKGSSV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL44	WD_REPEATS_REGION domain-containing protein	1	1-27	MSSFFTLPTSQKKRKRAQGDAVPRATA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDX0	Uncharacterized protein	1	1-22	MSPERCKRVSHRQPNHRHIATH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHW6	RING-type domain-containing protein	3	38-72, 122-142, 233-252	VKLARALKYARKQDEKKEKREAKKIEKASRQNSFE, DTKTKRWCIFGRKKEDCQRPV, QTQLSRRRPHRQHTRDGDHS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLG6	Uncharacterized protein	1	258-283	RESGGDEEKRGRKRRREPGLFDPPEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLH0	Uncharacterized protein	3	628-653, 911-933, 1021-1041	QLSPKSTSRARSKSRRRQMSVNRGAQ, GGKAICPQHRRYRKSNAARVAKV, TLLRNGCGSARKPRRPRTHRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRD6	Uncharacterized protein	1	109-135	FFEKRRLRDGKGKGKKRQELEKLYQKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTV1	Kinesin motor domain-containing protein	1	737-757	GGTPRKKMSPSKKRVVKWKDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUB8	TEA domain-containing protein (Fragment)	2	24-44, 62-82	SESYMKYRTRQQKDDKGNQGE, WPPMGRRKMLHKDKQRGRNEL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVE2	PHD domain-containing protein	3	103-126, 286-309, 828-848	ASADSQTKRARQKEQPKWLQEPDQ, LSTYNKVLRKARNKPRQLPKPSEH, EKLKQPVTVARRKKPCVCGEY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXC3	Uncharacterized protein	2	107-133, 379-400	LAVTSIPPRRPNRHRKRVCDDRRISIE, QTYISRGRRRGGPKRGNPNPSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXK3	zf-Mss51 domain-containing protein	1	37-56	KQPTNARRIHQSSKHRAAPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZJ0	FHA domain-containing protein	2	643-663, 696-718	WEGRPNYKKFQSNKNRNRTGA, DTENPRRSTKKSQSKSQSQIQMS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZX5	Casein kinase II subunit beta	1	401-426	VQEVTQRRKPSVKKQRHHQTGPGAMV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q010	Uncharacterized protein	1	54-81	TSPETAATKPKKSKLRPRKAPIVLTPKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0S6	Uncharacterized protein	1	54-80	AEEKEVIGRRSQRRNTRPHKRELQWIP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0U1	Zn(2)-C6 fungal-type domain-containing protein	1	32-54	STSNACVECRRRKIRCDGAQPCG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1C9	Uncharacterized protein	1	308-333	ADKKENQGGKKNKKKDKGGGDVNKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1L3	Nop domain-containing protein	1	408-431	PAPDDKPSRKRGGRRVRKMKEATA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1V6	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	1	66-87	FVPPPVKQKPTQNVKGRIRQLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2D6	Uncharacterized protein	2	1146-1171, 1406-1425	RDASKAAHIRPKNKRNHSRIPEHEYY, LVRDYMQSRKRQKRVAEIEF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2S3	DUF2293 domain-containing protein	1	19-49	SLARALAKRRDKPYKTEQNRVFAKKRKLDLH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2Y8	Uncharacterized protein	1	20-46	AIPAEKWHDAKRRKPQLQRRRLSNATM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3V5	Vacuolar protein sorting-associated protein 27	1	46-65	KEAMRSLKRRIGNKNPNVQL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5F3	Zn(2)-C6 fungal-type domain-containing protein	1	52-87	KPAVHLQKRRRVTRACDECRRKKIKCDGKQPCTHCT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YP62	MFS domain-containing protein	1	437-456	MYYRWVNKRRSEGREDWKLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD78	DUF155 domain-containing protein	1	69-91	AKALTKRKAASKHANKNSLRKVA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD83	TBPIP domain-containing protein	1	164-194	VSKAEKKKVQERWTKIKKSCEARKRIRDGIW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF28	Protein kinase domain-containing protein	1	627-648	NDNSSEHKHHPQHHHNNQGQAN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLU4	Uncharacterized protein	1	196-216	SSNRGPPKGRKSRPIHFARKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMC0	Serine hydroxymethyltransferase	1	19-42	PSIFDIIRKEKRRQKHFINLIPSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP18	Zn(2)-C6 fungal-type domain-containing protein	1	18-53	VMESRAPRIGHKKSRKGCAQCKRRHVKCNEESPCSN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSY5	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	2	83-111, 687-712	RTLNPRSCVTCRKRKVKCDKLHPCSNCNR, STGHLWRPLKKLYRKAKDARERGLQE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTJ7	Uncharacterized protein	1	314-335	DASPPQRTRPPPRRPRSSDNFI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUM1	AdoMet-dependent rRNA methyltransferase SPB1	5	226-249, 377-401, 733-766, 785-805, 823-844	NMEARVFNPEKKKRKREGYEEGDW, LQEQQNKEKRKERRKENERKQKDIV, LNARPIKKVREAKARKTMRTARRLEKLKKKSEGL, MAKAAKGGKKRQPVKVVKAGG, VDARLKKDTRGLKRAAKRNGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW54	MFS domain-containing protein	1	490-511	IWTGGSIFKKRRKDKEEASEDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWE1	Uncharacterized protein	1	608-636	LTILVKCAGNRQQSKRRSRRGDNGWDYEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXG9	Alpha-1,4 glucan phosphorylase	1	61-80	QREAWRKYSAREFKNKDEFD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXM9	alpha-1,2-Mannosidase	1	1-22	MPASKRSNGKPQKLPRVQHEFK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0A0	Uncharacterized protein	1	709-733	KREGHSNKSSKSCRNPPPRTATDRQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0B2	Uncharacterized protein	1	31-51	ETTTKSSKTARKHSPEQQEMG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0D0	Uncharacterized protein	3	160-181, 1803-1826, 1877-1896	RLEPPRLKKRVSWRGKNIVISI, NSAPTLRPRPDQRRPDSRSHTPSK, IVEPHKRRSRHSSSTSDRLS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0M3	Uncharacterized protein	1	262-287	IEAYEHRWNEHQKKRRKNWGIIWASI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q427	Uncharacterized protein	1	44-66	SFETPDGKRYRRKRKDSQDVIAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q439	Uncharacterized protein	2	10-98, 696-720	LETSKSRDPRGSKEHRSSRHRDDTDGRHRHRHRHHDHRSHRHGNEDERELRHRHKRQRDRDDDSERTQRKRHRSESRRREKDNPKEAEE, GVETIKKQGRWEKHDRRLEGFRKKW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4J6	Uncharacterized protein	1	55-76	SQSAKKDNTKLSPRKPTAKVTD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJ14	Uncharacterized protein	1	64-86	LASYDRPKRKRMVRGPWYSVGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0C4	Uncharacterized protein	1	106-128	LVILSPKFKKEKKRNFTQLTQGN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2Y9	Uncharacterized protein	1	87-110	FMTEPQKHNKGRRHHIPRGKALGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIR5	WD_REPEATS_REGION domain-containing protein	2	160-182, 212-231	LGYGARRTTRRRRGPVGERYPPI, SHDTLRKRKKLARRMFDREM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL05	C2 domain-containing protein	1	541-568	VLDCNKDAKKQQRMKKEQRERKEQEGDH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMF3	Uncharacterized protein	1	465-486	IAKISKTLQKRQMKNKDARTRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE76	Histone acetyltransferase	3	84-110, 267-286, 475-500	EWPAPEKPDKKDNKKTQSKNHQVSKTD, NLQFTRHRKKCQLRHPPGNE, VLQAQERRKEKERQKGKRIIEPEKLI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEJ1	Kinase	2	30-55, 626-647	SLFQSNQSCRPRPNRTNQYQRRSLYD, IHKHDRKDRSHHSRRLRKIPTY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ30	Uncharacterized protein	1	90-117	NLSACLKIAQRQRTRPKRYPPLRSATIV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN16	GED domain-containing protein	1	107-128	TPESVAPRLRTRRRNRDYEQSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ25	WD_REPEATS_REGION domain-containing protein	1	11-33	GFERDGNSRPRGRPNRRNATDIG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQW1	Cell division control protein 42 homolog	1	177-197	AALEPPTVKKPKRKGKGCILL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR10	Uncharacterized protein	3	14-33, 71-95, 358-377	LEVRNRRHDRRSSTDNWKRH, VSSADRTQWKRYRHHRALQTTWSKF, AENRCRAWSRKHRKMCSGLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXM7	Uncharacterized protein	2	101-126, 131-156	AFCSGCFRCRNCKRKIENLRYARTSQ, MSCHESLMARRRKKARTPKITSGATP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYH1	S5A_REDUCTASE domain-containing protein	1	274-300	MAIWAQKKERRYRKELGGKYQKKRFAM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1T8	Flavoprotein domain-containing protein	1	140-161	NPMTKKQLTKIRRKWNWIQVMQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q202	DBF4-type domain-containing protein	1	132-151	LESIRQWQKHYRRQFPQFVF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q240	Uncharacterized protein	1	18-44	GESAVQRQARERREKRQKKMAEQGEDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4C6	Uncharacterized protein	1	349-372	FTNMVPKHLKKKSIRDMRVKGEGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4S4	Lysophospholipase	1	660-679	YESYQRKKAERQARVSNTVD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q585	Uncharacterized protein	2	220-248, 710-734	EMSKRQLNMLKRRRKEELKRDNKKFKYDL, VNGFEPSKKRRKSDKKENSAPPPAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLZ5	Uncharacterized protein	1	32-59	APTAIKEAKKRGKKKKVEKSKSTLTSKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2S0	Uncharacterized protein (Fragment)	1	192-213	LQVHLLKRCKTRRSRERMCTAM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL68	RING-type domain-containing protein	1	421-445	DEEPIRTRQRNRGRRAPARSHRVVT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMH2	Abhydrolase_3 domain-containing protein	1	70-100	KASPTLAQIHRTRRRRRHRRRLPQRWTSEGV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN63	Uncharacterized protein	1	73-104	DSEVPAKKPTPKKKATPKKRKIKEDHEVVVKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNP1	Uncharacterized protein (Fragment)	1	27-53	TTNQESYRKMCKKYNKAVKEKLAPTKY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YPQ6	Uncharacterized protein	1	205-226	STNIKIPQRPKPGRKPIPQEDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBP2	Protein kinase domain-containing protein	2	420-446, 1376-1397	LIEAQRRLARQKRRQIKQYRQMRRGAA, GLSTRSKKSSRSGSNNTMKKVR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFD2	HIT-type domain-containing protein	1	13-51	LCYAETPKYRCPRCKTKTCSLPCYKKHQQRASCNGKRDP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGI8	Uncharacterized protein	1	12-34	MHSTKQATLRKKRSSNWFKRKSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHI2	Homeobox domain-containing protein	1	158-178	ELRAAKRKMKRFRLTHSQTRF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIC4	Brix domain-containing protein	2	1-20, 367-402	MAKRRVKKRTHVGSKPGLGA, KTPEEIKKMDKKKEQERQIKEKRRAEQKANVEKKRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIJ0	PHD-type domain-containing protein	1	218-241	PPPPSPTTNKRRRHYTNRKNPESA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIK3	DNA replication licensing factor MCM2	1	146-169	DVMDLTRQPRRRRHRFDEEQDDID
