ProteomeAccession	ScentificName	ProteinAccession	ProteinName	#NoLS	Positions	SegmentSeqs
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IEB7	Citrinin biosynthesis transcriptional activator ctnR	1	22-53	VCDNCIRQKVKCDLRRPKCSRCLERGHQCTYS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IM82	Transcriptional regulatory protein moc3	2	14-35, 57-85	VASQKQRKPEVIEQCPRRRRSS, PKNHRSRAGCTECKRRRVKCDETFPVCRN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IRN7	Uncharacterized protein	3	30-60, 146-166, 223-242	EVPCAWCKDRKHLCRRCKRRQQISSAGARKS, GHQRRRMQPRRPRMSERRRSS, KGVGRRRKWDEQKGELRWRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IYC2	L-arabinose-responsive transcription regulator ARA1	2	3-41, 44-69	VNQPVRPRPIKTRSRAGCKYCRDKRKKCSEEHPQCLRCV, GVACVYEPIKKRKRRTSTKSAMFSES
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1G3	Uncharacterized protein	2	67-98, 529-552	ESPNGHPPQPSSRRRPKRPDPARAKGKGRAHP, GRSQIARVRSRRPRQRMTPEDVQS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J742	Midasin	1	591-617	SQFKIGRTTLRKRKDRVNKAALAKRPF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBQ8	Arginine metabolism regulation protein II	2	11-35, 49-69	SNSGAATRKNQQSQKPSRGKPQSTT, FTGCRTCRSRHLKCDEARPIC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JF56	Exocyst complex component EXO84	1	4-31	DRERSKISLRSGNKRKGRPQISAPRQIS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJ96	Uncharacterized protein	1	56-100	TWLAPGKVTCRTRRKKSTAVSIKPTTKPKTPRPAKQPKHKHFEVG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJR0	FKBP12-associated protein 1-like protein	1	13-39	CGLPCGKKLKCGTHTCRKECHRPGECE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JNW6	Uncharacterized protein	1	424-443	ADGKPKPAPKPAKQANHRTN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPT6	Uncharacterized protein	2	31-59, 244-264	IKPPKAPKVLKPAKVSKKSQPSQAKNAGK, DAATPDQRKKRNQRKDASVLL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPX6	Cyclin pch1	1	18-38	TLPPGPPRPDRQSRSPARRLD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JSR8	Checkpoint serine/threonine-protein kinase bub1	2	105-130, 132-153	ENGAIIKPKGKSKKKKVMEVNETQII, ANLDSPSRPKLKKRNTSEPTMT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FJY5	Exosome complex protein	1	155-179	SASSSGPEKKQRNSRRKSSGKKNKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FK10	Uncharacterized protein	1	183-210	LKMGWKIPFWRQRRKKRRIRAVHVMLVK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FM02	Poly(A) polymerase	1	583-605	VFEPGEKKPLKPQKRQNATNGAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G2N4	Benzoate 4-monooxygenase	2	24-44, 57-79	VEYFRDPKRLRRYPAFKPLAG, GFRSKTLYEKHKKHPVLRIGPNS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G3C9	Serine threonine-protein kinase cbk1	3	11-32, 485-512, 526-546	VVKLVRKMVRDKYVRRKYNEVY, NGLKEYVRKYGRKERKRPRDMLLRDPDT, LGYSWRKPRSRLRPAPAQYDA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G3G2	Calcium-transporting ATPase	1	1168-1189	AETHIPFRKKMHNAKEHAKEKV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G578	Aspercryptin biosynthesis cluster-specific transcription regulator atnN	1	16-65	SSSSPTSDSQQKPKRARTSKPKVKTGCNNCKQRRIKCDEKRPSCSQCVRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8Y5	Pheromone processing endoprotease kex2	2	94-122, 718-741	GVRLAQKQQLRKPWEKRVPPRLHGPKNFA, ALGIWFYIRKRRNSQPRDNYEFEL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GCB5	Putative zinc finger protein 876	1	52-72	RRDVCRKHTIHCPNKKDHEAI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GI37	Eukaryotic translation initiation factor 5	1	138-164	SSYILKNQPKKGKKDKAERKAARRAKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IKX4	Uncharacterized protein	3	250-271, 385-405, 485-508	QRVIERKKRKIEKDAEKEKRRA, FSKPSMPPKPQQKRRPLEETT, HPISSIRRLKRRPESPSLRKKSYV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IL35	Uncharacterized protein	1	25-49	APPEPSPTSRAKRRRDTEAQPARPS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILE7	AMP deaminase	1	331-351	GPELEPKRTMKKRKPGQDIGE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IUZ9	Poly(A) RNA polymerase cid13	1	1079-1101	DGGWQKATKGRKKGDGKNQGNGF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IV27	Transposon Tf2-6 polyprotein	3	588-607, 611-661, 1823-1843	VSRTKEPRRAAKSQRYRSDS, EDNIRPQKDNRKCYNCNKIGHIATRCPKPRRSGPKKVKKVEKAKRREESSD, IDAAAWKRRGRGRRREVLVKW
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IVT8	Uncharacterized protein	1	25-49	APPEPSPTSRAKRRRDTEAQPARPS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J3Q0	Uncharacterized protein	1	15-40	KEDPVQKRRAQLRRAQKSYRDRKEIY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J6S6	Uncharacterized protein	1	16-57	QSCTSCFKSKCKCILRSDGDGCERCHRLKKPCHPGDAIRRQA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J6X8	Uncharacterized protein	1	263-284	IHPWKVAQRRIREQKELRAGSR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J7N7	Bikaverin cluster transcription factor bik5	1	31-60	TTAVRSCLLCRRRKVKCDKKKPCDGCSKAG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBG1	Uncharacterized protein	2	12-31, 590-609	AVFDKAKKYKDRFRDAPDHL, RPLPHLGKCLQKRVRGRFLL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDV0	Versiconal hemiacetal acetate reductase	1	14-49	GISDQNRRKKLQNKLNQRAYRRRRKQPTVDRDDQHL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIW1	Transcriptional activator ARO80	2	42-68, 82-103	APQHKRVYQACIPCRRRKVRCDLGSVD, SKECYFSATRRKRKTEDGADEP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJ74	Putative mitochondrial chaperone BCS1-B	1	616-639	EIQGFLLKRKKDPRRALKETAEWV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JLB2	Transposon Tf2-9 polyprotein	1	969-988	TTHGNQPKTSPTQQKNSRST
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQG1	External alternative NADH-ubiquinone oxidoreductase	1	59-80	ADAAPKRPGKIRKTFRWVWRLT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JSM7	Uncharacterized protein	1	49-68	PISPTHRKTRPSHDFDRRYD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8F5	Peroxisomal abc transporter	1	51-78	VLSAAGGRRWWRRRREEREQGRKLVRTN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GF19	Peroxin-1	1	1127-1152	LAKLESIKQARKRVKHAQRPEGEAKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IF22	Putative transcriptional regulatory protein	1	17-74	GRLSQEQEPKSKPKKTRNRRILSCLPCRLHKLKCDRTIPCHTCRQYNRQDQCRLHPAP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IPC5	Uncharacterized protein	1	27-50	QNSSVWKRKVRSHAAKNPQARRLA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQI1	Uncharacterized protein	1	197-220	IYRNCCWPNLQRFQRQKCRKLLVE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IRX0	Uncharacterized protein	1	1-24	MADKQKTKERPAKRSLTPNRNLYS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IXR6	Putative RNA-binding protein	4	49-68, 71-91, 297-322, 373-393	KVEKVEKKATPKRKAPEEAS, AAKKQKPAKATPKTTPKSKKA, STWAQKVSREEKKREERAKKLKAIGY, AAETPKTKAKAKKGGRRKSKN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IYR5	Uncharacterized protein	1	269-291	IFLILRKKKKPAQNQNQQPPQIQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J056	Transposon Tf2-9 polyprotein	1	695-715	QGITKTWKRLRQQYGEKVTRE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J0Q3	Uncharacterized protein	1	158-183	VKICAHVVKYRQSRKRDRFWEQTKLI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4M3	Uncharacterized protein	1	108-135	QNPKETHKHKIEVRPRWPRKDNDITRHG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J510	Uncharacterized protein	2	7-29, 787-809	LPYYSAYKPTRRKDRGSVSNKDA, AMSAKEAVKQHRRQRARTTSLST
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J6K7	NuA3 HAT complex component NTO1	4	1-28, 225-244, 398-419, 1194-1218	MAPKPSTPRRPPTGRKRGRPPGTTNAAR, AETPQKRRTRPPRESVSFLS, ALEKRIPKPNPKPPQTHRPRSS, DTIVSKAKSNSKVRKRTSARSSRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J7H3	Ankyrin-1	1	62-82	ISTPKGKKIPVRHILNKVDKW
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JF05	Uncharacterized protein	1	634-662	TDRFWEARRKRLAKKKARQREMRKTTETT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGH9	Uncharacterized protein	1	163-186	MKASVPPIPTRKRARTVRRAGGTI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JHA6	FAD-binding monooxygenase moxY	1	22-44	NEPSRESTKYFPKNRPWEPFRSV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIF9	Beauvericin cluster-specific repressor BEA4	1	17-62	AAAVASVRKRRRRAPAGGAADDCFTCSKRNVKCDRRRPYCSQCLEI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJ79	Chromatin-remodeling complex subunit ies6	1	25-51	SIHKSFRNPSWRPNQRRNKNIKTILGD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JLW2	Uncharacterized protein	2	181-207, 255-274	PEREPRHRDEQQQQRRHRRQGHGWTDY, MVRIREREERREERRGRRRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JR76	Ubiquitin-conjugating enzyme E2 Z	1	425-446	GADERKNYNRRLRRSVQQSMDD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JSI3	Transcription factor tau subunit sfc4	1	530-554	LSDAIKPRRKRDQRRRPTNNGVVRA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FBX9	Hard-surface inducible protein	1	575-596	EEDDRKQEKKRHDDEVKRIKAD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FHQ5	Uncharacterized protein	1	226-253	VSSCVWCCVRKCKKNRREKRAIKAAAAT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FLR6	AP complex subunit beta	1	242-262	TYYARKCFPRRTRSVKTQEKT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FSE4	Cytoplasmic dynein 1 intermediate chain 2	1	175-199	PPVTSTPNKRLSRRQRDREEELRQD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FXR4	Translocation protein SEC62	1	342-366	VWAWHDPNPKKGKKKKASSSSGAAS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G2C1	Uncharacterized protein	1	49-78	ANNAPNPTTRRANKKKPKRRPANEQEFGYG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G9C1	DNA repair and recombination protein RAD26	4	90-127, 243-268, 287-309, 328-352	REKLQNQRAKERQNLEKERRNPYKSRKIQTQIDKLDKE, AVENEFSLRPRKKRKVKQEASDEEFE, EEEATGRKRRKGPSKKKATGAAA, KSRLADWVKRRSRARRRRAEADGVE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ICN7	Uncharacterized protein	1	18-38	DKSSRLKKSSSIRDNQKVSKM
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDI1	Zinc finger protein 681	2	8-35, 97-119	HPYECLRCAKRFKRDDWRKTHERSCTKT, RHSNVHKRDRPFKQRNKASRINL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IF48	Uncharacterized protein	1	1-32	MPPRNQNTTSEKKTNRRQRRATARAKQGTRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFU0	Uncharacterized protein	1	33-52	SASAEPSKPAKRKGTRSVST