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP50	Uncharacterized protein	1	69-97	FHERPGMKRKRLKSVRWRRNFKANFKKTV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR67	Cytochrome b561 domain-containing protein	1	379-398	YGENKRTKTRKLRSDSEGSH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVW6	Uncharacterized protein	1	225-250	ANPRPIAPLKKKRTPRPAPSPRPSMR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYQ9	Uncharacterized protein	1	563-582	TPEGGRPRRTARKSVRISEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZS8	1,4-alpha-glucan-branching enzyme	1	176-199	WNPPTKYQFKHPRPPKPKSARIYE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2Z6	Phosphatidylserine decarboxylase proenzyme 2	3	164-192, 264-297, 832-851	DPEPKWYKLESRRSGRRKAKKDTNISGEV, RTPTGTPDEKQKNRRRRKLKRLRHKTKLKAYEFG, LYKGLKSREMEKKRARKLLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q343	Uncharacterized protein	2	14-42, 85-106	LKLKGAGGVDKKKKKKKKAKEGNEKDDGY, EAQRRFEERRKKRLDERLQKEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3S3	Uncharacterized protein	1	63-84	LLLGILRKIRKRRPELRIVISS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q457	G protein signaling regulator like protein	1	389-412	EDEPWVPRYKKRNVIRKIFDREVW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIG3	Uncharacterized protein	1	96-132	TGHGKNSRKARLRKFFRRCRNRMGKKQQKSSAEKKDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI91	Uncharacterized protein (Fragment)	1	1-20	RPLRPPSESRKVPRPRLFTQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBT7	Uncharacterized protein (Fragment)	1	55-77	DRDWRFESKKKCHERHRLPYMHK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEC4	Uncharacterized protein	1	173-192	EGQHRPAKRARTGERRWCAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGW3	Uncharacterized protein	1	112-133	ATPEDKQKRKLERTASKRQKLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI80	Uncharacterized protein	1	288-310	VALWDAKSKRRIRQYPKLPASVL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL13	R3H-assoc domain-containing protein (Fragment)	1	99-119	HTVYKRREPIRRDSQKRREAL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNS9	Methionine aminopeptidase 2	1	55-83	GAAEGAAKKKKKRKPRKKKKAGTGASGGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP36	Uncharacterized protein	1	680-701	LRAFPSKKLRWREKSLWIHAPV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQP6	Uncharacterized protein	1	423-443	TVTPNGTKKRVKNPIQPLPND
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRW6	Uncharacterized protein	2	301-323, 1413-1436	AQAADSRARRRCRNPRAPMSVSG, RAGSTPSSKRPPPKMQARGFGKQD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSF3	Plus3 domain-containing protein	1	60-90	SQGTRRGVAQKVKSRGRRKRRQESEDEDAGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSZ7	E3 ubiquitin-protein ligase	2	369-391, 773-795	LAKRLFSKDPKKQQQQRAKDEAK, VEDRRRFGKMHRRLAQMKREIQS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUI5	MFS domain-containing protein	1	296-315	APALLRRRGRKQRQESGNEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVH2	Glycosyltransferase family 4 protein	1	501-523	MERFGTIKQGRRRRREAGYLDND
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVR9	Developmental regulatory protein wetA	2	488-514, 540-564	SRSRPASTSRRASRHQRTKSTNSTPRH, PSGSSKTKARREKEADDKRRRLSQA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1S0	Uncharacterized protein (Fragment)	1	175-198	DVETQEARARRRRQERSAREQVPI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3H1	Ribosome biogenesis protein RLP24	2	25-55, 167-195	DAKVFKFCKSKCHKNFKMKRNPRKLAWTKAF, EQERLQPDKEKLKQKRRQRLVRGQGVEKM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XG88	Uncharacterized protein	1	170-195	GSERHRAWKAEGEKKKKRKHAWRLGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIY7	Uncharacterized protein	1	5-28	STDTPSTDLKPRPKTRRPFELGSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLU3	Uncharacterized protein	1	118-141	AEGEKPKKKGRPARGKKIDEKVEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XM35	PH domain-containing protein	1	40-68	SNGAAKPPKTLSKKHKHIRTPSSYTNPDH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI65	Uncharacterized protein	1	19-38	AFTRMRSRLRSRKERDHVLS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIH0	Uncharacterized protein	1	555-579	ARPEIQPVPKRKSKWQPEPESEVAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJJ1	EthD domain-containing protein	1	1-30	MTASSWKMHSQNKGRKKPRHHCIPAIDQVS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDP8	Serine/threonine-protein phosphatase	1	130-155	PPTQITDPKVKRKMKRRFQKDSAYTS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHK1	Uncharacterized protein	1	54-77	IAGATAKKRKREDRLQRRHEPALV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHS1	Uncharacterized protein	1	188-209	YDEFDRRARRRRDQVRINVIDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHY9	Uncharacterized protein	1	79-112	GERIEKDRVRREERQKRERARRKQQEEQRREQAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLX7	Mannose-1-phosphate guanylyltransferase	1	266-307	AGDSSDPKKRKRNFSNRTKTGCHTCRSRKKKCDEGKPICENC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMV7	Uncharacterized protein	3	1-22, 222-245, 280-304	MADRPRYRTLDRRWRRLECSLH, GPISARQEKEKHRQKRPRIASLHS, TFSVSQRKERRSQRSTGRKNSYHSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNL4	L-ornithine N(5)-monooxygenase	1	148-177	GCVGKELSKHQMKKKKKRSSRNDGEQAKPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPE2	Uncharacterized protein	1	1-22	MSIFKRKGKPAKQVDSTPKKEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR41	Uncharacterized protein	1	32-58	NDSDKAKSSKKANSKKSVKNNPYPESG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRR6	Uncharacterized protein	1	98-117	TGRHSEGRKHVKRLHDKNLC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVF3	Uncharacterized protein	2	661-684, 704-729	EPEAPSRSPKKSPRRSPANQGGQT, SNNPDSSGERQKRKHRPLGRNLSGIS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW66	Uncharacterized protein	1	24-50	RLQQETRSRSRSKKQEARHRQHFYTGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXH0	Zn(2)-C6 fungal-type domain-containing protein	2	25-54, 57-82	SNASKQLRRACDCCRKRKVKCDGEEPCNPC, ASIRCAYLQPPKKKGPKGLRSARVLH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYK0	Uncharacterized protein	1	686-708	ADYTTKRNTMRQKARNKAKKGLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1K2	Uncharacterized protein	1	909-932	QWTCPNCKAPRRAWKKLTMTRAPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Z1	Uncharacterized protein	2	122-144, 163-183	DGHVERMKARRRRMSRVPAHGTS, STILGRKWSKHYRKGVTDFKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2Y7	SET domain-containing protein	1	160-182	SDARVFPQRKKRLPENPNFQPSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q436	Uncharacterized protein	3	47-82, 353-373, 432-468	PSVPSRAPPPPPRPRAPPQPARRQPSQRTWRLQLNS, EDDQERKQRKKDMKMKERAEG, GQLAAERKREKKKKSEDERKERKEKRRRRAEENGSVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y6	Zn(2)-C6 fungal-type domain-containing protein	1	156-180	CVYSFQKQMGRPKKRPRTEGREVTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5B2	Uncharacterized protein	1	189-208	LSKKAHTAVKKRKHARHGLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLI6	Uncharacterized protein	1	346-367	LYKNCNKGIKGRGKDRRISNTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XL25	Uncharacterized protein	2	205-229, 474-493	GTDPLKAPPTRKKRKIPRSATPAML, KTFLQKKVRARTSTRPDLKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4G2	Uncharacterized protein	1	347-369	DIYTPTKEKARKKFRPPQAQCYA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM85	Uncharacterized protein	2	17-42, 124-151	VCLACRRQQLRIHRQQRRSNSETQHT, RQSASAKPSTHRAKRRQRRASQETAQDV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMZ4	Telo_bind domain-containing protein	4	1461-1480, 1531-1558, 1616-1641, 1831-1856	QSPVKKALIRRSPRKSQEQS, NSLSPKTKTTARRSPRKTRTQTEPQGLA, SPSTQSDKSSQPKRPARRSMTSRISA, VSSSQKGTPTKPKRMRDRNGSFTIEI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YPC5	Uncharacterized protein	1	325-344	VDKARQEKANQDKARRNTLV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHB6	Cleavage and polyadenylation specificity factor subunit 2	1	631-654	KTAAGRGRKDRKQEQNKKQKVERQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHJ2	Spindle pole body component	1	42-67	RSLGKLSQLHRKLKRHLETIRNAHQS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHQ2	Uncharacterized protein	1	101-123	EQVPDRLKNSKKFRKSIWRFVDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI83	Uncharacterized protein	1	349-372	TTWMYELRPKQRHLRNQNAKEENG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ36	Uncharacterized protein	1	368-396	RLKPSTETIRPRKERRKDTRTKRSVNQGT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJR9	Stress response protein NST1	4	15-43, 95-124, 489-518, 535-568	ITAPPLPGGNRKKQKRRAKQAAKSASQVP, HPPSPAVGMKKTKKKRAPAPSPHHHNHHHH, QAQREAKKQRDAQKKKDKKKQQAQAKAEEK, AEEKKQEEQRRRKEEQRKKREEEKKKQEEEKTRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLG4	COP9 signalosome complex subunit 3	1	8-27	LSFPPEKKKKEMTAREYDKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM25	Zn(2)-C6 fungal-type domain-containing protein	1	160-182	DIPCTFDRPSRRRGPPNRHAEAI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNQ0	37S ribosomal protein S25, mitochondrial	1	46-67	QPLQRRQQPGAKPPRKRSRLFQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP39	Uncharacterized protein	1	96-116	RLLPCRCPPSRRRRAFCSIVH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPE8	Uncharacterized protein	1	168-193	AERITGKSKNQEKKQKHKANANWFDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQB1	Uncharacterized protein	4	260-282, 1238-1264, 1286-1308, 1364-1409	ALSSTKPTKLKSRKRAHDESDDE, EDIVKDYLHPRKKRKATDSASHRPAKK, KVSKVAKSSKTARKRPSDEIPAS, VTKTATPKAQKPSQKKTSAKKPAPPTKRLPSRGRSARTANKRNEFD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSE3	Uncharacterized protein	1	44-64	EYPPRRQQPLSQPPRRHQDHD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT56	ABC transporter-like protein	1	1561-1580	VNRVKAPFKRSGKKGEQQEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU83	ANK_REP_REGION domain-containing protein	1	242-282	RHGADPHRLKKKKEHLCPPSPLEITKTRPRPKMRRLLETYS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUH2	DNA-directed RNA polymerase subunit	1	151-172	IIKKISGECRKVKRCPHCESYN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX37	Uncharacterized protein	1	538-557	AQNVRLKAIRKRAKMNDEED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX68	DUF2235 domain-containing protein	2	463-482, 563-584	TWQPYVRTYRPQRKKLLGGY, YSNNRWTWFKKVSRENKIAKTF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXA9	Uncharacterized protein	1	22-46	DGPYPDLRSKRKSLRLRPTEDSDRQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1F6	Uncharacterized protein	2	1-26, 231-304	MSYVDDARPRPRRRDRDRPPYPADMH, DDYRPRRRRSVEDHRRPPPRRDDDYYSEDYPPRRRRDRSRRRYDDDYDDDYDRHDRRDRDRRGGRDKPPREMKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1K8	PHD-type domain-containing protein	1	190-218	ADEPLPPPKPKPKAKPKPMSKSKVSKAAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2R4	Uncharacterized protein	1	737-763	AILGCLLRCCKRRRRGVKRVASGPPAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q417	Uncharacterized protein	1	49-74	FDTSRSNSVKRPKSAKKNLSSRAWVS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WHW3	Uncharacterized protein	1	290-311	AATPSNKKSKNKVLVRERDVQE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y1U2	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	1	74-95	ASKVDTGTRGRKKQKAKQEGAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2V7	Uncharacterized protein	1	14-35	DEEEGPPKKRRKVASDDKDANT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4B6	Zn(2)-C6 fungal-type domain-containing protein	1	178-202	SSCLQCEKAKRPCRKAPSHQSQSEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIC9	Uncharacterized protein	1	216-240	KASQTTKLRKEKERKEKAKNRQFTY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YK51	Uncharacterized protein	1	1-21	MMEKLRQIRHRGQHEKHHVDV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCP2	Uncharacterized protein	1	417-438	DQSPRIPYKKPRRSQSQTTTPI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGZ1	Uncharacterized protein	1	536-555	LPKVNQQDKRVSKRIRGWIW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHN5	Ubiquitin carboxyl-terminal hydrolase	1	590-612	LQALRNRGSRRKGNERWWRISDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ82	Zn(2)-C6 fungal-type domain-containing protein	1	97-151	EIALPPAPRKRGRPRKHPIVEQKKASHARSKTGCGTCRKRKKKCDETRPICQNCE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJU3	Uncharacterized protein	3	6-33, 43-72, 1295-1321	AATDRPPEIVRKPKRKRQTPAPQDEDTN, TTVPTKTHDGGKKPRRSKKNAEAPTLQRNN, KVAIKEFAKKESKRKRPARLTFYDDKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMG3	DNA_mis_repair domain-containing protein	3	610-629, 655-675, 811-837	IPDATTKPRHRPREQPQPGN, AESPPRRLDNKRRRHNADSSG, ATDSRALSRRKSSRRLGRAKSSKLPLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMR5	ABC transporter-like protein	1	1496-1515	FFYWLVRVPKKKGSKKEKKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR31	Response regulatory domain-containing protein	2	589-612, 822-874	IQHGSSRPKKTRKATPDKAFTKRT, KTEEQKQKDREQEEKQKKKMEKMAMLQEKQRLRKEEEERKKRRQSSSENGIAL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRW2	Uncharacterized protein	1	195-219	AELASLQRRTKKQRSQLHRTHPELS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTG7	Uncharacterized protein	1	92-117	LAPTHSDPPRQRRPSRPSPSLRLPSF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVA4	Uncharacterized protein	1	379-402	EDYTEYKRLRREHHDKKDGRPPSI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXJ0	Uncharacterized protein	1	124-149	SPTHPAASPSRKRKRTTPTPPGTPDG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYT3	SCD domain-containing protein	3	21-81, 1017-1038, 1044-1070	EEEIREKAKRVRKPKSSAPKKPSQKRPKANGTTTLPLRTAAKMPARKRAPKKAKVADSADA, NATATRKRIERNRTKLGPNFKE, ENNSLIKKQTKAKPKPKAKPAVTNGTS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3U1	Dolichyl-diphosphooligosaccharide--protein glycotransferase	1	736-762	QEATAFEKGNKRKKAGKRRGPRVLRVD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4K3	Vacuolar proton pump subunit B	1	480-500	DQYYQRQSKKGNKDTQDNSEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3K1	Zn(2)-C6 fungal-type domain-containing protein	1	9-55	VPSERACDRCRERRVKCDKRQPTCLRCEKLGKPCPGYDKKRKFVDEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLN3	Cut12 domain-containing protein	1	182-204	RDESAKKKSRSSRQTRERDEQDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBH7	PWI domain-containing protein	1	211-296	SYGGRSPSRSRSPPRRRRRRNSSSDISDKADNAGRRTRSPSPRRQRRSPSYTDDDRSPPPRRRRRSPSRSRSPPRKRQSRLGSGDL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCL5	40S ribosomal protein S26	2	1-27, 82-101	MVKKRASNGRNKKGRGHVKPIRCSNCS, KIVRVRSREGRRNRAPPPRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCT0	Nucleolar protein 58	3	460-482, 488-509, 511-536	TAQATEQKQRKEKKSKAEDVEME, DDKAARKAAKKAKKLQEEAKAD, DEEAVEKKLKKEKKEKRKSGTLAAGE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEF7	Uncharacterized protein	1	1-27	MQRRPGSNQIRRRSKREFKAKLHNYSQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF40	Uncharacterized protein	1	76-96	ELSRTDKKKWQYTRSLAKKAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHL8	Uncharacterized protein	2	37-64, 75-94	EPRITSIPRRKGRGGRARPRQSKGRDVD, SESGTPMRRRKGRPGAERGT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHR0	TFCD_C domain-containing protein	1	31-60	LYKSSPIDSRIKRVHKRVKRRDLDHVVNLI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMK9	GRIP domain-containing protein	1	6-34	AQADASKSASKKKKKSKKKTSGPPAAGTT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSD7	BTB domain-containing protein	1	289-309	KGLSRRTSKTSHKDSRYCPCC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT83	Uncharacterized protein (Fragment)	1	101-120	VQSVSRRRTGHRRGQSRWSL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUK2	Uncharacterized protein	1	17-38	SEFERRWAARRPVRSTRPPTTG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVB8	Uncharacterized protein	3	22-49, 492-511, 520-541	AAKKRERSISPPPSRSPRKAPKLEESTV, GEIPKDRKERRITCRNWECG, ILPPACKEKARRRHTDDEEDSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVK4	WD_REPEATS_REGION domain-containing protein	2	367-389, 400-423	DEYERKQKKKDMRQGIRARDRGK, ITGNERPRQRKLKPWQKSLRAGEY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXR6	WD_REPEATS_REGION domain-containing protein	2	58-77, 408-433	QSNAAGKKRKRETKGDSSVV, KVYNTGEKIKQNRKKEFRGHNNAGYA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXV4	Uncharacterized protein	1	184-204	LTSYFAKKKIRKTRNLLGSTN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ16	Separase	2	113-135, 1953-2000	TDATRAGPQQHRKRSPVNNSATP, PEVSTKLPAKTPRKKEKVVAPCTPEEICKTPRTPKAKKTPVAPKTPVR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0D2	Glutamate decarboxylase	1	157-176	ATLAMKKRWANKRKAEGKDF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1T6	Zn(2)-C6 fungal-type domain-containing protein	1	44-65	APLPDRKKARPLQTRPGKHPSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3J6	Uncharacterized protein	4	5-29, 69-97, 487-515, 639-658	NTPAVTSRRRKLTRHMRLRVETAKR, ATPAEPPTPKAKFRKRQKNKTWLPTHMFH, DWEMQERQKRKNQWLRRPKSKRVNWQSVD, LTLHPRNQPNAKRRGPKNGL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y7	Uncharacterized protein	1	325-348	AEEERHKREKLERKKKLEALSKSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIB5	Uncharacterized protein	1	35-55	MPNGLKQREKERKQQRGSSYE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3L7	GYF domain-containing protein (Fragment)	3	7-31, 72-92, 290-319	EEFNRTYDPSKKPRFDQRNPSTLAA, NARAAEKAKRKDKPAKSQDEE, LQRLNRGKPQEKKVPKWKQKKQRNGMDVDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIJ4	Peptidase A1 domain-containing protein	1	433-457	VWWFLFRNRKGRRSRKSKSQSYGTG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLP9	Uncharacterized protein	1	7-34	MSKLAISYSPKKDKSKRRTCPSLPNEIW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE32	KRR1 small subunit processome component	2	227-247, 292-349	RFLPHFKKRNLSKRRVPRVVN, DAMKEKMEERKKKREEAFKAPKEDADTTKKKKKRKSEGNDGEKKNSKKRKAEDVEMED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFT6	Uncharacterized protein	2	128-149, 559-582	YLYGHPAGRRKRFRSPNDFFPH, RPAQVPRLPRENHRRDNRKQAYAQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFZ2	Uncharacterized protein	1	136-157	AAVLKSTKTRKRKGSLRKTALL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGY1	Uncharacterized protein	1	31-54	AAVRCRRTKISTSKQQANRPRTST
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJF5	Uncharacterized protein	1	88-110	PQLRHSFRGQCRRSRQHMECTCS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMA9	DNA damage-binding protein CMR1	1	43-62	KSRPKPSSTAGQKRKKLAEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMU3	Uncharacterized protein	2	79-104, 434-459	GQGCPLRCVLQRKRPQHRSGRPDALP, VLCLSRPYWTKWRQRRPLTNIREDMA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNZ2	Uncharacterized protein	1	17-49	KKRSKQARAHVARVNRQRQKQERQEQKRDSETA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPQ5	ATPase_AAA_core domain-containing protein	1	316-337	VAALKSREDKRRKQRHVHDDDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ24	Uncharacterized protein	1	225-247	GGVEKRGTPRSKRPSRDRSDSAI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR23	Uncharacterized protein	1	407-430	GNTIEEVRKQYRRRKARAEFITFH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTX1	Uncharacterized protein	1	1234-1254	GSSKRPRSPTHVDTPRQRART