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IHU6	Uncharacterized protein	2	26-45, 301-322	LSLRVYCKFKKHRGLWWDDH, VTTTTRKPSVRRKDKLADDRSD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IKV4	Uncharacterized protein	1	34-62	PVCRTNGAIRRNRKRKRHREPKPSIHAYA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IW64	Putative aspartic-type endopeptidase OPSB	1	406-427	DTDSQWKYGRERRRRKGIGLGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IWP1	Chitotriosidase-1	2	126-149, 1493-1514	CGPDRPCKNKACCPKKTGQCNYGE, GGVWQDAKKRKREEKLTPTSTI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IWX7	Putative transporter	1	546-566	QYPFTFFYYRWRNNQKAKVWD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1Q2	Transcriptional regulator prz1	1	77-97	GSKRAEIKPNRPKRSARRMTT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4E0	Uncharacterized protein	1	21-41	ETNQLLPARKRQQHRVRVQGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4G5	Putative transcriptional regulatory protein	1	52-76	VSTVPSKVTKRRSPKAKGSTAPQKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8L6	Uncharacterized protein	1	186-205	LPERRPKRGRPERSEEQPGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J9E0	Uncharacterized protein	1	91-111	AGWTKKTIRRVAKQRNDDLRD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCM2	SAGA-associated factor 29	1	53-78	QAKAKTTSYKTKKKGIAKDKRPGPAS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGI9	Uncharacterized protein	2	73-97, 150-184	SVLSVRSRSRHHRKHRSPARGPRII, VIEEHEPERRRRRRHSSSHRHSSRHESRRRSSRDY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JK86	Chromo domain-containing protein 2	1	144-164	LFEQKTKAKTTKKRGRPAASS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JLS8	Salicylate hydroxylase	1	363-382	WDSVRRPRASQVQQNSRHVT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JP64	Peptidyl-prolyl cis-trans isomerase cyp15	1	30-53	GPQLPTEAPKKKRRVLPYEKLYIA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FBD9	54S ribosomal protein L25	1	136-157	AMPKLIKEWKKVGKRNWKRFPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FGS1	Multisynthetase complex auxiliary component p43	1	184-206	AGEGKPKKEKKAKEPKPQKAPAP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FWN2	Beta-galactosidase	1	49-68	TSPWPDHPRPQLRRDKWLNL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FY30	U3 small nucleolar RNA-associated protein 11	2	2-26, 38-59	SSMRNAVQRRSHRERAQPLERQRFG, AKDYNKKKETIKHLRQKASERN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FZD2	Putative RING finger protein	1	606-635	EDDAYFRRPVNPHRHQNRQRRVRPSDYREL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8L9	Bicyclomycin resistance	1	525-546	FPYIFFKYGKQIRKRSRFAKNT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GD55	Zinc finger protein 2	3	80-100, 592-613, 623-673	AYPFIIRRIKGKRNGTNRLDT, FFDQVHKLNHHKRYHERPHECT, TKTHLDRHINDKHRKTKKFHCTVSTCPYSKTGGKSFPRKDNWRRHMVNIHQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GJ75	SLD3 domain-containing protein	2	310-332, 646-667	SDEGGKSKKRRTKKMKLGKDGMY, GGLSSIKKSKKPTRHPLFDTVQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDC6	Uncharacterized protein	1	296-315	NKEMRRWYRQWYARHKQNKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IF00	RNA-dependent RNA polymerase 1	2	44-66, 723-746	IEPLNRILRKHRKHADCFMRVQF, FNKSGAQTRRQKDNSKKLKADFDR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INA1	Uncharacterized protein	1	347-370	QDVPTQPPRRLRPHARPGKPPAHV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITF6	Uncharacterized protein	1	48-71	FVIFSFRASRRNRQPSKNSSRGGF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IUU7	Uncharacterized protein	1	480-499	ASPKQRWRWLAPRRNNNASS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IXX6	Protein MGA2	1	453-476	NGCITRERKRAARKKIKKVEEEEM
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBI5	54S ribosomal protein L20	1	187-208	KDGWGKIRTKAREDRSRRKEML
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIW9	ATP-dependent DNA helicase MPH1	4	724-754, 847-867, 949-981, 1089-1108	TQNPALPEPKKRRQPAKKKPPKKFHLPDGVE, GVRTKKFVKLCKKLSQQQDTA, EEEESPPRRRPKPAAKKRGKKATKKTRGGINSD, DTPQRQVGGRQQRRRPVFDS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JMG0	Fusaridione A cluster transcription factor fsdR	1	20-43	QACLRCQSKKIKCDGKQPSCTPCT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JR37	Uncharacterized protein	1	555-578	ERGRLNVKTTKRAKTSKKMYDADA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FCV1	Aspercryptin biosynthesis cluster-specific transcription regulator atnN	1	10-33	RTGCLTCKSRKVKCDEAKPACLRC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FH25	C6 transcription factor	1	20-50	ETANNGSAGPPRKRKREKHQKTSCELCKARK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FJK0	Non-specific serine/threonine protein kinase	1	539-561	AGILRRFSTRRRKDPERLDKDRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FU50	Uncharacterized protein	1	164-183	SAPPGSPRMRRKPSKNTLSS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GB13	Uncharacterized protein	1	33-52	TQTLKRINRIKRPLNSVPQH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GD44	54S ribosomal protein L35	1	408-441	LKEPKKARGWEAKRQGPKYKHLWKYTKRIKGYSN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GGH1	WD domain-containing protein	1	1-20	MSRCPKVRGKSRLPNSSRDS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GHY0	C-4 sterol methyl oxidase	1	283-307	TEAGAEAHKKRRERKLKAIKAQKAQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GJF0	Putative ATP-dependent helicase	1	452-472	AIKPPERSRRQERKYERPASP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJ18	Uncharacterized protein	2	20-41, 283-313	KASMAKSRKEEHRSRKNNLIVH, TLSTASGGMPKKRRKRRSRAKKYQSPSVENS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJG8	Beauvericin cluster-specific repressor BEA4	1	7-31	ASCFACKARKVKCDLQKPFCNRCIS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J3U3	Putative fungistatic metabolite	1	470-494	KKGSCGKKDCFQKKQPKGWKPGSTS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JB60	Uncharacterized protein	1	6-36	HCSPMLPRVRVDRRRHPRSKQKQLLVTIRLR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDB3	Uncharacterized protein	1	14-41	ESQDVKPKKPFIRFTKRKRHSSPFVIPD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JEA7	Vacuolar amino acid transporter 3	1	339-364	DSALLTPSRHKRRRRQRGGSGKNSPM
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JEK9	Protein-ADP-ribose hydrolase	1	520-541	EGESRWKQFRRNIVHRENKTTV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGW7	Putative transcriptional regulatory protein	2	1-28, 45-67	MRKPSACAACRARRRKCHSREGLEDCIH, YYEQRENERKKNQEEQERQHQHQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FF70	54S ribosomal protein L4, mitochondrial	2	44-65, 281-305	STSAAHSKRKTRDSNRLRGVSS, TSEMAKKEKAEKKKPEGAKGAKKAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FG70	Uncharacterized protein	2	22-42, 451-470	VTATRGQKTKRKNADTPGSIN, VFEWQRKYKRLQGHNPVPSS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FI03	Efflux pump aflT	1	599-620	CMEWRNIKKGRNRASRIEPETE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FRA2	Methionyl-tRNA synthetase	1	621-642	AKEADKARKKAKKEAEKAKAAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G0M7	Highly reducing polyketide synthase FUM1	1	2321-2346	LEDPNNRCNWRRDRRMGAYHNIRNKQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GA06	Ubiquitin carboxyl-terminal hydrolase	1	290-319	EATESKKKQRRGPAKARKTKKQKVNSESGY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GCA7	Sodium p-type	2	245-266, 1024-1049	AAALRGKNSRRRDVKRKEDGSA, IEAWKWAKRIYFRRQSHKQHGANPDL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GE04	DNA replication licensing factor MCM7	1	650-669	YVRMREQQRRAEKKGQQFTH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IIU7	Asparagine-rich zinc finger protein AZF1	1	319-344	YVSGKDDKVRKSRSARRPPTRPMITA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INA3	Uncharacterized protein	1	440-463	SGELVRRVSGRKRRKYDSGLGFLD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IPI2	DNA repair protein rhp54	2	77-102, 771-796	ATRTVSTDRPARKKRKVDYKGADGAV, NSDTHDTFKCKRCKPDGRQYIKSPAM
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQF6	Uncharacterized protein	3	2-25, 419-441, 504-531	SYDYEPHRTRRYVREERREERVDP, YDSRASSRDGRRHRSRSRSVVDS, DDDRSSYTSGRRRDRSRRRGARSDASSD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IVK2	Uncharacterized protein	2	35-55, 237-260	IPPYQHSRRSRQPSPALHHSS, SSSPNKRRESHRPHRVSRNTRSAI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IXG3	Uncharacterized protein	1	21-43	KLIIGSRRQKTDQKRRCPACLKL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IY75	Pogo transposable element with KRAB domain	1	16-37	VLGRAATKSVRKKQPGSRAWVS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IYY1	Uncharacterized protein	1	312-331	REKLRCKKRSWGKSGQEKWE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IZ61	Uncharacterized protein	1	395-421	FASDASRQRRHSRREERERERERNPPP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J0C1	Uncharacterized protein	2	113-138, 746-771	ANGTTTSPNSKRRKLNRPPVPTLKEA, KPVTKPETKTPRGRGRPPRSANKIRA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4I1	Receptor-type tyrosine-protein phosphatase O	1	1-21	MDHLPKFRRKPKIPTISTTDV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JLS1	Killer toxin subunits alpha/beta	1	1495-1515	FVKSLRRRPLWCRLWRDNLCW
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQJ9	Adenylate cyclase	2	115-136, 303-322	SGKDRSRSYSHSRPTRDRNYSN, QTHHSKRNILNRLRGRNKDK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JR12	Uncharacterized protein	1	27-57	DDWTGLRDRAERRKRQNRLNVRAHRKKKALE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FBX7	Chaperone protein	2	261-282, 372-402	MQRAKEKQRKEAHQRAKEQQRR, EEQRKAEETKRKAQGKKRKAEDRLQEKQRIA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FE86	DNA-directed RNA polymerase	2	487-509, 1334-1358	QLANDKSKSKSKSKRRRVVLAES, SYFQDVLNKKQPKKRGQLPTQIWMP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FR02	DNA-directed RNA polymerase subunit	1	100-122	SQCAYCKGFRMRHRESNRFSCKL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FS74	Uncharacterized protein	1	120-155	MHVPAQRQARKKCKRVRKPAKGKKGKKHNVLRALKT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G143	Methyltransferase domain-containing protein	1	60-80	DYNFENKRRYHKFKEGRYLLP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GCK5	Peptidyl-trna hydrolase domain-containing protein	1	166-192	AKSFNEGRLKQKKHLSSKKQNRRVSFD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GEG3	DDB1- and CUL4-associated factor 13	2	382-408, 411-448	NRYSHMPEIRRIKRHRHLPKVIKKAGE, NVELKSIKRREENERRHTKKQFEKRRSEREKPILAREK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GGR0	Uncharacterized protein	1	203-232	SHLKLNRRDGSRKGHKRCKACKMREVSGMK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GHK6	CobW domain-containing protein	1	538-563	EEWKKWQKVMRNKKWDGEKKLDKLQD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IF87	Uncharacterized protein	2	173-197, 246-270	GGILTWRKQWQRRKRIRETIKEASL, GSKRINYPPRVRRERLDRGRKAGSS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IK80	Uncharacterized protein	2	233-254, 407-431	TQVANRSSTRQRKPRREPEWAT, TIMTHYPKYRERHWKPKRGFGQKTL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IL38	Major facilitator-type transporter ecdC	1	440-462	IDELWTRKVPPRKFKNTNLVTLP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INI4	Uncharacterized protein	1	287-306	STNYGFVQPKDRRRKHELMG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQG2	Sterol 3-beta-glucosyltransferase UGT80B1	1	1117-1137	LPDARPRPKSPRQLDEKNPDI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQH8	Uncharacterized protein	3	1-23, 665-688, 692-711	MTRVPANQRKRKRDESDDKKAAT, SIPPSSSPPPPHQQRRPLPSPPAP, ASQKPGPRWKLGPRARKPAS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITR8	RNA-binding protein with serine-rich domain 1-B	2	1-32, 43-63	MASRSRSRSPGDRYRSRTRSPTPRSDRGRSAS, SRSPSRSQSPAPRRNGRYRSE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX12	Low affinity vacuolar monovalent cation/H(+) antiporter	1	99-126	MMAPERPKANNRSRKPPMTRRPSTNPSA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IXW7	Uncharacterized protein	4	75-96, 182-206, 795-818, 987-1015	DAKGWVNPWRSKRSRNPPVAVV, RSMGSDWLKRKDNKRRKAEEEDVEG, ANFMSPSPERPRRQPKRARVSGGH, LERTKEEERQEREKREREKQDQQKNGITS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J441	Multisubstrate pseudouridine synthase 7	2	186-210, 611-632	GKGRGVRGGPQQKKKQEPKVKAPGE, MDRIRAKQPPSSKKRGRTDGDD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J603	Uncharacterized protein	1	195-227	PAHQQAAKKIRKGKKKQSKKSNRKGGPRTASDS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8J2	Solute carrier family 28 member 3	1	57-87	EQVEGVRDTKKKKKFRISKFYKKYRLPIHIV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J9A4	Putative ankyrin repeat protein L63	1	176-196	