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1P0	Uncharacterized protein	1	628-648	EETAGERKKWRQQINKELEPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2W7	UBA domain-containing protein	2	159-180, 492-520	STSSSYRSTSRKRRENASRIGT, QPPVRAPTIPKRSRKRDWKDPRQTRKIAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2Y2	40S ribosomal protein S30	1	20-45	KVEPQEKKKTPKGRAKKRITYTRRFV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJ42	PARP catalytic domain-containing protein	2	5-28, 75-101	EPKLDNRQCRHAPSRSPNNTWPCA, GTSLKTRSTAPKRFWRKYTPEEWRKDI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC95	Uncharacterized protein	1	276-310	SKARERSRSRDRSHDQQRQRKRRQSQDGPRRLAAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD96	AB hydrolase-1 domain-containing protein	1	78-102	SRDSFECRFGRRKRDRQQVHECDDL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFZ6	Uncharacterized protein	1	24-50	DDLLDQVKPRKRIRRSPEDVKKKLEAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJC4	F-box domain-containing protein	1	207-228	LPSNRAPTKRRWSKEHRPSRLQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLF8	FAD_binding_3 domain-containing protein	1	513-533	AYDKIRRPRSQHQVDLSRKHG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNQ7	Uncharacterized protein	1	174-207	KDLSRARPEERERHQRTRRKRHRRDDDRRGGGGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPA5	Uncharacterized protein	1	6-31	IWPRLSKTSKCLWKRRQSDDTRQELA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPR7	Putative phospholipase	1	105-129	HPANKGARSSKPKHKWFPKPISLTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ07	MYND-type zinc finger protein samB	1	238-273	HGQALLKCSKCKKRCYCSKDCQKEHWKNHRGFCRAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRX5	Uncharacterized protein	1	19-48	GKSIGGPRPKYKSWRKKYRKMRHNFEGVLD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSW1	Uncharacterized protein	1	115-140	LERRKQEVMKAKQKRIKEQFQVHACD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTA2	Transcription initiation factor TFIID subunit 8	1	249-270	EGRPREARVPQRTKKRMHEDTF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUG4	Phosphatidate cytidylyltransferase	1	1-21	MTKPKKDVKFNHRERRLSKSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVJ6	CULLIN_2 domain-containing protein	1	714-734	SAIVRIMKSRKQMKHNQLVSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWD8	Uncharacterized protein	1	88-111	IKALKEPPRDRKKEKNIKHTKSVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWD9	Uncharacterized protein	3	82-107, 599-621, 632-658	DNTPMAQRGLRRKKGSRNLSNLNLRH, ANVKLTKKSVRSKKRTTMHDDEK, DEEWDKAIQKPKKKRKSTGRVETTSRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWK1	Uncharacterized protein	1	691-711	VFSQVWLRRRRPNIYNKYNYL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY13	Uncharacterized protein	1	45-65	IAPGTKTEKIQRKSYRHCETR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q190	Uncharacterized protein	1	690-713	RVEDSPPRTRGKKRKQNEDDGGEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2E1	DUF202 domain-containing protein	1	2-33	RACRCQCQRACTSPRKRCGPNRRRGVRANADS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2E9	Bromo domain-containing protein	1	581-609	GPAQSWTSTKKRSKKRRSHARDRSPHSVA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q311	RRN9 domain-containing protein	2	277-298, 543-568	LALHRSRQGRRKERKTSGSRTT, IGRSSDHRAKKLRSRSASRARARSTS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4M3	Uncharacterized protein	1	65-84	QTYLDCTKRVKKCTQRQWFI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5E2	Uncharacterized protein	1	243-265	RAQLRRQFPAKKRHRTQWTPIDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMM6	WAPL domain-containing protein	3	4-28, 66-88, 122-142	ATVSPNPQSRRRKPATYGKASRSHN, EAKSNAPKPVKQRAKKQDAFDVP, ELAPWEKRRKQVTRPNGDSAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKL7	Glycosyltransferase family 90 protein	1	72-92	AAQYRSRRGRHPPPGFDKWYE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN84	Structure-specific endonuclease subunit SLX1	2	102-124, 307-327	MTSRISPKTGRVRKRSARPRLSL, KEFKALFKPKRGKKNAAAKSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK2	CMP/dCMP-type deaminase domain-containing protein	4	61-88, 139-161, 220-247, 303-324	DGDAVKQLKDKLKKKNQQQQDIYQPQRQ, REKPCFKLPRSDKRKARLQRDVL, HHQNRSQSGKEKKKGKKKENRYGYQYQY, PGHPAVKRKKDYKRSGKMRSGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH37	Uncharacterized protein	3	22-42, 177-202, 589-608	TSPAKPPPKVTYGKRNKPLLL, SEQTAQRKSKPKSKAKTSTKSKRGDA, APLPRPHRPRSILRNPSSCF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH78	Uncharacterized protein	1	77-98	FHLHGKRTRRGRMTNRVRVRLP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHK4	Ubiquitin-like domain-containing protein	1	75-109	GGMAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHR8	Uncharacterized protein	2	25-47, 64-86	NANGRAIRKCRTRQRDSPFEDSA, EVIPVAPTRKRKRSPSPEDSLPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIN6	Zn(2)-C6 fungal-type domain-containing protein	1	21-59	AEVDDFLRKKRKAREHKACYPCRQRKVKCDLSRPCQTCR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKN8	Uncharacterized protein	1	120-142	LMPPPPSTRKTPKRTPLRPSESA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL03	Uncharacterized protein	2	273-300, 326-346	SSKVSSSSQKKHKCKICDKRFTRPSSLQ, VSNLRRHRKVHKGEGHDHPSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLD6	TRP_N domain-containing protein	1	610-636	AIITCVKENPHRKKRKEQEKLERDLDN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS64	Uncharacterized protein	1	173-199	RVSGIFSRRLRKRKKNQRSRSASPSSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTG3	Uncharacterized protein	1	310-332	TGDLHKKELRFRNTKRPKMRCLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYM2	Phospholipid-transporting ATPase	1	30-59	NRMRWATVRKTGKKGAQKRKSIFNRQVARL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ47	F-box domain-containing protein	1	109-130	NDGERWQKLYRRLRTQARIFTW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q036	Uncharacterized protein	3	468-487, 516-541, 705-724	REGDRERQIRRQRRETARFT, DDERMGRGERAKKKRRLRSLSPVGRE, ITEPRERKRLQNIINGRKYR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0P2	Uncharacterized protein	1	90-112	LLGGTIKRLGRKKSKQNIEDDWD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q335	Zn(2)-C6 fungal-type domain-containing protein	1	42-68	AHTLTACTRCRQRKTRCDPGLPRCTPC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4J3	PUM-HD domain-containing protein	3	10-39, 111-133, 647-671	KEAPSEARKSDKKQKTYDPKLAKAEKQRSH, AKQLWERLRRKSHVPKDERKELV, EGEKGVKQEKGKKAKKLQGNAGARI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XM41	SUN domain-containing protein	1	907-937	PILDSQQSSPERKRRKRPKKPQNWPQGPGLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y076	Uncharacterized protein	1	12-37	QQQPIPKRTNCIKIRKKRIEPDDFAL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YPL4	Uncharacterized protein	1	65-86	DPAGNARKRKRELPPSRYNFRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCU6	Uncharacterized protein	1	21-43	VDVFKKFRESQKRTEGRRKKSGV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCU8	Valyl-tRNA synthetase	1	88-113	AMSAASQPKQKEKKKQEILPPYKEET
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD59	Uncharacterized protein	1	44-66	ASHSHRIGPRKAKANKKSRVEDP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEK1	Uncharacterized protein	1	107-133	VLDILKKEAKRRRPKRKKKFDMATAIN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ42	Uncharacterized protein	2	19-39, 46-72	NLERHLRSRHRAAHKFVCERC, SDVRKRHAERCARGLHRRRPRTPVADH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKJ6	Uncharacterized protein	2	7-33, 188-212	TTSESLFRSAKRRKVFRKRTTDEDAPE, RAQARADRTPQKQRRRQPQIDPSAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPX5	Uncharacterized protein	1	520-539	LVYGRWYKRKATKNSKEGEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR72	Serine/threonine-protein kinase RIO1 (Fragment)	1	503-552	KEKAPRGKRFEDKGIKKAHKQAVKEEKRERRKEKMPKHLKKKLISSSSRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW34	Uncharacterized protein	1	261-289	TKAVSVRSSPRTPKKSKKWRDVVDENDTI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXA6	Uncharacterized protein	1	278-299	EGDRKDRKKLGLPRRRGGAKKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXF0	Zn(2)-C6 fungal-type domain-containing protein	1	3-40	GQGTGPSRRSHTKSRKGCKTCKRRHIRCDETIPQCRNC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY15	Zn(2)-C6 fungal-type domain-containing protein	1	1-27	MDDRAPNKRQKRRAVACERCNKQKIKC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZK0	Uncharacterized protein	2	2-29, 595-614	ASVTASRSQQPPRKRRRKTAAGAADDCF, TPASHPSSLKRKRQAPRSLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0C3	HD domain-containing protein	1	209-229	KTETGKRLARERTQRLKEFRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0R7	BZIP domain-containing protein	1	155-174	TSEPTTKRKAQNRAAQRAFR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1P9	1-phosphatidylinositol-3-phosphate 5-kinase	3	571-599, 1841-1868, 2351-2370	ISLSRRPRSSSHRRRHSRHQPGRGLRASF, EQLSREFEKKRQEDRKQRATRSRQARAN, KDRGKNKPTITSPKDYRNRF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2U3	Zn(2)-C6 fungal-type domain-containing protein	1	42-72	GQVPKPKRIACVLCRKRKLKCDGSKPSCGTC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3D7	C2H2-type domain-containing protein	3	33-68, 80-102, 143-162	DDYRADPYRDGRRRSPDRRRGADRERRRSRSPAQID, AYGSRRDDPRERRRSSPQPIDRY, KEEKERTKSGRPPRLRGERE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y2	Uncharacterized protein	1	48-70	TIVACPRRRKSHPKNHLSRHDPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q552	Ribosomal_L18_c domain-containing protein	2	8-36, 274-295	KNSAYFSRYQTKYKRRQAGKTDYYARKRL, SKKFRQVKLTHAERKQRVQEKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q563	