AQWPRLRKRYARPPSHSDRLY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JC92	Uncharacterized protein	2	233-254, 753-775	KRNCIFDPKYSRSQRKRMLEDI, AQPQKPPKKVRIKAPKKAQPQAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJB4	Transcription-associated protein 1	1	3422-3446	MYEYIHKLRRWRNKFEEKLDRRTTR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JK97	Uncharacterized protein	1	10-33	TSQDIKKLRNRLSQQAFRRRRDDL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JRX7	Vacuolar protein sorting/targeting protein 10	1	576-597	CLMGHKQTYRRRKKTADCFIKQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FJB9	Uncharacterized protein	1	57-82	TPCLGDREERARRRRERDRAGGRAEY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FJJ9	PHD domain-containing protein	3	42-63, 350-374, 644-663	NDDNRATKRRRTEAKIQPHTLQ, LSDKAQGREKKQRRRRNTNAVEDGT, NSTTPKPKESPKGPHIRKSA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FWH4	Uncharacterized protein	1	55-77	SPVSANYQKHHRPNGRRTRSSIC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G105	Ribosome assembly factor mrt4	1	12-31	LTQVSKKTREQKDKLFANIR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G6B3	Peptidase S41 family protein ustP	1	868-895	KAPAKNRIPKTGYKRPKHNEPNLCSGRT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GAJ8	Uncharacterized protein	2	424-448, 453-478	TEGPMPKATQPRARKRRAAPEPADD, HPKLTKSGAIDKRRTKRSKQDLSTDE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GAS1	Spindle pole body protein pcp1	1	1405-1429	ADCVDEMRKTKRRKQLKVVSTGHVE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GK72	Formin binding protein	4	363-388, 575-598, 652-681, 741-779	AFNDSKQEQKNKKFRKERKARDAFLS, KEEEADRDRRRRRGRDSSERDLYR, LSDRDRRLSPPPRRERERERERDRDRERDR, EDDRRDSRDSKRVRRERTPRERTPQRDTRTKNRTPPPAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IM96	Aspyridones cluster regulator apdR	1	117-141	IQHVNFVRTKPKKCRRVAMACDSCR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQW7	Nucleolar GTP-binding protein 2	1	52-73	HKKMGTGKKEANRKVRQGKTGD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITU6	Uncharacterized protein	1	160-183	IGVHFFFFKKKRKDRPEQPSTQVS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX47	Fusaridione A cluster transcription factor fsdR	2	19-43, 49-74	QAIVRACDMCRKKKIRCELTTQGCA, RTRCHFTPIAMKRKPRRPAGFKYIAQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1L4	Two-component system protein A	2	717-736, 2076-2100	VDIIKKRVPRREPYRKLLFD, QSQAASQKRSSRKLTKTRNSIDPAS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J5D8	Transcriptional activator protein UGA3	2	8-38, 41-70	SMSRKRLRNGCLTCRDRKKKCDQVYPICGAC, LNFICRREDLKQPRKRGRPRKSVPQDPSAE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JAK9	Polyphosphoinositide phosphatase	2	105-124, 1057-1085	LDWIKHFDKHTKNRTKGVYR, TEEDAQKKRYKAYRKWLRGKSFFKQQPLD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCY8	Uncharacterized protein	1	289-312	EMDIRQCLLRRRHRSTAQKAELSR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FD60	Uncharacterized protein	2	74-93, 224-245	SHRIHYWKLKLRQKPRIDFD, IDPRCMWCKRRHRPEVEWWNEA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FPU2	Duf218 domain protein	1	211-233	GVGPSLSRKRRARNPWNLRDRLF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FR70	Uncharacterized protein	1	77-100	APPSPPPKQKTRIVIKRPNNSINQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FYF5	tRNA wybutosine-synthesizing protein 4	1	464-489	DAMRNLDKKTSQKKRKWEEAVGVHDT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G0F6	Splicing factor spf30	1	217-238	ATKPPKAKKIKATKELEKGKSK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G0N7	Carnosine N-methyltransferase	1	68-88	DVPNRPSQRHEQEKRNLMKRM
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G3Z1	Cellular morphogenesis protein	1	1-25	MRLPLDRRPSARRRRHSPHLLAMAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8K2	rRNA-processing protein EFG1	1	34-58	DSKRSRTGPVATKKKHKAKEGTPAW
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GCN8	GTP cyclohydrolase 1	3	7-26, 34-78, 80-101	AELKKGKKTKHSHPNGLSGS, TASQASSSKRGKKDKSKRKREGDDAELNGNSKKHRRPSLSRPARD, RDTTSSSSKKVKKPKNEGAVTR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GGC3	Uncharacterized protein	1	309-330	DYGFMNCKTPRQRQRLRQLYAD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GJ38	37S ribosomal protein S9	1	301-330	AGCITRDARRVERKKHGHLKARKSPTWVKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IL49	Uncharacterized protein	2	11-30, 605-630	TTPARHGHKRRASNDPFQDQ, ANESVGPSPQRRRKRPSPAADVPPPS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IUV9	Putative transcriptional regulatory protein	1	32-61	GKYISKACFECRKRKSKCNGRSPCLRCARQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX76	Uncharacterized protein	1	17-36	CDQDQDKSRNRNSNNRRNTS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J364	Uncharacterized protein	1	856-880	GKRFERQLKAEQQHRQQRPPQQQWR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGV7	Uncharacterized protein	1	622-652	PSSAGASKTRTRKHRTKSRKGPKPTGGAGKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJP4	mRNA degradation protein pet127	3	91-110, 154-181, 886-914	QMKPRKGSKAPKSSTKSQGM, DDGNTKSADPKKKGKSKRPLNVERVHAN, DVAQAQKLYRRLKDRRRKALEKGDEHRDT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JMW2	Uncharacterized protein	2	13-36, 118-137	PEAISPKPPSPRKKSAKMAREGTR, ATKAGKKETKPKTAKAKANA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQV0	Uncharacterized protein	1	158-178	VEEPKPKRSPSRERPEPEPEV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQX6	Sterol uptake control protein 2	1	16-46	SPTASSPPTPTPKKRGRPRKNWDDIQKLPTP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FPK6	Uncharacterized protein	1	39-59	IKDFYKNLKKRVKAHSDKVDG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FPW1	Putative transporter SEO1	1	4-23	ADTVPRKKWWKIQWYSDDDT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GA69	Serine threonine protein kinase	1	345-373	LLIEKEERKVRRRERKRREREAENRSLRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDF2	Transcription factor IIIB 60 kDa subunit	2	1-32, 576-609	MSSFLTPTKKSQKPQTKSKPFQPPNRIRAIRE, QERLFRKKLEGQKEKPTRKRKKRPRIGEGQTTPA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGD2	Uncharacterized protein	1	1-26	MAQEGRRRRRRRQRNQEDNNEGHPKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJJ6	Putative transcriptional regulatory protein	1	35-64	GKLPCSYCLRRQRPATCRYSPQQRRRAPAP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJP4	Putative transcriptional regulatory protein	1	96-118	SIACNECKRRKIKCNGETPCQRC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IV85	Nitrogen assimilation transcription factor nit-4	1	68-95	VTPNACTECRKKRAKCDGQKPCGRCKAQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IVW5	Uncharacterized protein	1	70-91	STTGQKRMTKQRRSTLRREKED
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IYI7	ABC1 family protein	1	77-101	SLGAPKRARTYPKGRKWTRRLLVLS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J0Z2	Transcriptional activator protein DAL81	2	66-91, 99-125	GAQSRPCDICRQRKTRCVREEGRDKC, QPCTYLRGPLPRKRRKATDPPEVRPQT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J110	Uncharacterized protein	1	44-77	QQQQQRPQFQPPPPPPPRRNQQQQQQQKQQQSTI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4H4	Ribosomal RNA-processing protein 14	5	31-55, 138-169, 184-203, 336-361, 471-534	GEDNSEQWKKKKQTKAEAKAAKTAK, LMRLAKKEAKTQKRQDKKEKKAAKKAAKAEAA, EPAKAAKKAAPKKQQKKAES, LIEARRTKQNQRKEHKKELRRQAKLA, DEGALKRAVKRKEQTKKKSEKAWKERSDGVAKAIREKQKKRDDNIKKRKDDKLAHKLGRKSGKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JAQ7	Uncharacterized protein	1	271-290	YHGFRFPKMWRRQHQEGPID
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPJ5	Uncharacterized protein	1	17-45	CTPCNEMKAFRKAKKKAKEEREVKRRIEM
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FIN6	60S ribosomal protein L14-A	1	118-145	SDFDRFKVLRLKKQRRFEQRKELVKVKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FYX8	3-amino-3-carboxypropyl transferase	1	108-131	AQLKAKAPKGSKKGEKERRIWVDV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G7H0	Transcription factor radR	1	49-80	AERRRIQNRIAQRNYRKKLKRRLEDLERRAGQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GAG5	Uncharacterized protein	1	297-317	DIRSQFRCTCNPQRIRRRQKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IF32	Uncharacterized protein	1	104-125	VDASRARKRKKVKMSPNSKFAD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFV5	Pogo transposable element with ZNF domain	1	300-321	DANVALAKRRRAKRTRVQLGGA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IIF2	Putative maltose O-acetyltransferase	1	343-384	AILQSEKKRKRNFSNRTKTGCMTCRRRKKKCDEQKPECSNCI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQE5	MICOS complex subunit MIC60	1	216-240	AAVKEKPKPVEKKKKAPEPKPAPVE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IXV0	Serine O-succinyltransferase	1	37-56	QQPVRRFHSKPARKASNSPG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J149	Bud site selection protein 6	1	166-191	INLLHGLKRKQQKLRQKGPRDRESGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2B8	mRNA 3'-end-processing protein RNA14	1	941-962	DYSTWKSNPDPRSRQNNGNGFR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J626	Nitrogen assimilation transcription factor nit-4	1	22-60	LNANRVARRSARPRKTPSACDPCRRRKIKCDGALPRCLM
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JAR0	Non-reducing polyketide synthase ausA	1	6-25	ADARNSRRFPEHPRNIRRLE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCZ9	Uncharacterized protein	1	835-854	SGIVRKKKSFADRTNPAAPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDH4	Uncharacterized protein	3	74-97, 426-445, 516-548	HSVASSRRSHRSRRSHYPEQDCYP, FRTTRSSKTHRSSRTERTHH, DIATRPKKNNMLKSLFKKKEREHRDRDERVSAL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGA7	Uncharacterized protein	1	1-24	MARRYPLPRHWRARMPNGQPPPRV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JKE8	Carboxypeptidase Y-like protein A	1	71-100	VEAFKKNAIPSKPKPHRRKAEKHWDHVVKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JMB8	Uncharacterized protein	1	365-387	GPSGIERRQKRFKDRNWRETNVE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPR5	Putative serine/threonine-protein kinase fhkC	2	21-40, 593-612	SDTEAKKPRRSERLSVDKTP, RSPGPKQKPVKIYSKNTTKT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FVR1	Efflux pump aflT	1	562-585	LLVEWKSVKKEKRAEEDQKERGGN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G2J3	Ankyrin repeat protein	2	979-1003, 1199-1240	SESNRPESIKKRHKRELQEAERENR, AWSGVKKVVPEKRRERRRQRIDNREREERKTRMRDRGYDFWA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G879	Intermediate filament protein	1	52-75	FLTSRGSRRSFRHRSPRPQGPAFI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8X8	C2H2 type zinc finger domain-containing protein	1	533-557	AATRYEKRRDYKVSEKNNNQKNFYY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJW4	Histidine kinase 5	1	500-525	STHAHDKTHKSRRRGRNPFSRKNEGN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IKW7	Uncharacterized protein	2	27-59, 73-101	PNTGKPSPNCHLCRQRRVKCDLGRPQCQRCIKY, RFQHSHPNTFEKRKSKKQRDSPDQPMNVI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IN33	Polyamine transporter 4	1	357-379	LLYLPQTKKHPPHRTPPEYRLYP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITS8	Bikaverin cluster transcription factor bik5	2	20-75, 625-644	KQPLSCANCRHRKIKCDKVQPRCTQCERSDLDCVFPSRKRNRKPRQGRQSELLNRI, GTLWKPLKKLLRKARAARAE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IYB2	Uncharacterized protein	1	23-46	ASPAPAAQSKRDRKRQVLADKINS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J218	Uncharacterized protein	1	213-237	LVQGGRRQRRQKPKPIAWRQRRLLG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J3W5	tRNA-dihydrouridine(16/17) synthase	1	360-386	EEDEPARKKRKKDTPGKKASGKKERTN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8Z8	Myb-like DNA-binding protein myb-1	1	94-120	VKNWWNGSQNRRKRHDRRRANQSTSGY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBR7	Uncharacterized protein	2	11-47, 71-93	AAIGIKQYQKKKEKEEDDRRSRERSARSRSRDRSISR, ASSGERPRNRERERDRRRYEDDA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBZ2	Uncharacterized protein	2	97-125, 137-156	HSFAATKRMYKRQFKRWDWKKYNTQSVQE, QGQTTCRRPMRSKRNINIES