Uncharacterized protein (Fragment)	1	40-65	ELQNIIRNRFKRHRHNTSHRQLKICF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNN6	Uncharacterized protein	1	263-287	GVETRKERNRRLSLARFGRKKRDDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y420	Uncharacterized protein	1	106-129	CQMPTYKCRGKGRVKNFQPKIRPL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJ08	Uncharacterized protein	1	62-81	VPSPKRRRRLVGPQRTRGRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL93	Uncharacterized protein	1	20-54	VISPASHCKHCKHCKHCKHRKHPRREKTDIRQGMA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLY8	Uncharacterized protein	1	506-528	KSNFAQKAKKWFTKKRGRSLAIP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNI1	Uncharacterized protein	2	57-81, 127-146	IVILVVIRIRRRRHRQAIVELEQRT, QVEHTNKRKRSQFLSKRLAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC93	C2H2-type domain-containing protein	1	91-110	GCDLRKHYKRHTKTLFCRTE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDQ3	Uncharacterized protein	2	281-303, 758-777	IAYEQLKRKVKRKKYRTLEEFMA, AEKARRQEMVDKKRKEREVD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHI0	C2H2-type domain-containing protein	2	397-416, 660-680	QSGPARPRGRPPKNREREAN, TSDLPARPRGRPPKNPQHVGM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIR5	DNA helicase	1	2-33	SSPANRRSTRSSANNTPQRRNQRSSQAPRSSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIZ7	Carbohydrate-binding module family 14 protein	1	133-162	NKPVAKPVKRPVKKPVKKKGGKKQGSGGTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKF7	Uncharacterized protein	1	462-483	LGAPKARAPKKLRKGKTPAMLW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKQ3	BZIP domain-containing protein	1	57-76	QSKPAKKRKSWGQELPEPKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLL2	Uncharacterized protein	1	39-60	ERMSLTKPGKWRKVRNSSAHEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLT5	Uncharacterized protein	1	269-290	RPGMLQCRRSKIKRIKTVLLHT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSK0	Phosphatidylinositol 3-kinase VPS34	1	159-181	SNTTTPWQEPRKRGRRGQAEEPV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSL9	Uncharacterized protein	1	518-542	TTNDEPAPIKKKPKKLVRPTQAGAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW71	Uncharacterized protein	1	3-23	LSSLKRKANSPPENPPVRKKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWN5	Uncharacterized protein	1	17-43	NRGRVGGKFKLRGRKHRRETELQREAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXW3	Uncharacterized protein	1	644-669	PDLLWHWRRHAPKRVRYKTPTGYVKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY95	Uncharacterized protein	1	104-128	AESVLAAKRRRRRNGHRGDHWRVGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYW0	BZIP domain-containing protein	1	110-129	GASARFRQRRKEKEKEASTM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZF7	Phosphatidylinositol 4-kinase	3	55-78, 85-111, 304-334	LPSGSHSPARPGRRRRANSGVDIK, ERWADEIKDRFKRRRVKGKTSEEEQLE, QTSPNHSNTPSQKRRRRKRWDETCRPKSRTG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Y9	Uncharacterized protein	1	32-57	DGTQEPKKVPSPRRVYKPRYAERDMV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q582	MAGE domain-containing protein	1	299-323	AQQAGRSRKASKRKARPQEDDEDEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJB9	Uncharacterized protein	1	247-269	ADSNVHYRKRPFRPRRCKPDLAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLS0	Maintenance of mitochondrial morphology protein 1	1	460-482	READERDRRKQLRREDSSLRLRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLW6	PPIase cyclophilin-type domain-containing protein (Fragment)	1	190-209	KEEKTGVKKRKKPMGKQVLS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCL0	Glycoside hydrolase family 3 protein	1	2-23	TTLRHRSMPPSNRLRREPRLSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD49	Component of oligomeric Golgi complex 3	2	10-31, 78-97	TSTPALAKEKPQHRRRASLLQQ, ASTRKECPLRRRDSLTERRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFN6	Uncharacterized protein	1	407-431	ESSGPGRRDSVRRRRGRQGGSGAKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PID7	UDENN domain-containing protein	1	805-830	GGDEEKRESKKKRGKRPVTNLVPESN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP94	Uncharacterized protein (Fragment)	3	3-22, 972-996, 1065-1084	ETAYGTRSRNRTNTRPNYAE, LVEPPKVSHKKKTDREREKERLEKE, EEVCKFCKNKDHQGRIKSNA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRW5	Zn(2)-C6 fungal-type domain-containing protein	2	37-61, 601-620	AQACQTCRSRKSKCDEQRPNCSLCR, FWPVCMAPPKNKKRLVPHLF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTY9	Uncharacterized protein	1	104-131	PSCGSNIQPKDPKRKPKRNKTSDMMIVC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU77	Uncharacterized protein	1	242-264	TEEVNKLRKGKKEQKEQGTQAEN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV25	Uncharacterized protein	2	1-22, 820-842	MVGRKPKSTKRKINSSDEDTDD, GLGKVRYKYRPPEDVRRRQFCTM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWU6	Uncharacterized protein	2	17-39, 71-91	LSPAELKKRAKAEKQARRAAQKE, GGPAQQKPKGEKQQQQQPKGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXH1	Uncharacterized protein	1	1192-1213	ANTQKAKKLGFFRRNRKVDPYA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY81	Uncharacterized protein	2	54-80, 200-222	AREGRSSYRQPSRRPRRHRSSSSYSSY, YKEQQEWRDAQRRERRRRDDRHS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYP2	Uncharacterized protein	1	583-608	GFPSFAARARPKKRKTPKQGLEDFLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0H1	Ribosomal RNA-processing protein 36	2	248-268, 288-322	EQEIIRKHRREERNKVQEGKT, DMKSKDREKLIEKRRKKEGQKEKKRMPQARRIVGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0P0	ERF-3	1	636-663	GALLHKLEPKTNRKSKKPPGFAKQGMNI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Q7	Uncharacterized protein	2	56-84, 87-123	SNSHRRYTPARSSPRPSPRHDQQEHRPVV, GSRQPAPRFSPQQRHPPRANRSQKRPQAPRLPIPRMV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKP7	Uncharacterized protein	2	34-58, 222-241	KASITKSPSTKKQKIQSSKKEATNA, PSIPKGQKGWGKKRQLNLDS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKP2	Uncharacterized protein	1	117-148	HNLPGPNNARNQRKRDRKKRKLNTMRDQVAQT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2C7	SRP40_C domain-containing protein (Fragment)	1	25-48	VTRGKDFTKEKNKKKRGSYRGGTI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2M4	Aa_trans domain-containing protein	2	361-386, 673-692	DSALLTPGKRRRKRKHRTGGNGTPFG, RTGKYNPWIKWKKNIFRFFM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBG6	Vps8 domain-containing protein	1	1410-1432	TLRQRGWRPRTQVCERCKRRAWG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDV0	Fungal Zn binuclear cluster domain-containing protein	1	49-73	DGIRKRVCKACDRCRLKKSKCDGSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE15	tRNA-binding domain-containing protein	1	224-250	AVPTEKREKSKKEKQPKPPKNAPAPDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEC6	Uncharacterized protein	1	263-285	LPQPSSPQPRRTRLRRTVSEDTS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGW4	Uncharacterized protein	1	170-194	RLANTQGKKAKRKARERQLEESRRM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PML1	Protein-tyrosine-phosphatase	1	493-513	CERGMAKVKNQRQKLFRNQTF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMM5	Uncharacterized protein	1	491-530	QNEWKFLKKKKEVKPEPADKRFRPPSPKRKAQPSPRNITS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT20	Uncharacterized protein	1	17-39	RRYSASSTTKSRRSRRNVWMALL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU55	DNA-directed RNA polymerase subunit beta	1	1206-1230	IASLKKQQFECRPCKNKTRIAQIII
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVH5	Uncharacterized protein (Fragment)	1	37-58	VEDPRRPGKLKKVKKQIPAYIP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVK8	Aldehyde dehydrogenase	1	20-44	TYATFKTKDIRWRKWQLKQLWWLLV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVL0	Uncharacterized protein	1	56-79	MMNLLAARRPRRRRNHWHSHVHLP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVT5	RNase III domain-containing protein	1	31-53	STAHETRPRRDIRRQHLPSQRHS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVU7	Uncharacterized protein	1	431-459	EPPKMPSLLRPTPKRQRSRQGLLKNQAVQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWA6	Uncharacterized protein	2	1-24, 105-124	MDIDDRPYKKRRFFAERRSPNDAS, ASPRKKSVDTKQSRLNVKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWQ9	J domain-containing protein	2	58-82, 650-674	ADIIAGQRSKQKRKELRLKRIITAA, QPTADPDKPVRNRKLKEKIAQEESD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXG3	MFS transporter-like protein	2	3-24, 621-641	HPTSNLARAKRERKLPVQQLSI, DSANRTLSRRNSRRTMHKMSI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Y7	Exonuclease domain-containing protein	2	58-86, 521-544	GEWQTVESNRTKKRKKLPKKDGNYPSISH, ESVFKRLSRSSRPKRDKVNPSGED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2M5	ELMO domain-containing protein	1	267-287	AANGVKPRKHHPEKWRRLGFE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2R0	Uncharacterized protein	2	17-36, 46-70	REVLGRTRLQRPPQPQCRGF, TSDDVLEKKKKKPYYWKHCNDGERV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q537	PHD-type domain-containing protein	5	237-256, 260-282, 572-593, 599-626, 676-704	DREKKDKRGTTPRPRSHTPR, SEEERERDRKNPKPRGPRAPGQP, AGPSTTKSGRRSRRPAHNVVIT, DAKVGISKRKAAPKKKKKDSVAPPDQPG, LTGMPPRRTKWYCPDCRKRLKLGTGTNGL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIE6	RRM domain-containing protein	4	7-40, 78-103, 206-229, 236-259	TISRKEKKALRDAERAKSKGKKRKHDETIADDEA, TDVAPSPSQSKKRKKKSPNTTTTNEE, NNSGGGRRGQRKKKETARRINVEL, NTGARKEKIKVKNQRLQEQRERRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKI2	Uncharacterized protein	2	287-311, 821-852	DSGAGQKRSSKHRKHWQDTRPGLKA, AEMARRAENKRIKDEKKRQKEEEKARKAEEKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHC2	Zn(2)-C6 fungal-type domain-containing protein	1	1-37	MSYARVKRTHRKSRLGCLTCKQRRVKCDETRPQCLKC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHH3	Uncharacterized protein	2	66-91, 257-276	TVLQAQCRPTEKKKCKDWIKIDSLQQ, RTPGRISRKHLPKRPYPRPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y349	PALP domain-containing protein	1	1-23	MGAQRLKTPPKQRPWRETPLIES
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4B1	THO complex subunit 2	3	1-45, 2079-2098, 2228-2248	MAPSTNKRKRPDRQASEDDGSGRPSPYRPEKSRTSRRASQGKDEA, SANERQRRTERQRNSINATL, PDDNRDRRGPRDDRRPRDQGM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCV4	Eukaryotic translation initiation factor 2A	2	529-555, 589-611	DENLSKTALKNKKKREAKKAKDAEAKT, GHQNSRPQSRRRDGSRQRGPPVS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCW2	Uncharacterized protein	1	67-89	LLQPCSDKTRHRHRHPLRALHVR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD25	SprT-like domain-containing protein	1	29-53	AEDSDRPTTTRRRRVRRISSDELSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQZ6	Uncharacterized protein (Fragment)	1	92-111	RPKPVFKPSKPLRRRPPPTI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR24	Oxidored_q6 domain-containing protein	1	223-242	IFQLQKKMRHTKITRMWYRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR56	Protein kinase domain-containing protein	2	93-120, 713-747	ALREDPRLPKARRRWRSRLTGNSRRGGH, YSDDIRKRQKKALHDHHPPKTKSPGKTPTKTKTSL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRE1	YL1_C domain-containing protein	2	140-163, 543-565	EDGSAPKKPKKKSERSDWRPTDAD, SRYLVNKKWKKEFPPPPEKAKCA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVI5	Uncharacterized protein	1	60-87	SSNVTPLPRRPSKQQQQQQQQPRQEPAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVW0	Uncharacterized protein	1	222-243	GEGRPWRIMKKEKEKEGQTKTL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWN9	Uncharacterized protein	1	4-24	RGTLQRKHTRHSSARKQAAKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ27	PH domain-containing protein	1	40-61	WLNSHRKQWYRQYVRSTAKRQP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1B7	Uncharacterized protein	1	112-135	EKEAKQFKKKMDEREKNAHKNTRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q505	Uncharacterized protein	1	643-664	GPSGSTIRRKRAPRRRIIELSQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q531	V-type proton ATPase subunit H	1	34-56	DEDLKKIKAIDKVRKEQRKATIE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5A8	HECT domain-containing protein	1	39-64	HTGNTNTSRRPVRRPKPRTARATALC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y517	Zn(2)-C6 fungal-type domain-containing protein	1	8-67	LPPPSQLQSPRPAKRRRVDRVTAACDFCRQRKAKCDGRSPCGYCQRKKRPHTCTFSAPDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDN1	Uncharacterized protein	1	238-266	LPNHKALKHGSSPRRRNLRRLSDSRPEGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDW2	Uncharacterized protein	2	11-40, 68-87	GIDNCWRPRQDRYRRRPRRNTGPEPPRITE, SPPASPTSKRSPMRRRQTIV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEE4	Uncharacterized protein	2	61-83, 181-207	RKQAKLCKAHPSRQARRRYICLV, DEVASKKKQEAKKLPRRKTPLTHPTKQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFN5	Uncharacterized protein	2	413-436, 473-495	GSRVDDWNKWTRRRRWIRDAELVE, STAVKKKGWFGRRRLTNEKIRAI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPG6	Uncharacterized protein	1	246-266	QPQRRTARYRSPPPPRPRSNT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ78	Uncharacterized protein	1	722-747	APHFETRPGKRKWLERNKRSRRADSL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQE1	Uncharacterized protein	1	25-51	TTSQRYTVRPSERRRNKKKLSISHYTC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSR2	Uncharacterized protein	1	21-44	LHQLSKRRASSQSRKKNANTVQWP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTH8	Uncharacterized protein	1	305-325	GWQPRRLRRSRDHTWAGPKRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWW9	C6 transcription factor-like protein	1	21-47	TGLHLACRECQRKKIKCDRTYPCGQCT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY43	Cyclin N-terminal domain-containing protein	2	402-425, 468-516	EVPIPRARSRSRDRDRRRDAPIDR, GDRDRDRDRRYDDRRDDRDRDRRYDDRRDRDRYRDRRDYEDRRRPRDER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY59	Uncharacterized protein	1	64-83	DTVRDFRKKLGERVRNNARY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZA0	Zn(2)-C6 fungal-type domain-containing protein	1	36-73	TLGSPERSEKRRKVTRACDSCKGRKRRCNGQLPCQSCQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0N4	F-box domain-containing protein	1	697-722	AGVIGAGQRRRRRRARDAQLRHADEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2J6	MutS protein homolog 3	1	16-43	DLEDDARPSKPKKRSKPTASSKAQSIRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3V6	TGc domain-containing protein	1	450-469	QEEHRLRLREARRNQDQQQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJM5	AP-3 complex subunit delta	4	761-781, 938-963, 969-995, 1003-1026	RESLLRKKAERRERYKDDPYY, DVPEEGTIVKRKKKKKSSVEFADEPA, NGEEGGAVKKKKKKKRKEGEGESAEPL, GEAQHVAPTKVKKKKKRQVTFDEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKF4	DUF1996 domain-containing protein	1	482-503	APGYDSKHKRHLEKHQHRHARL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNQ0	Pre-mRNA-processing protein 45	1	393-413	DRDRREREQKRADQRNEERRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YPU0	Protein kinase domain-containing protein	1	242-263	YSTGDKDSWHRHHKNKFPQEFW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC24	Uncharacterized protein	2	61-82, 218-242	LSTRRRRPPTLHQLRAKQRRPT, SRCCNYRHSFAKTRHPKRRDDVLEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEW0	Uncharacterized protein	1	574-601	DSISCVDLSKRRRKHHSSRRSQTGSEKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL29	Uncharacterized protein	1	536-560	AFLPKTISGKIQRKKLKQLEWETVG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL46	Uncharacterized protein	1	479-511	IKTNETKRRIQAGRNRGWRKERFQPKRYQELCE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPW6	Uncharacterized protein	1	979-998	DWTRPNTKKAKNVRNMCQLN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ95	JmjC domain-containing protein	3	583-606, 865-886, 1260-1281	DGVVKKIQKKKSKTWLKNNVPCHV, TESALRPFKKRRRSGRDGDDDG, NGSGKQRSSTCRPRGRPPTFSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS88	Uncharacterized protein (Fragment)	1	45-64	AECTKKRKTQHGREQTPPPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTR2	Ras-GAP domain-containing protein	3	33-59, 156-178, 1432-1496	MLQEKENRRQHRWTHDKFRKKEPTLYD, SPASSTSRSRRASKDRHRTHSAW, LPSYEREVRHRERREQARVQIQKQIEAARVKEKDKEKKKTSTVHHLVPKLKKRTKYREENANAMA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY70	Uncharacterized protein	1	124-143	TDLPRWRNARHNKKAGPIED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZN6	TFIIS N-terminal domain-containing protein	1	143-175	AEEEEEHQRKKKKKEKKREKPKRRRAGADEDDF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q162	Poly [ADP-ribose] polymerase (Fragment)	2	15-34, 78-100	ASPVSSKRTRGRNKVAEVNL, VAPGQPKKAASKRKVKAEQDQTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGG2	Uncharacterized protein	2	73-93, 372-398	SSTGHTKRQLRSCRRTHDQSN, LPGKALTCKWHHKCKQCVITRRHGPVI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKW5	Uncharacterized protein	1	260-283	EEVKAFNQARKEKKMKKRMAFYKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XML2	Cysteinyl-tRNA synthetase	1	763-793	AEGKEVAKSKSKKLKKDWERQKKLHEAWQTT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y489	Uncharacterized protein	1	218-237	RFAAWRKSALRKARNVERRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIF9	Uncharacterized protein	1	229-255	WVIFFYRRIKRKREERRRGKEEKEETV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDF9	Uncharacterized protein	1	2-21	AENDEKGKKRERDDDPRGKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF05	Uncharacterized protein	2	192-211, 222-241	FIPTGPPRKKRRSSLSDLKS, SPDRPRQPSPQRPSPQRPPL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIP1	DNA repair protein REV1	3	112-131, 936-962, 1035-1054	NLTPKKKEEFRRYRIVKPAW, RTLPPMRQAPPKRGRGRPRGSKNISNL, LSLHQRAKNARRKKGEDAGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS73	Uncharacterized protein	6	301-329, 429-455, 476-506, 1120-1149, 1238-1268, 1339-1393	APGTPEPKPTSRKKKMGKGAKNKKKMIIV, ESTPPGSKSKKKKGPSKQPKDAPCPPF, APADLPKEKSREKKKKKSKGKSKEVRSPPII, RSSGSRHKADHWKRDHRKRGSSDSKKSSDK, AEAIARKEAERRRRHREVREIDRPRPRRESK, GGSSGHHRRHRHYRTESDRPEPRRRDSERPESGRSDEKRHRRPAAPEQKPKSFLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSL3	Uncharacterized protein	1	594-616	DAWKGSSKRYRCHQCDPYAHRVV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV28	Uncharacterized protein	1	455-476	LLGWLQQRKDRKQARKRLEEGF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV80	Aldedh domain-containing protein	1	55-78	EAAHKAFKSWKKTKPSQISQILNK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX08	Glycoside hydrolase family 16 protein	1	18-39	WDDDRKFKPTLRERFNKDNVIN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX85	Uncharacterized protein	1	173-198	VVEKEPRRNLFKRRHKPSHEVERTNA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZX4	ABC transporter-like protein	1	690-711	SLLRPKGKRKTSIRQQQERQLF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0T9	DAO domain-containing protein	1	42-71	QIKTCKCKICDERVKKFCHRCKSCGRRICS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2X3	VHS domain-containing protein	1	50-69	AARALRKKLKYGNAHRQIRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4N4	Uncharacterized protein	1	51-71	LLDPKASKTKHPREHSWNATG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDF2	Uncharacterized protein	1	45-72	CRERLHRMRTVCNKKWRTKDNEEKLYLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE64	Uncharacterized protein	2	13-34, 42-69	AKKESSRKAKSGQPNRKRFSSP, LESIGDSPKRRPKKRINRGPSSSPPPVK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEA6	Histone H1	1	205-231	EKKAAKPRKSAATKKATPKKTKTPTKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFY5	Uncharacterized protein	2	21-44, 69-90	LPVIRPVRQKIRDHKRRRDVQEIV, SQFPRSSSLRWKKRKLTTPMSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGF1	Uncharacterized protein	2	235-255, 261-280	IQLDLKKHRKRVQEAERQLEE, KEYQEKVKKRHTTERDQEEF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHK3	Zn(2)-C6 fungal-type domain-containing protein	1	