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JEP8	ATPase family gene 2 protein	1	21-47	YPGFHFYTRARQNRARAKQRATTRKMA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIB0	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform	1	10-37	AQLSRGKDKDPNKPKKNKDSKDGTASPS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JKC6	Uncharacterized protein	3	92-115, 326-352, 384-443	AGAAKNKTKPSSKRKRLHILYILN, GWSRNFCEKMKQRKKGKPGGDRRSRGR, DSRSRSPSRSRSHSRDRRQSPPRKGRYDSRDYSRSRSRSRSRSRSPYRSRSRSRERGGGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQ90	Uncharacterized protein	1	5-24	NSLRLRARRALRSRALRNLV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FG17	Putative transporter SEO1	1	492-515	LTTGFFLYRKQEKRQKQLDLDEEN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FLH5	C6 zinc finger domain protein	1	17-60	GGSPPEDKPYHSKRPHKKSRTGCRNCKTRKVKCDEARPTCRNCV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FR88	C6 transcription factor	1	2-24	RYSTACSACRARRRKCEVPIGGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G1K1	Major facilitator superfamily transporter	1	43-63	ANFPEERKKKAVRKVDFRLVP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G775	DnaJ domain-containing protein	1	214-238	SGNFCKEKDRCKKCKGKRTTSETKV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GDM9	Myosin type ii heavy chain	1	763-787	PHFVRCILPNHKKKPKQFNKLLVLD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GJ47	DNA repair protein rad14	1	297-325	AEFEKREADKKRRKEAKFRDKLNDLKRKT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDY1	ATP-dependent DNA helicase Q-like 3	1	1312-1336	IVEKVFSRLKRRWKITRSSPPEYSF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGU8	E3 ubiquitin-protein ligase RNF216	2	39-66, 241-266	KDLEPNLRRQSKRHERPRSQIQPQPVSP, LGASSYPKKARPKSLKRKRESPAEKD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IIK3	Putative endo-beta-1,4-glucanase D	1	300-323	TPTAPSTGCKRRRAARKARRAAQY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IRN5	Uncharacterized protein	1	23-77	STSTSSPNTGQRRRRRRDFPKRVRRRNPAAHVAVASIPRQQQQPQQQQQPQREGH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IUC2	Uncharacterized protein	1	7-28	QDPPRCKKGWLKWAKAQMHPKY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IV84	Nucleus export protein brr6	1	432-457	MPPRTPSGRRSPSKGDRDRLRSPAKY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IW56	Uncharacterized protein	1	175-206	FWPRFKPSPGSSRRQRRERRSRQYVLPLRRLP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IXR8	Aspercryptin biosynthesis cluster-specific transcription regulator atnN	1	83-104	GYVVKPRKARGRPAAQPQRLNP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4U7	Uncharacterized protein	1	355-376	SSLAPAKKSKTAKRKSSFVTSL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQ61	ATP-dependent bile acid permease	1	432-460	RKIMSWFRSPKKNNHKYKKVQEHRQPATT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JSL5	Uncharacterized protein	1	21-44	NSNLMHSRRCRRTRHERCKSVGSK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FK27	DNA-binding protein	1	256-282	DNKENGSSKKTKKGPKKGDKVSWQWGN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FKB6	DNA-directed RNA polymerase ii subunit rpb1	1	144-220	RGETKEQKRARKAARRARKEAREARRKERALKKAKKSKVVEKADKGQAREESKEERKARRKAKKAKREARKGKTESG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FM96	Uncharacterized protein	1	242-261	QWERQSSSFRHPQKRPWKEI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNJ1	DNA polymerase delta subunit 3	2	158-178, 350-375	ITNPNVRKRDRKGKPVPTPAP, ASSGDGRRRGKRKVMKKKQIMDDEGY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FU38	Uncharacterized protein	2	86-117, 272-292	VDEKLAAKREKKREKRRAYKKRAQERRTLDKE, VYKLAHWSRKSKKLVPKDLIT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FYS5	Duf1264 domain protein	1	186-206	DRDRRFKTDYKEKQEARKHIV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G663	Cell division control protein 12	1	52-76	FSTTIKNYADHKRRHQKQVDKTVEI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILB4	Efflux pump vrtL	1	66-87	SWDRPHDPENPKNWNRRQKWTM
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IME6	Uncharacterized protein	1	566-587	ALSSREKPPKDMKGKRLTQTLA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IRP4	Putative threonine--tRNA ligase	1	23-42	RPQPLPKRWYSDKKPAAPAD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ISF3	GPALPP motifs-containing protein 1	1	4-26	IGPQLPPHLTKRKRNPDDVSADS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IT17	Lipase 4	2	28-48, 642-662	LKTGRSSSIKKQPQSPPRNAA, TSPVLVRKPRLKRAAKSHFNV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IUG3	Regulator of nonsense transcripts 1	1	531-551	AWKAFDKKKSRYKRLAQALQK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IWZ8	Adhesion defective protein 1	1	693-714	GVQNKGKPPTPRMQKRLKGNPA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX62	Retrotransposon-derived protein PEG10	3	377-397, 400-420, 509-533	MTKPNDKKPWNPKCYNCNQQG, AKNCKQPKKLPWKPVAERPRQ, TSHMPDKRIYANKNQRKNQNISMIL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX74	Tyrosine-protein phosphatase 1	2	165-184, 831-854	PPNPTTLRPRPPRWNTHASD, IDMLKRQRHAKSNSRPVRKRDSDG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IYD6	Uncharacterized protein	1	116-148	LEKERRRQQALKQKQARRSSSKKSPKSKSSAMA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IYN8	Vegetative incompatibility protein HET-E-1	1	1884-1910	DTIEARAQPQQRRKNKRGAALHDLKKQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J604	Nitrogen assimilation transcription factor nit-4	1	56-83	QVPAACLQCRKRKVKCSGARPSCHRCLQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J9X5	MFS transporter fmqE	1	435-458	DELFERKIKPWRFHKTQTATQNLV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JFF8	Uncharacterized protein	1	11-38	DDNMRRRESSPRADRRRRPRLLRASATE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIA5	Uncharacterized protein	1	306-325	IDDHERIPRDKRVKPNKLYR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JID6	Uncharacterized protein	2	175-203, 446-465	EDFIVSHPKKKNREKAAKKAQKKAAKKAA, DKLKHFKDKYADKKHKAMKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJV6	Uncharacterized protein	1	92-114	LGLRYTPRTATQRRRSRLRMLVA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JK69	Nitrogen assimilation transcription factor nit-4	1	90-122	VACDNCRRRKAKCDGSRPKCQHCTKRNVECHYE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JN29	Tip elongation aberrant protein Tea4	2	397-429, 568-587	DKELQPDKKDDKKKKDKDKKEKDKKPSAIRSFF, SSEPKEPKPQKVTKAKSRVE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JN44	Uncharacterized protein	1	89-110	NTNKLERKIAKRRSRYLKAREA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JP67	Putative RNA-binding protein	2	15-53, 74-96	GEKKSGGPRNHSNNNNNRRGGPPRRRERDRQEYPRDGVR, EHDSRRGPNNRRRRDSPEQRDSS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JSC6	FK506-binding protein 4	1	282-306	ESKDESKPSKKDKKKLKNNKGEAVA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FC70	Calcium-transporting ATPase	1	1108-1131	GFSAIGRLFRRKPKAKDTESTDIP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FCH7	Duf1168 domain protein	2	9-31, 120-151	IPTSADPRSRRPVKKRALTPVTE, REAKDEERTRKNREKREKKKQRGKKGSAAAGP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FKK3	Pentatricopeptide repeat-containing protein	1	1018-1045	PGFSGWQMKRLRNRHKKNLPLEQRRIGS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FLG2	Coiled-coil domain-containing protein 16	1	289-309	LEARVRRLKEKREALRHQGDA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G004	GPI-anchored wall transfer protein	1	99-119	FPPNTRRKKPVVPPNAKSKAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G4L6	Uncharacterized protein	1	375-396	VLQFHRSNPKKPGPLPKLKRFL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G5E8	Protein kinase domain protein	1	19-39	QDEKVCRKNFEKRPFYFPKDI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G5R2	Nucleoside diphosphate kinase	1	11-32	QDEDPASKHKKQQHNNAGPDAH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8G0	Uncharacterized protein	1	87-107	VDEERSKKKRAMKKLENKGVC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDN3	Uncharacterized protein	1	81-109	AMEQMGTKSKKDKKKKKKQKASEHATIAT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IF82	Uncharacterized protein	1	184-204	ASDTKHKTKKAGQMQDENRDT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJQ0	Arginine metabolism regulation protein II	1	9-37	SMTFTGCWTCKKRKVKCDERPTSCKNCEK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IU13	Uncharacterized protein	1	44-67	RPPNSEPKRSPKRLARPRSNFTPS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IU14	Uncharacterized protein	1	13-32	HRYAPCKKSHIKCNGAHPCS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IW59	Uncharacterized protein	1	50-79	FKRECVFRTGPRTRRPRQSKLNQDAPRPPP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX89	Uncharacterized protein	3	587-615, 988-1016, 1080-1101	DYSRDWSKDARRRAHKRRRKQFLHYFGDT, MDAIKERKERIESKRRRRKSQLASSQTAA, QPISGRHAMRSPKKKGKRKSGF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IY09	Uncharacterized protein	1	270-293	GGLGPVAKARKKKKQKLAILAAVL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J985	Uncharacterized protein	1	50-77	LQKPMGRPRSARQPNRRRRLIQPEHTLQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J996	Putative methyltransferase tdiE	1	271-290	EVVFKWPQNRWPRDPRYKEL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JD65	Mannan polymerase II complex ANP1 subunit	2	21-40, 448-473	ISPHRYQPRATPANRRRQRL, QNAVGGEEKKEKKKEREKEGGGFAKD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDZ8	Aspyridones cluster regulator apdR	1	1-24	MDPGPPHKRRRPAVACTECRRRKI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQ07	Uncharacterized protein	1	366-392	DAKTESPSPTKKKGKRRKELESPVDDA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FUJ5	Ankyrin-1	3	28-56, 174-195, 897-916	GPSKTNRRDVLYSKKSKKRGTWPNGDVVI, VKSPFRTVKEDRKKELQDREHE, DILKRESKDKLRKRLLKAIQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FV26	RED_N domain-containing protein	1	492-520	DEGGHGGKTKRKRGPKKRKGDGNNAADVL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FV74	Spindle pole body component	1	794-814	VMRISTRAPRHQKKASTPGPD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G506	F-box domain-containing protein	2	81-114, 292-312	ASGNLKIRSRRTERRQRKMLKKTAKKSSQPTHIF, VAIKRHSQNKGNKRRHFQMTQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G600	Uncharacterized protein	1	235-256	ENKMRNTKTSMIKKRRPSLPQE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDJ2	Ankyrin repeat and protein kinase domain-containing protein 1	1	47-75	VTVNAKWPRKWRSPWKTTCHPKWRFDEKL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IH57	Sterol uptake control protein 2	1	1-35	MPKGSRQYHGKTKNGCRQCKKRRVKCDCVGPVCAN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILS8	Activating signal cointegrator 1 complex subunit 2	1	637-669	EAARRRKEASKGSRANHNRRDQRAKKMGRGGLP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IP43	Uncharacterized protein	1	57-76	RAQHNKSRAKEKQRRGREVD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITN8	Uncharacterized protein	1	59-82	