2-25	RSSIACIRCRRSKVKCVNNGVGTT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHX9	Uncharacterized protein	2	1-29, 35-54	MARTKPKPISKRSSKRKPQAEKTDYSKEK, AEFKKRGLPKPGRVNKNNLI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJA5	Zn(2)-C6 fungal-type domain-containing protein	2	5-25, 52-75	GRPSRGCQACKTRRIKCDETH, VSPGARRKTKSRSRKGSHDREGGE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNC4	DNA topoisomerase I	2	179-198, 208-228	EPIAKKKAPAKKQSNGTAKK, DKPLAKKKAPAKKPALKKEEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQY8	Zn(2)-C6 fungal-type domain-containing protein	1	47-74	RSPTQPTTRVRAKHRRSRNACQECHVRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR30	Non-structural maintenance of chromosomes element 4	1	112-134	AQDPEQRRQVKRKSRALEREFNE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUL7	BTB domain-containing protein	1	15-40	SFSYKPEKSMSKKQRSFKEYPPTRRI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWC6	Uncharacterized protein	2	42-63, 69-88	TSNGQFPPPKTDKPRPHVCTTC, RLEHLKRHERSHTKEKPFEC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q079	C2H2-type domain-containing protein	1	40-66	ECDKLFKTEKEMKQHKHKEPDHFYCSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1D3	Uncharacterized protein	1	455-476	VVKAQKTKPSTRPDQKSNWSHG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q488	Uncharacterized protein	2	185-204, 353-376	GTSVDRQTKKKSKRDPDIAV, EAEAKEERRRRRDRERAEEAERKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4A7	Uncharacterized protein	2	86-108, 111-133	GDDTPKTKGTPRKRGKKVTDEGD, GESPAKKAKTAPKKRGGKKAAVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4R7	Uncharacterized protein	4	8-27, 51-76, 152-177, 273-293	SFDAHPRIPRDPRRSEPRDE, SPYHCPPTPTSDRRRQPQTSPPHTRR, PPTSEDERSRKARRRPSKLTINGDGR, HFDSRRPPPRGKKMTDQPRSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKR6	Uncharacterized protein	1	228-252	RYDVKMEEAKRKKKERASFASSRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNP1	Ribos_L4_asso_C domain-containing protein	2	186-212, 313-335	KNSRKLRAGKGKLRNRRHQQRRGPLII, GAVSKRTVVQKKNPLKNKQVLLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIA9	Uncharacterized protein	2	617-636, 722-742	ALEKRIRRAHARARDKRESE, AQTFRRCSRRIDRWQETNHPG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLC1	Uncharacterized protein	1	266-285	STSQRIRGEQRGRKRCARGW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEL7	NUC153 domain-containing protein	3	35-57, 464-495, 577-607	FTDKEFSKKAKVDRYGRKIKPET, EESTRERYIRKEKERKQKRKERMKAERNGADA, EIEKAQKEAKRAKHNKKKGKREIERVQDDFK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNS0	Uncharacterized protein	2	64-89, 1193-1239	RYRTLKTRAKLLDKLRRKGRWNWDAE, EERVFSGSRLNKRERRRHHHEPTSEQVNEYKKKWKSYRSRMRWALGV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSG5	Uncharacterized protein	2	10-34, 123-147	PTSISSKSHRPTKKRALTPSTQQSA, DEKLSKNRAKREKVKLRAQKKKAGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSG7	Histone acetyltransferase type B catalytic subunit	1	383-406	AANRSRSRITKREKAKNDNDRAYF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTK2	Protein kinase domain-containing protein	1	633-653	EEQAHRRARRQNRSDIRGRER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW33	Uncharacterized protein	2	428-449, 471-495	LDRDRDGLKKEKKKLKVADEYV, LCNACGLRWAKKEKKRSGDDIKMSN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWX6	Uncharacterized protein	1	134-155	NDAAKEKKKHWWSSSKKKDGTS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZL8	Uncharacterized protein	2	459-490, 656-678	CSGPIKRPKSRGKNGSPRRKEREERVRARKMR, NSNHSSPRSKSPRRHQTDDAPPL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2R7	Uncharacterized protein	1	34-57	VSAPKTTRKALRPYKPRQSLKPGT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3W7	Deacetylase sirtuin-type domain-containing protein	1	339-358	SKLALPPQKRSKSKNRNSSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Y8	Uncharacterized protein	2	41-60, 92-117	TPNRSRPKTRDDPSRSPLFG, RLRIAQKSAAQKRKKQATERRPQNEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5B1	Protein kinase domain-containing protein (Fragment)	1	410-437	VGKPRVTVSSKGRRRRPSSKTLSQALKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGZ5	CFEM domain-containing protein	2	171-206, 225-297	HQGKKQQKEPHHKKPTHKDPHNKKPHHNKGQDKAPQ, PQYGEPQHKKPEHKKPEHKKPEHKKPHHKKPHHKKPHHKKPHHKKPHHKKPHHKTHKTHRPHKPTPYPPPYQS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XZI2	Uncharacterized protein	1	137-158	PTISRSSSSGKKTRKKRQCSVQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJB1	G-patch domain-containing protein	1	3-30	ERATYRPPRSDYRQERERKSDRHQSSND
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJJ8	Uncharacterized protein	1	29-55	NEVLCPNTNKHNPQKYHKSCLRQNDGI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC72	Polyketide synthase-like protein	1	1654-1676	PTAVTATKKPKQRKATPPQASGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD21	Uncharacterized protein	1	6-25	KTTTKKPSLLSRLRNKNQAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD28	Uncharacterized protein	1	1238-1262	DLIRSFSTRTVKKRPDRTTDEWLAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF32	Uncharacterized protein	1	240-263	KIMTKVRRQRIVKQYQRQHREKGF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF99	Uncharacterized protein	1	1-20	MPISKKDRVRKEQKKADAAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJE5	Uncharacterized protein	4	8-37, 175-200, 453-473, 489-509	LHKMEPPTTPPRRTPRSNRARTPPSPRHGA, DPNDVMPTRRDKRKQKPARNVAAQDF, AVPPTPQRTTRKKAAERNLTP, SPSSATRRKTRSPFDDWPRTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJS2	Uncharacterized protein	1	285-304	PDRLPAKRPQCKPHKADKAY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL96	Uncharacterized protein	1	151-171	AQCQYERKYKKSRQYATEKEL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLS8	DNA replication regulator SLD2	4	61-85, 326-359, 397-420, 435-460	EKCALPPRQTTPRRNTRQPETNRTL, PDEEARARKPWKKKGLKRQTRRTNMKPVLHKAKK, LDEEGKSKIKKKQASKKTKAATDS, HANYRALKIKNKNSKGKGGGRRFGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNN2	Stn1 domain-containing protein	1	175-210	RKEQERARLHRKKQAKYDEKYRQKRAAREEKRQIVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS72	Uncharacterized protein	1	25-44	RYAATTPRRRHESKRWQSTE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSM6	Uncharacterized protein	1	110-136	IGAAHLNERRRERRRRKEQLEEDDSSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTH2	CID domain-containing protein	1	409-432	GGSSSDPRLKRRKLSHPSKDVDDE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTV7	Uncharacterized protein	1	783-803	ITLFGPIKRVSRKRKEFADVV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTV9	alpha-1,2-Mannosidase	1	113-132	ASGERDKKDKRDPLRDFQDG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWP2	Uncharacterized protein	1	70-89	EKEARKRKSLREWDRLQRES
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZR1	Uncharacterized protein	3	342-366, 987-1019, 1029-1056	SAPTNKRKRDTKAQTPVKKQRQEKD, GEPVVKAEKKKGKLSNKEKKRLQDKDDRREGAQ, VGKARDEKGREKQAKHKSKPKPKPKGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1C2	Uncharacterized protein	1	138-159	WKEANKKYKAYRDEKRRMEQET
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Z2	BUD22 domain-containing protein	3	45-65, 155-177, 321-344	GKGFERQKLGRRKKNAVAAKD, KEDSKAPAKKRRARAKDYENSNR, VDVAPKKNRRGQRARQKIWEQKYG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3T4	HECT-type E3 ubiquitin transferase	1	2983-3005	SEQAERRRRDRDDARRRERDQGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Y6	Pescadillo homolog	2	36-63, 638-688	LCIFKGIYPREPRSKKKVSKSSTPSTTY, EEVERRKMMMPRRKRKTYEKMVYSNARKDEESEKLRAKRRRIEKGATTQKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y088	C2H2-type domain-containing protein (Fragment)	1	391-415	SGDVCTRIVRRSRSRRHASRYTAAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0A3	Uncharacterized protein (Fragment)	1	302-321	RQLTIAKKRGKDPKLRAEEL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLP3	Uncharacterized protein	1	154-178	LPLARPPRRVRKKPAGQLKQKERLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMB2	Uncharacterized protein	1	93-120	VLVKVTVPKRTGRKRKRGSREPYCEVEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCW8	RNA cytidine acetyltransferase	1	59-90	YKNKLLGFTSHRKKREKKIKKEVKRGIREADT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDL4	Uncharacterized protein	1	10-31	SPEGYKRRRLDSPTPPRRRAFS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFE7	DNA polymerase II subunit A	2	1269-1295, 2305-2324	YTGWLKYQKKKWKIQRAARTRRRQLFG, LGRLQMRKRKWYECNGRNDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGJ0	DNA-directed RNA polymerase	3	40-65, 551-570, 1085-1111	SQSSARLRQRSPSRTRKLSRISESHH, DSASKKKKGRSKETNQQILS, KSGKVAAEPAKKKRRTKKEREAEAAAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH81	Uncharacterized protein	3	187-207, 379-405, 415-436	GHRRCTDCTRHPPKRVKQISD, APMVRTVRRVYRKPRQRVRYTCEHCYT, ECGHERCRSCHREPPKRAPVVH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIR9	PHD-type domain-containing protein	3	152-174, 529-557, 794-815	APTANGKKKERATRTRAVKRKSE, STPRVWQVKPKPKQRAKTKQSPEKKQQVA, LLNRHHRRTVHLRKPRVPKVQE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJS0	Leucine carboxyl methyltransferase 1	1	25-44	NTLRSRGPRLRGRRGGPRGT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKG9	Uncharacterized protein	1	64-98	VVAAKRVTRKRKAGDDKAATPKKKKRNESLFSNEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLB9	Zn(2)-C6 fungal-type domain-containing protein	2	1-20, 615-637	MPRPKVKPQDRQRSAKACLP, ILLRREQLARERRKKSDRFVSQI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR73	Uncharacterized protein	1	33-55	QVQPDRIRIKNRRKRYLDLHPEY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRH5	BZIP domain-containing protein	1	432-458	LERNRVAALKCRQRKKQWLANLQQKVE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW84	SurE domain-containing protein	1	256-277	AAPPRRNSWRHRHFKWAPRFTD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZK6	Uncharacterized protein	1	26-49	LPSLACCRRRKVKRVWNALRWKAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZM8	O-acyltransferase	1	74-96	KATSAARRANRRATRRRIFPTVD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZQ3	Uncharacterized protein (Fragment)	1	108-141	DDAGSRRKSYAHKKRLSRRQSVRSVRSKKTKSLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2J0	Uncharacterized protein	1	195-219	LSSWMKVQQRLNRRRQRSLLLCFRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3T9	Uncharacterized protein	1	726-748	QRPPAERERDRSRQRLNERSAED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q477	Uncharacterized protein	1	603-625	GETAAEKKRAAKKAKKEAEKAEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4B8	SLD3 domain-containing protein	2	16-37, 314-342	QIDAKPPDVVRKRRRDEQEAFA, VLEPHDPKPQQRKKRKWKAKRDKTGLFID