HAKIDDPRKPKKVKGKCGQPTVDL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J7J6	Putative ubiquitination network signaling protein acrB	2	28-49, 410-432	VGPAKRVSNKKSQPNLDPNPSA, NAAVSSTKKKRKQSTQVRLQQPL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8D6	Uncharacterized protein	1	97-119	FSDKELEKEKKHKKKVFGTAVGE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JFW6	Uncharacterized protein	3	2-24, 356-375, 401-423	LEYFGYKQYKKYKTEKDAKEAAG, VLWYCHKRGREERIKRENAP, TEPLRSDRPRSERSERSRRSGRD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIS3	Uncharacterized protein	3	140-161, 421-463, 897-928	FQLPPPKPPGRRGHQHRRSAAL, ASDPHSKDGKKSRKKKKVKTWAGSILTRKEKRRAKKCKDLDLS, YDGETDKKHKSSKSKRLSRMMRFWKPNKEDNS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JN95	DNA cross-link repair protein pso2/snm1	2	14-35, 122-141	ATPKNFKVSPSKKPARPNASIL, PTEAKPTKKAPGKRKGPFLD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPW1	Putative catabolite repression protein creC	1	171-193	ANTKDAAKKKVPKPKNNMTKSNS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FB57	Integral membrane protein	1	314-336	AGTPVRRNSKKSQLSIRQREVTD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FC49	MYND-type zinc finger protein samB	1	23-53	DVKYCSKSCQNLHWKNHKKSCARTRTANPSE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FD71	Chromo domain-containing protein	3	115-137, 402-424, 1258-1282	CEDFQRNRFDRHQERNRLRIRRG, QSQPSRPPAKKRKSVQWDPQIPF, DDPKSKTIFHPPRSPRPIRASRCEN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FEX2	Uncharacterized protein	2	76-97, 149-178	ATTPVKRKRATPRKKAAPTPST, SPETPAKKKRATPAKKRTPAKVKKEQEEAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FU11	Plasma membrane channel protein	1	640-659	LQKERKERFLMKKRLLEQNL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G5R1	Guanyl-nucleotide exchange factor	1	1040-1059	SRSSTQSKRRRSQPRPGAGP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GAB8	Phosphoinositide phospholipase C	1	2-22	CLYLRRRKAPGDERAPKKRTF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GE19	G-patch domain-containing protein	3	2-24, 184-217, 220-300	GLAQQKSRRKIGKDPNNTKWTKD, SESSEDEKTRKKRRKEEKKEKKRKSKAAKEDVSE, QDDAEKKAKKDKKKEKKEKKKAEKDSSDAESSDEKASKKKSKKDKAEAKETDAEKAARKEEKRKRKEEKRAKKEASRESSS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GIT2	Glucose galactose transporter	1	1-24	MGVKEFLKKRSLRQKDNVRTNAAE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GIX8	30S ribosomal protein S15	2	34-58, 261-297	QTANLSLRERKRKAKSDPYRYQQAQ, LGQNRGYKDKHNKRNLRVLCHRRQRLMRYMEKKERGS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFL7	Anucleate primary sterigmata protein A	2	19-51, 1344-1380	LPTPRDTPHRTPSRSSRKSRRSVTPPNGKKSPS, PDEHEEYRYRARRRSKELRRRQSRSRHRDSYSSRGTR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQ09	Uncharacterized protein	1	11-35	ARLNNGKKKALKTKQQPQVNQKEAR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IR14	Exosome complex component SKI6	1	82-103	GFSSVDRRKRGRNDKRNQELEA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IZ67	E3 ubiquitin-protein ligase TOM1-like	3	3024-3044, 3205-3226, 3280-3304	QQERQEARRRERDEQRRQATT, QLSLKAKKPKDKDTEPRTPQNL, GSSLKRTLSRKGKTKDSKSHKYAIN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IZU0	Uncharacterized protein	1	76-101	TNHLAIGKKWSQKRERRWNWHEWTFE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4P7	Baeyer-Villiger monooxygenase	1	501-521	ISGPTHPGRRRSTWRKPAMIA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J5D4	Zinc finger protein klf1	1	23-50	QALHPRPHSTPVKRRRRTGHGPDARSCP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J7M2	Uncharacterized protein	2	106-127, 301-339	ARAEAKKRPGRKPRGPATPPPK, TVIEKLRPYMKHRKLRKETKLKRFKKKRVDRWRGSLGGL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JB21	DNA-directed RNA polymerase I subunit RPA43	3	6-55, 72-101, 103-152	SPVTNGHKSDKKSKKDKKEKKRSREEDAVEGEERKHKRSKSVVPKDDDNN, STTNGEPSSEKKRKHKKDKHRKSTDEAEAD, DASDAERKEKKDKKKKRKSQGLEEVSADTPASEKKEKKSKKSKAAAVAEP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGX1	Uncharacterized protein	2	6-25, 96-121	EEPVKRGRGRPPKVPGEKKV, SAAAPTPKKETKKKARKSDASTKDKE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JKE2	Beauvericin cluster-specific repressor BEA4	2	5-30, 51-72	GKPSKGCSSCRERKIRCDQKEPGCGQ, DESAHVKRKATKTRARISGKPP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JL10	Rho-GTPase-activating protein 5	2	447-469, 575-600	TGEGEKRQPNKLKKKRIPGSLNP, EAIEQEKEKKRRWRLSRQRKDDGHPG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JM20	Putative transcription factor lepB	1	6-36	SQRQSLACRECTRKKRKCNKEIPCARCNRLG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQI9	54S ribosomal protein L31	2	15-41, 77-103	LLWKIPWRLSKFQKRRHRLRLRAVDDV, KYTMFDRKEKRYRKGIHKLPKWTRVSQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JR68	Protein pob1	2	275-300, 662-685	TDECSLKPRKSSRRRQKKASHDDIIT, VTFQGPMKKRKTKMLRHEWNDTFC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FID4	Uncharacterized protein	1	277-307	REHHKNNPFARAKKRRDKKSLRKRQGANMDL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FKX0	Acetyltransferase BOT5	1	2-25	EVLRTIFKRSKPKVVQPPKVATDD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FQP0	Ribosome biogenesis protein	1	4-35	KASGEGLKRKRVPAKEKSKKRAKSESESEPES
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FT13	Proteasome regulatory particle subunit	1	19-39	QNNKKDEAKNKSKKAAKDGDE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G1Z9	Ino eighty subunit 1	2	456-478, 553-576	ILDRGIRKQHHKARKARRQDGAI, GPPLGVVPARKKRKQNGVEDGHER
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G648	Nucleolar protein 16	1	1-32	MGRDLQKKKRRAGQKTRQPNRPKKLLNPLGND
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G6U3	Alpha-mannosyltransferase	1	606-629	AESSTSAQPRRRKNQQPQEYIDED
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G9T8	Methyltransferase domain-containing protein	1	1-24	MAKKRRTKKRKGTRTKQDPAQGAS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GGZ9	DNA polymerase	2	87-109, 157-200	TIQGRGRPSKALKKQREDEVAKR, PVSRSGGKRNRSPERRRARVLSPAPETRRPLSKRPKTVDDRLPS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFL4	Putative transcriptional regulatory protein	2	16-42, 44-67	SLSCTACRTRKVKCDHRRPVCSGCEKY, GECVWPERKKSIRRGEKKLYENIV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IIH2	Peroxisomal membrane protein PEX30	1	485-506	GSDGWGRWTRRRKWYRDAELVE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INJ9	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7	1	144-164	GMMQLQRKMRHGRKARIWYRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IPI9	Nuclear GTP-binding protein NUG1	1	1-60	MAGSINKPKKPKSKRTPVRLRHKIEKASAAKQRKQRKLAKKNPEWRSKLKKDPGIPNLFP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IV55	Uncharacterized protein	1	107-131	LPSAGRRRAETRKLRHSLRKWLKGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX93	Uncharacterized protein	1	12-40	TTAPQLFTTRKPRRVHKKKAPNSRVVASC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J063	DNA polymerase iota	1	1-22	MELPRKRAPRRKDDRIILHFDY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1R9	Glycine-rich domain-containing protein 1	1	660-682	EETHSKARKRANKTFKADQGKRM
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J6V3	Uncharacterized protein	2	52-75, 353-382	PSSFAPPPRRDPRQPIPPPPPRST, LVNALGKKKPPPPPPPKKKPQIGGAPQPTP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8A2	Replicase polyprotein 1a	2	10-31, 126-145	AASTHHMKTRSQRRREQAEAEA, HSESPPPSPKKPRLEKDDSG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JAX4	Oxysterol-binding protein-like protein 3	1	209-235	NANYHTGILHKRRRKKGQGYARRFFSL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JM07	Putative transcriptional regulatory protein	1	24-74	DAAASLQQKPPPRKRKSTPRSREGCLTCRTRRVKCDETKPKCNNCIRHQSG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JNE4	Uncharacterized protein	1	60-84	QSALRRYSKAPKRDRKNVQNWHFNH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JP73	Uncharacterized protein	2	1-26, 41-65	MAQKKNSKRAAKKKVQAKARKAAREA, VELFAEKKKLTRKEKVKLDKGKGVA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQM4	Transcriptional activator of proteases prtT	1	69-89	GAACAQCRGRKQKCSRPGGGS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FKH6	Cryptochrome DASH	1	557-583	FSVEGKPKNGRRQYANRRRGRGNQNGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FLY8	Elongation factor tu gtp binding domain protein	1	80-100	SYLKKKFIDPPPKQEPKKTKD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNH8	Exonuclease 1	1	704-733	LSPTKSAIQRSPKRSPRKSRLLKSMPVNPS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FS02	Uncharacterized protein	1	206-225	QAKPPAKKARRSKAQARDMT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FTX2	Transcription activator AMTR1	1	2-26	RSHHGCLTCRQRKLKCDEAKPTCGQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FX89	Chromatin-remodeling complexes subunit NGG1	2	127-153, 550-573	KAEGDSKKTGKTNKKKRKAADTLAPQD, AAYLKRTRTMGKSKKNKRPGGAGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FXQ3	Ras-related protein ced-10	1	179-199	RAVLNPRPVPQQKKKSKCTIL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GEE7	Peptidyl-prolyl isomerase CWC27	2	213-232, 262-283	KTVVVERKKKRKGGKQLLSF, EPAQTKTKPKKAKTKENKVESA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDF0	Uncharacterized protein	1	185-209	LIKKRLWKNLRPWPAWKKKIQNDED
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IEG8	Uncharacterized protein	1	413-432	ATHWLPNRSTKNKKIPMFRA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFY1	60S ribosomal protein L44	1	4-31	IPKTRMTYCKGKECRKHTQHKVTQYKAG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJ44	Regulatory protein GAL4	1	27-54	ASADQACKECRRRKAKCNRAIPTCNLCV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJU9	Nicotinate catabolism cluster-specific transcription factor	1	27-74	HECSICHKRYERSDHLKRHVASHQNSRPHACHRCSRRFNRKDLLTRHL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IMF0	Uncharacterized protein	4	1-24, 223-243, 266-289, 553-581	MEESAPKRRRTSPRLSRERDEANN, HDTPSKRKRRPASPSKSSPLK, SVTREKSPSKPAKKTRTRKGPAGT, KLVQSVAKIRTRRKKRRRKDDDDPSQDAD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ISR6	Telomere length regulator protein rif1	3	63-82, 1155-1176, 1545-1584	DSTNPSIRRARKRVGFSAKA, KLKAQKVSKRTRGKARTPTARL, STTASSPDKSGKKKRKRGSSKYDTRRKKRRSVDNANEVVS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J3R4	Uncharacterized protein	2	94-121, 284-306	NANSPNPVMKRAKKQKTKLLYPFQKDHL, GFQCTCKPRQVCRQRRQRIGLAF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4B9	Putative transcriptional regulatory protein	2	26-61, 378-400	TESQQAKRRRINFACNYCRNRKTRCDEQKPSCRACI, MGLNKPRTCRRKCQNKKPDALDD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J7X0	Smad nuclear-interacting protein 1	1	19-106	DEEERRRRDTKDRDGHRRRRSREREGARNSDRHRERRRSRSRDKRERRRLRTPDPSARKRSCSRDRDRDRDRERRRERSPRDDDRRSS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JAR8	Vacuolar fusion protein CCZ1-like protein	1	35-63	VYYASVSTQRQKRRHRSRSKPTENISQEE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCI0	Protein transport protein sec73	4	23-46, 157-178, 180-199, 666-687	LPQHFPPQQPQQQQQPQQEQQPQQ, DFQVPQKKQSRMRLADRFRRSV, SSTSFFRLGRRKPKTPSPMF, GLLWRKDVKKKKTRSPWQEWGA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JLK3	Zinc finger CCCH domain-containing protein	1	355-374	SNTGKCKTKGCKLLHRERAS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JLR5	Cytochrome P450 monooxygenase FCK2	1	15-39	LEPLITYLRDKKRLRRFPNATYFSG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JM92	Uncharacterized protein	2	22-47, 81-105	RMSSRACHRCRTLHKKCNIRSRGQTC, ASPLSKTRSRTRGDRRRSNRPLLAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FGD2	Iswi chromatin-remodeling complex atpase isw2	1	56-88	AAEKKRKAALLAKRRKKKKVEFTKEEREKKAKE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IEG0	Uncharacterized protein	1	25-49	APPEPSPTSRAKRRRDTEAQPARPS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IH25	Uncharacterized protein	1	281-328	IPPTPQRNHPPRDRNNQNRHGKINRQDRRQDRGRRNKHNNQSKRDPSQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IHH8	L-xylulose reductase	1	44-63	PFHSTQSRNHAKPKNPKPTD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J081	Uncharacterized protein	1	65-88	LLLAHRYKYELRRKRRPNPTSEGE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1K2	Uncharacterized protein	1	276-298	NSSGFRRDQWRQRHQARRNETSR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2K2	Uncharacterized protein	1	26-49	LPEPSPTSRAKRRRGTEAQPSQPS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2K3	pH-response transcription factor pacC/RIM101	1	109-131	KCEFCGKSFKRPQDLKKHVKTHA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4P1	Putative enoyl reductase	1	4-26	KITLKLSSRSPKQPVKKLPESIE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J732	SEH-associated protein 4	1	897-919	EVESTKKSKRGGRPTIKPPSRQI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBH6	Uncharacterized protein	3	17-39, 140-161, 163-184	RSPTWPASWRRWSPKKPWSSKVA, MRNTRCRIRRLLRLHRRRPGSR, GGNATKSPRKAKKTPQEPVKTH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCR5	Putative transcriptional regulatory protein	2	11-30, 42-62	NPSRGSSRLPVNPRRHKVAP, SCNVRRIKCSGERPCRQCRGS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJJ1	Uncharacterized protein	1	124-155	EIPSSRRKKTKASRRKDKKKSKKHVSSSEEDS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JL49	Mitochondrial distribution and morphology protein 10	1	373-402	PEVKPRLVVEEKRKKKPRERSFQAKMEWRL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FPM6	Glutaminyl-trna synthetase	1	28-53	MVSKGELKKRLAKRAKKAATEKAKAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FQQ4	Uncharacterized protein	1	81-100	RSPQRLSPPRQQPKREQAGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G2P7	50S ribosomal protein L1	1	36-67	AQTRCASVGPKKTEKKKRKLPKDYKTYNIKGC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8K0	rRNA biogenesis protein	4	12-52, 100-129, 1453-1478, 1710-1735	GTPPSKSAKSTKASRPSKRDTPTKDRKQDGGKDKKSREEAP, EFDVNEKSKAKKEKRRKAKEAKDTDAKHAR, EPAEGKKSKASEKKEKKKGGEIQVDR, ERGTKAKGLKAKKAEKWFKRWADWEE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GA26	GTPase activating protein (Bud2 cla2)	2	216-242, 1192-1217	ATNSLREKKSSSKRLIKRQSSRPTSPP, YMETSSSRSREQRRGRDRSSMRQNSG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IC97	Uncharacterized protein	1	202-227	EEREQREKERSSRRKRTRRDSDLSSS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ICP6	Uncharacterized protein	1	127-150	IPIKIRKTASNRRRRNNKSTPPGI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGZ2	Uncharacterized protein	1	60-83	SKNEPKKGEPEKKSESKKKNETED
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IKH6	Uncharacterized protein	1	2-25	GYRQKFRVTRSWHTHRFRRGLRRA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQI4	Uncharacterized protein	2	17-42, 130-149	GAIKAYKEVKRRLKLFRHSSREVKNV, TKNSNGKLKRSLKRTKDCVK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IT53	Transcription initiation factor IIA large subunit	1	327-346	LCMYDKVQRVKNKWKCILKD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J447	Uncharacterized protein	2	1-23, 699-720	MARVLSEKRKRKCDEGDNKKAAT, ASQKPVPRWKLGPRARKPARAV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J904	Uncharacterized protein	4	179-204, 319-343, 570-604, 1166-1188	REVERKSSVKKKRLSPLPPSPPPRKS, TPAPRPATSDKKKERPTRTPSPGTS, TATPPKKLTKRARSPSKWKLFSRSRSQPNKKEPEP, MGNRGRRTIRRLKERIHERNPEI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JB33	Uncharacterized protein	3	86-108, 468-495, 501-520	DFVETTKRWRHHKGRANKGEVKD, ETKESQPSKEKSKKGSRNKAAVYKKDKA, TEDEPKKVSKRNPKGVDLSK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JFU0	Splicing factor ESS-2-like protein	1	19-44	DLMPPPPPAKKIKRPKKVIDEDTYTD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JG62	Uncharacterized protein	1	6-31	GPSVPRKKTTTYGKTSRKRPIHAFLE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JHK4	Vesicle-associated membrane protein 714	1	194-216	REFRVRSRGLKRKMWWKNVKLMA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIC1	Putative transcriptional regulatory protein	1	2-21	CDACRARKIRCDRETPCAHC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIK4	Secreted beta-glucosidase sun1	1	34-53	AQPHNHRHRHVKKDTASPVE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FC30	Uncharacterized protein	2	311-330, 473-494	IPEPSKKKLNHSDRKRMTSR, QQAYAKRKRREESEEQHKKDPN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FFM5	Alpha-xylosidase	1	50-72	FAINRRFFRKHKPLIKETEHRLE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FN62	Cytochrome P450 monooxygenase gsfF	1	118-138	DVFSCKSDKKHGQRRRITSSV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FVF3	Chromo domain-containing protein	3	37-56, 561-582, 599-620	SSPAKPSRSQSPHANKRLKS, AEEPAPKKPRAGRKKVPEEAEA, TETDGEPPKKRGRGRPKKTPVS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FVK4	Zinc finger protein	1	213-234	NSAAHTKKIYHCPNPRCRKAFN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FYF8	Putative tyrosyl-DNA phosphodiesterase	1	24-49	EGPRSLSRPISPPRKKNNGGQRIKSP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G3H4	ABC transporter	1	457-485	AKTIEKDKKKEAEKKKNKKKGKEESDDEE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G3S8	Uncharacterized protein	1	255-279	TSKSDKPKSDKPKPRSSNKRNFFVA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G7Q9	Low-temperature viability protein ltv1	3	261-281, 291-312, 375-400	LEDFKKFKKDQKEGKPQAKAA, TTTTMGGRKKKRKGALTNPSTY, FLGSYTKPGKRTNKKNKAQSGLEQLD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GEU6	Uncharacterized protein	1	13-33	TIYWDRSDKRLRQNPDCRVFG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GF98	Mitochondral 37s ribosomal protein	1	82-103	GLKARGKSAPKKAKEKVVKKKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GFC6	Uncharacterized protein	1	15-34	AEQARLRKAKREAKIRAGGT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGD7	Uncharacterized protein	1	164-185	IRYFNRNTYKKKRQAGQPQTIS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGL7	OTU domain-containing protein 2	2	19-46, 114-133	RDLVGRITSKKKNATKKTRKGVNDECAD, GGGGGKKRNRQKERLARRAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IL77	Retrotransposon-derived protein PEG10	1	310-363	KIDNRLFERRKEKGEKRQGPNTGRKYQWQPQHKFNNQRNDNRPRSNWNNKAPLT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILV5	Transcriptional regulator of form adherence 5	2	23-48, 124-150	DASAGVKRSRRESRQHRCAYCPKVFK, NRSPRRQSLFSPEKRRKKSPLPTTRDA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IUJ5	Uncharacterized protein	1	45-70	SYAPARGRKPPGSRARRSNKLLHVPD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IWE9	Transposon Tf2-6 polyprotein	1	914-933	TTHGNQPKTSPTQQKNSRST
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J128	UBP9-binding protein bun107	1	684-706	ADSKEKGKDKDKKDEKDKEKDAN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2Q9	Oxidase ustYa	1	41-66	EHATEKLKLTNRRHRWQQWNLFRWLD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J483	Uncharacterized protein	1	180-200	TSTGCKRKKKGDCKTLDSKPD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JFV0	Unsaturated rhamnogalacturonyl hydrolase YteR	1	387-415	HGGPKPPRGGPKGPRPGRQFNRRFQKTYW
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJ42	Acyl-CoA dehydrogenase family member 11	1	45-66	LTSATSKRYVLRKKPPGKLLSK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JMV9	Store-operated calcium entry regulator STIMATE	1	93-114	LLSLVYKRWRERPQRPVKIWFF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FEF2	Sac3 ganp domain protein	1	211-232	EPLPKSSKFQKQLEKRQRRFDG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FG11	Uncharacterized protein	2	10-34, 113-133	ESLGKEPIGRRRRRELLKRGSEWFV, ISSRNCHRVRREIKSRRSYDE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FU41	Uncharacterized protein	1	167-186	FDVAYHDKTRPGRKSKNGKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G0J8	ERF-3	1	629-653	LLHKLQKGTNRKSKLPPSHAKKGDS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G4R5	Uncharacterized protein	1	424-443	ALECKNRQARRAIRNNPVPA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8V7	Ribosome biogenesis protein ENP2	2	19-45, 599-624	TARPLPDWLARRRKRSLKNDPEYANRV, EKQVTFVPDKKKKGRGPPQQQEESAP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GA75	GTPase-activating protein	1	636-656	SQSEGTRRKQQKQQVLGPYKF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GDL0	FAM50 family protein	1	70-95	SDSGSGASKPKKRKKKIGGSKLSFGD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GE96	Threonyl-tRNA synthetase	1	20-43	LGSANKDKAPKKEKKAKNAGDASA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJT0	Uncharacterized protein	1	76-106	SAPQTPVPAQKKTKRKRKRNEAAESKKRSVT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITN2	Ankyrin repeat domain-containing protein 50	1	1-21	MTDTSAKKRKNDEEDDQRGHP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IUC3	Kelch repeat-containing protein	1	493-513	AGCFCFIRRRRTYSRERHASA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IWS3	Uncharacterized protein	2	1787-1822, 1912-1940	KSSQDVKKWKEKGSDKKKKKGKEKAKPRLKTASKDE, EDKPEDKPARMNPRNKPNRNNSKPKAEGT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J0P1	Transcriptional activator protein acu-15	1	26-55	AQTRPQACERCWKRKQKCDRRLPACNSCSV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2B7	Protein argonaute	1	226-249	DEGLPPPKSGKPRRKDDNKFFFVI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2N7	Uncharacterized protein	1	292-314	LTEEPTKREWKKVRIDDKHEAID
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J6T9	Uncharacterized protein	1	16-42	RDRADSCTYRTRPFKKKRGHCSYVEPA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JA89	Uncharacterized protein	1	27-46	DPVIRFKNWRSDLKNNIRRL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBC0	Sterol uptake control protein 2	2	86-111, 211-258	HHDSWCSSFRKQKKLRAIPTDHTRPV, GGPPRRSHTKSRKGCDTCKRRHIRCDENFPQCRNCTKHKIRCPYNDMP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBV0	Uncharacterized protein	1	107-130	LVATSKAVWRKRRLERLKANLADG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JE35	Uncharacterized protein	2	52-72, 75-94	FDELRRLKRRKVDGPEAQRIP, AKGGVARRHHHRNRPPAQNE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JEU8	Uncharacterized protein	1	881-900	PPPKSTTSTKPPPPKPTEQV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JHS5	Nitrogen assimilation transcription factor nit-4	1	32-52	ACLGCRQKKTKCDVQNLQPGT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JK22	Uncharacterized protein	1	71-170	RDDREDRRRSRSRSRSRAKDRDRERDRDRDRRDRDRNRDRDRERDRDRDRSRDRRDRDRDRDRDRDRDRDRDRRSRRDRSLSSRRDRRDRSRSRRRSRSR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPL6	Aspercryptin biosynthesis cluster-specific transcription regulator atnN	1	6-34	KASQGCQNCRTRRIKCDKVKPECSQCIRV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQP2	SET domain-containing protein 5	1	421-440	WSWMLRTRKRYSWGEKRVVE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FBU8	AAA family	1	11-37	AYSSDESRPQRPPRRRSRSSDDEEKTK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FLS8	Cocaine esterase	1	30-50	NPSTRKLPKEHRRTVENKAFE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FQI5	Protein-lysine N-methyltransferase EFM2	1	29-48	LSPPIWSHKRKRSEIVHEQE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FWN6	G-patch domain protein	2	236-259, 272-310	GWDGKMRGPNKKRPTERRQNQLGL, QWNHGGKKKSSRPRLDEYRRDEEKRRTERKERRGESYRD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FXB2	Regulatory protein LEU3	1	55-79	GEPDSKKRQPGVKRACNECRQQKLR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G414	Nucleolar complex-associated protein 3	3	1-39, 41-69, 361-392	MSSSRAPKRRRLTPPPEDDEPKSRSSKKIQKQFFKSAAG, DLEQDYENRKHKRGKKDKKESNRLPIKTA, GAPPPRKAFKKEFRTKKQRKQIKEQKQIEKDM