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGK0	Uncharacterized protein	1	672-692	WGAWKYTKKDWLKKINWPLIF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLT5	NAAA-beta domain-containing protein	1	353-372	EGKNRRLCAHHNYHNRRREH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2D3	Uncharacterized protein	3	14-42, 138-167, 1084-1107	IQQSDSSGSRQRRRPGRGRGNKRESENSA, TQSQPTQRPARQLRHPKRRLSKSQAPDIAT, GGKVTFAKKKPEKVMKPKPLPVAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNB4	Decapping nuclease	1	357-380	SEEYDRKIISQRFRRHRENFSFED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCW4	Uncharacterized protein	1	38-64	ANGASATPSKRIKKKRVTIVSPNSPEF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFY8	Polynucleotide adenylyltransferase	1	778-800	LGSSAAKTKSQRKKGQETGSISG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHY1	Uncharacterized protein	4	93-117, 170-194, 234-257, 484-518	VNENDAKARKKAKNEKRKREEGVLS, DSKKSKSQEKKEEADKKKKSKPGKE, IEAERASKKKRKRSKKVEESDVAE, YENRGDLNRAWKKRRREEKKVLRQRENRRLGRRIA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI02	Uncharacterized protein	1	27-57	GHDPLKSNIRKTRRQCRKRWIAKLRRLDLNA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN38	PHD domain-containing protein	1	379-400	APVKRGPGKKPGKKLGNNQYTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPV2	Uncharacterized protein	1	6-25	TAPARVKHYKRNSAEPKTKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQR2	Glycerol kinase	1	487-510	QMDGKSSKKMFRKWERAVRMCKGW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQZ8	Uncharacterized protein	1	135-168	LDDPRRRSSRRDERPPPPREERRRDRDDRYRDEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU72	Uncharacterized protein	1	211-230	PPAPPPKSSTRQKVEKHRAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWB7	Protein SDA1	4	99-120, 217-243, 584-604, 640-698	DLRAANSKTKNHKLNRNIQTIC, KEIKAAQAKVKRKEKKKNAYQTLNFSA, AMPSARRRKLQQQQEAARSNR, DANDHRSTTARRKEKKEAEGKSTTNKEKARKKNFMMTLGKAKRKGKRSLVEHRRILKAH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ82	Uncharacterized protein	1	227-254	GDCARNRTKSARGKKSKGKAPARGPQAF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q121	AMP deaminase	1	327-346	VKTPVTPRRKQRKMGQDIGE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1J8	Uncharacterized protein	1	106-126	TAPLAKSTKKGRKPKASSAAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2I1	Uncharacterized protein (Fragment)	1	125-147	LWEGRKKRDAKRAAKAEERRLKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2W8	Uncharacterized protein	2	441-465, 578-597	FVCTLCSRRFRRQEHLKRHYRSLHT, DFSPSSQDRKPSQKKRKREE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLW3	Uncharacterized protein	2	1015-1050, 1058-1087	YTTDEDGTRRKREKKPKEKRQKRKKKTDDTDTEGDG, TSTPVSDGEPRQKKKRRLERKGTAVKSSKY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGU4	Replication termination factor 2	2	194-218, 261-280	LSHSLKKAPGGKKRKKKEEATAALE, EEQEKAKKRRLENDNVRSLF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK39	Uncharacterized protein	1	1-20	MKLCHRSCRWRVHARRPALV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMA3	AAA domain-containing protein	1	140-161	LFADCLPNRKKRRSHFNTFMLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQD7	Fe2OG dioxygenase domain-containing protein	1	534-561	QSQTGAGQRRSAKKKKKKADPAIYQAAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSU0	AB hydrolase-1 domain-containing protein	1	8-28	HSLARHTPKALRKTNARSRFA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZP7	Uncharacterized protein	1	13-39	LAQGQSSTPRNRKERRADAKQNGKPIE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q367	Sec39 domain-containing protein	1	230-253	GPWMYGHTERKRRRLNQEHQDPID
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y328	Uncharacterized protein	1	77-100	REEWFVRTRKPSKRREYSRVHSSI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCG3	Uncharacterized protein	1	40-59	LKERRRTNFLRNVRDKREDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCR8	Lon protease homolog, mitochondrial	1	60-82	SRDFSSSPARRKQKPSINPEDGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFV5	Uncharacterized protein	2	224-250, 304-323	VKPNRAHMTRSRRKKQDYKPRTARLAQ, IQYRIKTTRQREHYRPPIIR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGV8	AAA domain-containing protein	1	487-510	HSPPGPSKSKKKGKKQGKYPTVND
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHB5	Uncharacterized protein	1	236-259	VNESEKQERKQPKTKAKHQDGKPY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLJ9	Uncharacterized protein	1	554-573	DRPVSRKGFRQPTQSRPRPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP28	Class I unconventional myosin	1	1177-1198	KVPPAPPTKRPAGRKPAPAPQT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP93	Uncharacterized protein	1	1-25	MANHHVRGRCNRSPTRRCAHRTTPG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR25	AlcB domain-containing protein	1	65-87	ADDLKARHIHRFKRPTLRNDHLF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSL0	Zn(2)-C6 fungal-type domain-containing protein	1	30-51	GACERCRSKKIKCDGERPCSTC
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUQ6	Uncharacterized protein	1	867-886	VSRNDSRRVRTPKNLSKSPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVI3	Zn(2)-C6 fungal-type domain-containing protein	1	5-32	GKPSAGCENCRKAKKRCGLEQPACERCV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY92	Fatty acid hydroxylase domain-containing protein	1	436-458	AEELKARTRLRQFPRKRTTSSGM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q172	Uncharacterized protein	1	257-282	DRNIPRQCTVPRRRRRQQRAQFNGAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1L8	AAA domain-containing protein	4	20-61, 118-144, 414-434, 450-475	EDFKDEPSSPRRPHKKARKRKSSPTKKPAKRRREGYNDSDID, SDVDRHTPARPKGRRPAHAEKKPQLLV, RSGRLRGKTHSNRSRSRRSPE, LDEDNRRIRRERPRRQRSQRQEIAFE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2A9	WD_REPEATS_REGION domain-containing protein	2	703-723, 788-817	DDTSHKGRRRMRPSVRSTARQ, FPRTSSLSPNQRKRTARRDHARSPQQRPAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q487	Protein kinase domain-containing protein	1	315-336	KEVQREMYRRVQRKARRTEGSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WK97	Uncharacterized protein	2	293-316, 336-359	LPPTPTAGKKPRRGRKVPKTGDIV, TCTKGERCAKWRKQQRQINQLQSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y304	Uncharacterized protein	1	121-143	SKQTLKQKYQQGKKQRREQKGGV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5Q1	Zn(2)-C6 fungal-type domain-containing protein	3	26-55, 60-91, 579-607	NKPGTSCLGCRRRKLKCTREHEGCRNCTKA, VYPTPESGIKRKRGPYKKDKPARQRHLEDLVK, VNAMIERARRVRRRRHTHQNKAQRLRQTE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKT5	Uncharacterized protein	2	49-69, 154-216	KRDKEEKVRERKQLREQRKED, KYATKAQIDKKPLRKKRPWDKGGADKVKMKKKKFRYETKAERAVTRQKQKSQNKKFAKARREG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLB6	Uncharacterized protein	1	124-151	PQTPPRALRRDGRSRKRRRDEEEEEACE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC78	ATP-dependent DNA helicase	4	518-540, 721-744, 754-784, 844-871	ERGRKAKGGRRAKRPLKKFHMPD, VLVSGPKPRGRPKKAPPPPSKLVD, PPPPAPRPVQTTKPRERTRKKQPLQRAVSYG, SSSQRTSPTMQKPRGLKKKPNHLRTAED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCF2	RF_PROK_I domain-containing protein (Fragment)	1	168-192	EAAGRRKMKEFQSRKKSARRGGGGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFL3	Uncharacterized protein	1	292-329	QPKTAGKKKATPKPRRPVMRCATCKKRHMKCKHFDEDG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFQ5	AMP-binding domain-containing protein (Fragment)	1	1-36	MKPTLRKRKAEQQPAAPPLRRPKPSTKHKGTGDPGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLT9	Uncharacterized protein	1	475-495	DDPIRSRQSKKRRCGLAEGAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQF2	ENTH domain-containing protein	1	163-183	GEPSHEQRRHQQRRNQRPDDD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRC7	Glycosyltransferase family 69 protein	1	66-88	SGSSLRTRYTPRRRRSLLCRAVQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRI9	Uncharacterized protein	1	179-199	ERLSILKRKKKEQGRSPHSGQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSC9	W2 domain-containing protein	1	138-170	GFILKSQPKKGKKDKSTKKADRKARKEAERNGT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVU4	Uncharacterized protein	1	1118-1142	VPRFDKSGNTRSKQRARKLQLGDID
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWK3	Uncharacterized protein	2	7-27, 30-49	HVPIVKKRTARFNRHQSDRFM, DPSWRKPKGIDNRVRRRFSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY34	HET domain-containing protein	1	52-76	PDDIRCSMHRHSRRRSNKRYIALSY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY72	Zn(2)-C6 fungal-type domain-containing protein	2	17-36, 55-84	IRHGIHRSTRRRSTHSQDAQ, QTKIMRKRAARACDQCRRRKSRCDGHAECS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0A9	PKS_ER domain-containing protein	1	13-34	EDQKQWQQFKKQEFKLKPFEDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0M2	Deacetylase sirtuin-type domain-containing protein (Fragment)	1	38-61	VDKDGPPPAKRRRVSKERTTEYLD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1R1	zf-C2HC5 domain-containing protein	1	82-105	ASTSDRTKSPRSQRKKANIHFLPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q368	2-oxoisovalerate dehydrogenase subunit alpha	1	16-40	AQGTLRSKTRPGKCSNCQQRWNSVS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q522	Uncharacterized protein	1	5-29	EDSAKSKLSKRHARLRKQYEDIRTH