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G7B4	G1 s regulator	1	560-579	SSKTQAPPAKSKRDLKPGYC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G830	Cyclic nucleotide-binding domain-containing protein	1	958-979	GRPHALSIRRRARKPVRFIVEK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GG48	Uncharacterized protein	1	189-209	DPRYWGKRKSEGKKNFRLPFT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IC22	Sterol 3-beta-glucosyltransferase UGT80B1	1	834-859	DTLCRISEEKKEKKGRKSDEPELMER
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJB0	Uncharacterized protein	1	100-130	AQPKNRVIRTPRPRKFLKRRPNSKLRTSFKL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IK62	BTB/POZ domain-containing protein 1	2	1314-1339, 1516-1542	ASPKPVQPKMSQKERKKQQQAQAAAQ, GKAKGERSSKDSKRGRRGRGGGKGKGA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITV5	Heterokaryon incompatibility protein 6, OR allele	1	7-29	AAARNIAYRHRRHSPRQGAVKTV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1U1	Putative transcriptional regulatory protein	1	5-37	TGRNKVTKRSSNACVRCRRQKIKCSGSQPCDAC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2L8	Vegetative incompatibility protein HET-E-1	1	41-65	AIDQIQTKLHHKRRQLNLTKLRSFV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J489	Coiled-coil domain-containing protein 25	1	179-200	ARVMQERKEKKWQKDHAYDDIF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J5U7	Conserved oligomeric Golgi complex subunit 5	1	6-25	DAPPPPSTKHHPLRLQHTAN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J9F5	Uncharacterized protein	1	1-20	MVPRPPRPRRTSPSIPPPSP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDG3	Cytokinesis protein sepA	4	9-34, 1486-1509, 1543-1573, 1640-1680	QSSGGKSFFSRNRKDKRNTSDEGRYL, IGEWKKSREKNIKYEEQRRRNEAS, KLRAAAPQTRDQRDRRRRARLKDRHQVRIAS, DADPEKRESLRRSRRQTAEEERRMRRRRREKASSTNTAAIS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JG66	Sulfite reductase [NADPH] subunit beta	1	1249-1268	QRDFGDRKNRKHARLKYTID
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JI04	Clock-controlled protein 8	1	183-206	SAQSLEAKHRRQKPQPQQPPPALT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJC4	Bikaverin cluster transcription factor bik5	1	132-156	MITSCLECRRRKLKCNKSQPCVNCM
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JK92	Uncharacterized protein	2	75-102, 474-498	PAEPAPRTSGPKKKKKQPNIHTPVARKV, GSQLEGRKDRKTQWRRVQDDFNDNE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JL96	Putative transporter	1	488-507	LLSRENQKREQGKRNCWSDG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JM83	Uncharacterized protein	1	170-189	DLTGHRKRFAKKKLLYRLDR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPB7	NIPA-like protein	1	462-503	DEKSRDAKDKERWARLRRVKSLFESKNAKKIRRTLSRPGTAR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FEE9	Kelch repeat protein	1	14-39	AAKAAAKKAKQANKGEKKAKTKAAKL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FGA8	C2H2 finger domain-containing protein	1	64-89	SLVGHQKGKPHKRRVKQLKEEPYTQK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FJK1	Duf1275 domain protein	1	35-56	GGSSRKPTKSLRKKLTTDVQRD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FSF9	Alpha beta hydrolase fold protein	1	74-94	TYDGWVRRKIQKAKNINDRVV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FU53	O-acyltransferase	3	11-35, 75-94, 525-544	ATHDQVLRPRPRKPQHSQLTRTISN, MSSARKQARAEQRRRIFPTI, VVLQRTKWVRGKKTLNNVCF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FVK2	Condensin complex subunit 2	2	39-58, 224-246	EEKARRAQSRHALQERQKNE, DEDGNVRKKPKRKTQRSSEATLA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FWN9	Replication termination factor 2	1	197-228	GLTHGLKKEKKDKKEKSKKKRKAEDVDAKDDG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G3E5	ABC multidrug transporter	1	1363-1384	FSVARAVLRRRVRRRETGVDGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GIP6	Uncharacterized protein	1	322-343	QYATQSKFSKHKHPSKVRFGVL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFF4	Phospholipase D1	3	232-264, 375-394, 1738-1762	DEGNATDTIKPKKKRRMRRSKKDKPQMSVPSTP, KYVKNTLKLLRQKKEDRFDF, QAQGSVKRRRRATTKGSRRGQPPEE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INY8	UDP-glucose:glycoprotein glucosyltransferase	2	1227-1249, 1403-1422	VTFKWPHWLRQQKEKQREIWGYK, CNNPQTKEPKLDRARRQVPE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQ80	Structural maintenance of chromosomes protein 4	3	36-58, 61-87, 138-164	FEPEPSKSPVRRPTRARKSAAAS, ASTSTPTTTAPRRRGRPKKNVEASVVE, EQENTPRKPSPTPRKPRKSAAPKSATP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IRV9	Uncharacterized protein	2	20-45, 882-910	SEDLTKNKPKKPDPSRLHRNIRPSSL, TDSAKSDPERDTRRRKRDEKRLQLDLTKH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITJ3	Uncharacterized protein	1	28-53	EKQPSGIKSPHRHRSPARRWNGDGKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITS7	Ribosome biogenesis protein nsa2	1	1-28	MPQNQHIKRWRKRHGKHYTRYREASKKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J0Y9	60S ribosomal protein L15	1	165-203	TATGKKSRGLNKGHRYNKTRAGRRKTWKRHNTLSLWRYR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J5Y9	H(+)/Cl(-) exchange transporter 3	1	67-88	LEEPLSFKRKQKQNVLSTPGRF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J7Q6	Vegetative incompatibility protein HET-E-1	1	36-56	FKDMKRLSKAKKKTGFVKIAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JAM4	tRNA (Guanine(26)-N(2))-dimethyltransferase	2	64-92, 617-638	VVERRAAQPASKRKEKKRRRAAGDDGGDR, QLGKRTQGKKLVRYQMNPRENW
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBR1	SUMO-conjugating enzyme ubc9	1	4-23	CQNRLQEERKQWRKDHPFGF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCZ1	J domain-containing protein spf31	2	165-187, 193-220	QDEETEQRKRKRQHEQDWEATRD, WRSFQKGKSGDGKKKKKMKPIGLGLRIH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JMI2	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit	1	20-46	GTPSRGDPLRRTKTEKRPEPDRQPSLF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FFK4	Homeobox protein ceh-14	1	100-123	INNWFQNRRAKAKQEKRHAMNEEK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FHA3	Pectate lyase	1	47-76	RAEKANPSKTKSAKKPKKTHATKTRSPGSI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FK69	MFS monocarboxylic acid transporter	1	38-64	SLDLLHRSSSHRRRSRRSANTWRAVSF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FVA0	PX domain-containing protein	2	828-849, 893-922	IAWQEARKKWHHDKTRQKMAAE, ELDPIEAERRRRAKRRDRLRRSAGEPVKPP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GB18	Structural maintenance of chromosomes protein 5	1	1-21	MSSFPASRRRRREPEDESDSA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GEL1	Serine/threonine-protein kinase RIO1	1	496-553	EGDSKFDKGRPRGRKHEDKGEKKAHKLAVKEAKREKRKDKMPKSMKKKLVSSSSRKKH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GJL9	Double-strand break repair protein	2	510-535, 604-627	QFSKGLLKERSKRKIKPKPDDWDSDM, AKKAAPAKKAPARGRKKPLFEEED
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IE05	Uncharacterized protein	1	322-345	QPQYTSGKPKRAVRGKDRARTLLR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IHZ7	Vegetative incompatibility protein HET-E-1	1	1-20	MSCQWLKKFKSSFRKSNSAS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INW7	Uncharacterized protein	1	249-270	EEKPAEKKVKTGKPGRPPKATN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITT1	Ribonucleases P/MRP protein subunit pop1	4	5-24, 101-180, 191-229, 622-647	ASKSKPLKSAFANKRKQGPP, VPRGMRRRTASHNAKRVPKRLRRRALKEMTEDNTPVVISRRRKPKTTRARIRVETAKRLGFLAEKKRRRQMKAAKAKAQD, VTTRAPRSKIRRNELNEPPKRKSKFRKRQINKTWLPTHL, ELEERAKRKRDWERRPKSKRVAWESL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J3S7	Uncharacterized protein	2	11-32, 126-147	VDRFKGKKGSHRIQKGRYTLQE, TVANHGRKKGRRRNNSMIRILE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8E4	Lactose regulatory protein LAC9	2	21-43, 102-124	FTQHKRTCYSLSRQRPRQVSQSC, TTPHACAECKRRKIRCDGQQPCG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8U5	Uncharacterized protein	1	22-49	SASARQPRSVIRRSRRNVDARPFRRRAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBN7	Uncharacterized protein	1	78-98	EFFLRWRKFWRMRTVCRRFND
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JG69	ATPase family AAA domain-containing protein 3A-like protein	4	47-83, 109-153, 237-261, 349-383	TDRTETSKKGDAKKPKKTDKTKSKKPKKSVLADTSTS, SASEPDTKRKAKSKKQVAKKSKKALSQPKKTKKSKKVSGDSSDSD, LGVKRAPAPSKKRNGKVKLDYKRVD, LRAYSKKLKKQEPKSSEKKARKKQQKHIDDKRMHL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGS0	Putative cytochrome b5	1	1312-1350	SRYGRNRGKMDVKRRLKEKHRIQRLRGKKTPGIRPRPDD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JKC3	Uncharacterized protein	1	400-420	YEPLGPRKWFRRQHHRSPTVS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JP18	Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein	1	669-690	NNIPRARRSPMPSKRSPRPLDA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPP2	UPF0743 protein	5	9-30, 56-84, 203-232, 269-291, 300-331	CGDVLTKKKLDPHRNRCRGATY, KYQGALYKEKNNNNNKKQNNRNNIQPQNV, APKHERRRKDGSEKKDKKRKRLHVDTDQMM, PSPLSPLKKTKHSKHKKSSEGGI, NMNTSSKTKAKKRKVSSSSKKHSSHRHRDGEK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQ30	Delta-1-pyrroline-5-carboxylate dehydrogenase	1	12-32	VKVNSHSTRRQLNPSKHREAV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JRF1	Uncharacterized protein	2	51-76, 97-116	FPQASLKLKRSRTKPNVRPRQANIPD, SVACGHCRRRKIRCIPSPSD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FI76	Allantoate permease	1	467-486	GLRICLRKANHKFERLRSEV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FK77	tRNA-intron lyase	1	457-480	DIPSTPTKPMKRRKSVRFSPKVES
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FN17	Cell cycle control protein	3	13-121, 163-182, 673-708	AEKGERERIEREKNERRERKKQRSHHHHHRERDRSSDRHRERDRDRERDRERDRDRDNDRHRHHRSRRHDEDEEDGHRHKRSRHFRDDEERRSRRHRDRDGGRRDEKHE, DYVQRKEKEKPPPPKEEPIR, APDVIKKQGRWNKGDRRVEGFKKKWRKFDWTRVLTD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNS6	Transcriptional regulator	4	93-112, 118-140, 145-164, 245-283	ATSPPAKRRKRASAAKEEEP, EVEKPKAKKKAAPRKKSRATVDS, SSVKAKPSKAKNGRAKKAEK, VIDDPPKPKRKKKEAGAPKAPKEKKEKKEKKAVAPENPD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G329	Replication factor C subunit 1	3	15-42, 224-249, 984-1038	APPKPAPKKVEEPPKSRRGRKVVEDSDD, EEEQPPQKKKAPAKPRAPRAKKADVP, LDLKGDKYIKQPKPKAKRATKKAKAEEDEDDDADAKPKRGHPKAKTTTAKGKGKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GD39	Ser arg-related nuclear matrix protein-like protein	2	92-114, 409-428	TFDAPIRTSRRRNYPPPPTCEDE, RETKRTPTYKRDSPRRRDDS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GH24	Type 1 phosphatases regulator	2	106-125, 128-154	SADHKGKGKSNKKQNHDCDD, GHSHGRKSDRDGKQKRRPSPNAYERVP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFT7	Uncharacterized protein	1	676-704	APPPAATKTQLRRTRQRRGEDQTQNPDRP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IIG2	Activator of stress genes 1	2	106-151, 639-662	SNTTPLPDSGRRRRHRDKERVRVTRACDRCKKRKIRCTGIQPCELC, NFARLQRNGKSRRRSVPHKDQAGD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IIX4	Uncharacterized protein	1	256-277	VWSKLGGRFRRHRHGYDKCTQV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IM71	Uncharacterized protein	1	30-58	ASSVSSDGSTRRRRRRNRNKQVAQPKGTL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IS89	Uncharacterized protein	1	236-255	GYPPRSQSRSQSRTRRPSDA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J6X7	Nipped-B-like protein B	3	10-42, 47-72, 116-183	YRPPTPPPQSHGQKRPPPQKRHSQQQYSPVPPP, LQPRDSFKPARVEKRERERDLPRGDR, DSESPRRERESPRRERDVPRSRDRDWDRESPRRERDVPRNRNRDWDRESPRRDRDRDRDSPRDRDRER
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J9B2	Uncharacterized protein	2	299-320, 923-944	ILAICLARRKRRRDYPDVKTGF, QPPPRSHRRISQQQQQQQQQPN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JHN3	Uncharacterized protein	1	573-593	TVLAWRPRLRRHRSASAVTTK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FL31	mRNA cleavage factor complex component pcf11	1	660-681	PEPVHRKRKAEGDHKSHRGRVK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FLR1	Pre-mRNA-splicing factor prp1	1	102-127	WKEVDEKMAKRRQKQREAREKAEQEE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FMT2	rRNA processing protein	4	14-45, 122-143, 375-397, 419-441	DKGVDFQKKKLDRKIKAKHREAEKEKAKKAKL, MEKVERPAKKTKTNKKTPTEVE, SGVNAKRQKKNDKYGFGGKKRHS, GVAKGRVTKTRPGKNRRKSMSNK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNB3	Lovastatin nonaketide synthase	1	931-950	QYWHESRRSRRIRLREEPFH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FRY9	Fructosyl amine:oxygen oxidoreductase	1	392-419	LEGKPRGLRKEWKYGNRKSKPVATRPDT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FSJ8	Sphingolipid long chain base-responsive protein PIL1	1	271-292	KLSTRARTLSTRRRNNIKARAE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FVZ8	Serine palmitoyltransferase	1	1-20	MPQTEKERRPSRSGNRITNF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FX61	GATA zinc finger domain-containing protein 7	1	10-37	RPSSPTHELSPPRRRRRSSPKAKPVGAP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G5A7	Uncharacterized protein	2	23-51, 85-107	SDGNKFAEKQRQRQASKKARERTNSFKSL, AVDRDVEKTKWRKNPLRAAARSF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G5F2	Fungal specific transcription factor	1	19-50	PLKRKQVQQACESCRKKKKRCIHAEPAHSEPG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GHR5	Uncharacterized protein	6	20-42, 102-131, 135-161, 178-204, 211-245, 761-782	EEYCDSVQRRRRKTSIGRQRISV, PDPDCKCRDCKIGRRRLRKAGKGDKEKAAE, SEEESKPNEKKKSKVDKKSKKVIESSS, EDEASPPPKKTKDKKESKSANKSKETA, NNVGPTKKERAKKNDTKKEKAKKAREPEKLRPEAA, ASNKSNGSKKSSKKGSNNDDAW
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GIQ1	RNA-dependent RNA polymerase	1	1136-1159	FNKAGAQTRRQKDNSKKLKAEFDR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJM4	Uncharacterized protein	1	427-451	TLGWRDFSRRSRWRPRKRPEEYGWL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IL58	Transposon Tf2-6 polyprotein	4	88-112, 297-318, 341-375, 1537-1559	AEGRRKPLPNPPKFTGRRKDYPAWS, VSRARNKKGAPEPQRRRRYSSS, GHIATRCTKPKRPGPKKIKKVKKAKKSEESSNDSA, IDAATWKRRGRGRRREVLVKWEG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ISI2	White-opaque regulator 2	1	408-462	ALQMIKRRRFKDRETREPSPNEPTTAGVQLPPRPRQKKRGRRPKFSPTIPPNMRE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IUB4	Cutinase transcription factor 1 beta	1	7-43	AAESSKPKSQSKIRKRAPKAWRASRFRRAQQRDDAAN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J3A4	E3 ubiquitin-protein ligase CHFR	4	172-194, 211-236, 297-324, 380-401	SGDGRTRRSRDPSRDSRQSHRHE, LQPDARPSEQRRRRRSESRQREESSA, SRKITEAYRRRQRERERARGDRTRRRDT, LEIRPEERRRRRRTSSGGRSAT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J802	Uncharacterized protein	1	3-30	GVAGRSKGCRTCRQRKKGCDLQQPICGN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDN2	Sterol uptake control protein 2	1	1-28	MKRLGYRKSRNGCLRCKERRVKVSAQAP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JEV0	Regulator of nonsense transcripts 2	1	1-20	MDRARKRKLRSLNTRAWEGE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JKG4	Uncharacterized protein	2	51-71, 562-585	TPGPLESRKRLGKRKMTAMYL, VADFRWKKDWRRVDTRKNVARQLP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JMX9	Transcriptional regulator of form adherence 5	1	22-72	ASLAPERKYKCQFCNRAFSRSEHRSRHERSHTKERPFKCMKCRSTFVRRDL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FBL1	Inheritance of peroxisomes protein 1	1	174-197	VALPEKPKTPVKKRPWTPPVKGAL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FC43	Ferric reductase transmembrane component 5	1	1-21	MIETRAAKKPKPPNARQLMNE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FG25	Mannan polymerase complex subunit MNN9	1	51-75	LSPPTAPYRKKSKSDTRPPPVVRYN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G6E1	C6 transcription factor	2	4-26, 56-81	GTSSCWTCRIRHKKCDETLPVCN, ERLKTEVRNGAKRRRARRILQRIIGD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GAD6	ATP-dependent 6-phosphofructokinase	1	693-712	LEEFRPKSHNRCKRDPMSAS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GFX7	Histone-lysine N-methyltransferase, H3 lysine-4 specific	3	551-581, 864-891, 1113-1140	APRSRRTPSPERKRRTDQRLREDKDRRRREE, LSTKASAKKLKSKKKSKKQLFEEREALK, GDSDAFKFNQLKKRKKPVKFARSAIHNW
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IBR8	Uncharacterized protein	2	19-41, 179-207	SYYQDNLKNRRRFRFRLCPATER, VEETGLKVREKRKQKKKVARRGRHDAIDA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFI6	Uncharacterized protein	1	59-79	LLPKATKQRQQPGKRISRRGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJ15	Forkhead box protein K2	1	598-647	EGGDRPEKRKYKPRKPKGEDGAEGSDAERRAKEKKEKKVRPKSPPLELKI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IMV3	2-pyrone-4,6-dicarbaxylate hydrolase	1	1-27	MGRRPYVQAHRRRHRHRPQSLQQYGYH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ISA1	Uncharacterized protein	1	143-162	ANTFTFKRKNKEPEFRPESV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IUY6	Anucleate primary sterigmata protein B	1	1408-1433	PSIPTGPRDRERKPRKGERTSTMTRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IVD9	Uncharacterized protein	1	60-80	EQMNKFHKFRHDKGKIDRLRT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IXU9	Mitochondrial GTPase 1	1	347-371	VSMSQARKREKEAKKDRALNKTKAV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J429	RNA polymerase II-associated protein RBA50	1	33-53	FPAHKKRTRVSAFKQQRQGKD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J552	Uncharacterized protein	1	65-87	GASANSKKEKKKRKETVTSPSST
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBZ5	Kinetochore protein mis13	3	24-46, 48-70, 329-352	DFHFTRGSKSKRVKNAQPESEPE, EPAPLPPKKSGRGRPPKERAAAA, LEAKVKRLKEEKKKWLALKKSRTE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCM0	Protein transport protein sec1	1	696-726	APTDGGKPHKGEKEKKKRNFLGMKKSHKDKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCT4	Uncharacterized protein	2	27-56, 361-387	RAGDGKTTYKSWKKKYRKMRITFDQKMHDC, GGYRPRGSVGRPAKKKRKSEGADAGTP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JLI8	Uncharacterized protein	1	81-101	AVEHLKEKKHHHHRISLPFGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JMF8	Uncharacterized protein	1	65-104	QKEPRRSVSKRGKSSHNSSDDEKYRVRKARASKKAQEPGF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FE99	Spindle pole body component	2	46-69, 116-137	RSDARQQQRERERERERERDRESG, PERGDRRGDKGKPKEDKSRSAE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FI97	C6 transcription factor	1	63-86	GITCEVLSRKRRRNSDQLPTHPGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FZH6	RNA-dependent RNA polymerase	3	1-29, 40-61, 166-188	MAPHTKPAQSAPRTPKKPKHIERLAETID, EIPDRTLTPRHSERRRKHDAAF, IEVPKSKRRPPEDTKDSPKRVKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G3E0	Alpha-glucosidase	1	14-34	GGQPNKYRRWWKEQSVYQVYP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8J4	Cytochrome P450 monooxygenase aflN	1	30-51	KVLWKAFTIRRKFRQVRAQGIP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8V9	ABC1 domain containing protein	2	281-305, 380-400	SEGLLGRPARKRRRRGGPGRGKVVV, ASGFVKRRGKWVRKHDDEEDE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GC64	GTP-binding protein obg	1	175-197	LQRALRAKRKAEKRAKREREEEL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GDH8	ER membrane protein complex subunit 4	1	36-60	SQSTGSKKQKDQKVQPQPRKQQSPE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GG08	Uncharacterized protein	2	214-236, 295-320	QDLIYKKPRQRVRRTCHECQTLF, EDGTECKKCGHKKDANCPRLKPRKVE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GI51	Pre-mRNA-splicing factor	2	43-70, 767-786	QLAKKHWLKATKKPAKVKVKNDVLKQDI, VEPPSKPSKKRRRGVEPALL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IBX3	Uncharacterized protein	1	59-82	GSVAAGPSKKRKRRNADDDDSDYK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IE00	Transcription initiation factor IIB	2	78-99, 396-426	LFYIFDRKKNRQFREACKRDPY, KAVVNKRQELRRRRKELRRRRKVFDENNNIY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IEE9	Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22	3	136-189, 342-361, 1146-1172	EGKARGEKVSSRKRSRSPNDGRESRRKRRDRSRSRDRRKRDKYRSRSRSVDDYE, QAGQRRQKKRMTSPERWEIR, FKVAPTDRLSKRKKAERIQPLHNKYAG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILC1	Casein kinase II subunit beta-2	1	1346-1372	AALIRWQHQKKDEMRRRLRKMEVDSGF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILX6	Stress response protein nst1	4	67-94, 144-175, 517-539, 574-593	GADALQPAINRKKQKRRAKAAAKAAAEQ, NTNGIASAKSKKKNKKKKKAGKTQHLPDPQFD, TRQESQRKAKKAKENQKRKDKAA, QRLKAEEKRRKKEEQKRLEE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IMY0	Glutamyl-tRNA(Gln) amidotransferase subunit B	1	48-89	PEAPPPPSTPLRKKLKEEKKLLKKESKGKKPKGSNQTIPGWE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IR00	Uncharacterized protein	1	54-73	ALSLEQKKARRKAKPFPFMS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IUE9	Cellulose synthase 1	1	304-324	IWTMWSMKKRHRPKLRLMGDE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IVL9	Uncharacterized protein	2	289-313, 356-382	DDCDDRSRSRSRRREDSRGRTRSTY, SDRDERERDERPRSRRRQRNDSIEVLD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX64	DNA damage-responsive transcriptional repressor RPH1	2	190-244, 594-615	HQPPARRGERRANVEKPKPRSAPRPRPAAKSTPSGSKKRGRGRPARGKAKIQEEE, VIKTSRKRKRAGDKGGKTKVKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2X4	Histone promoter control protein 2	3	31-83, 417-443, 528-556	TAAGLPRKKPGRKPGSTVKSKNPDEPPKVRRPRKPRDPNAPPIQRKRKSAPAQ, MTSGAEPEKPKKKKRNFKEDEYDKDDD, GSLTRKPRITKSEKEQREREKAERERQAE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J6H9	Histone-lysine N-methyltransferase set9	1	612-635	AADQPPLKKRKYQRRTFIKETTPP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J7E3	Putative 20S rRNA accumulation protein 4	1	83-106	LYVFACRKPTCRRKQGSIRAVRGV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JE68	Protein MAK16	1	279-315	EETDRKAGDKRKRGRAVKMNQKRLKQKQAERPKIAEE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JFE7	Uncharacterized protein	2	18-37, 163-188	LGTGRRQRTHIRNEQQEQTR, TQSGANTSRKKKKRKAEKECFRDSPA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JMR7	Putative ubiquitin fusion degradation protein	3	110-156, 172-192, 196-215	QQSSTASTRRSKRQKVAEPPPPPQLSTQTPAPPRSKRKDKATAAMSS, PSGSSSRKSSRSKRTAPSATD, NTSGSSRRTKRNATNNADQD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQA7	Uncharacterized protein	3	27-48, 109-130, 159-182	DDNEHEYRTRRKHEHWSPSTRI, PTPGPRPPPHARVKKPVREVRL, ELGPERVKRRERKLLLRRQRQTES
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FU80	Delta(24(24(1)))-sterol reductase	2	21-41, 44-63	VETPRRVSSRRKSPENEPTAD, ESKMSARTPRRRATGKFREE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FXU3	Protein ras-2	1	218-240	KEGGDRYRRKGGRREGKSKCVVL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G131	Ankyrin unc44	1	812-838	GNEHETGKPERKKKPKNKEVFGPEKEP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G311	Centromere protein C	3	206-229, 340-361, 444-469	EEEAPKQPAKRKGRPPKAKAPVVE, AAKADPKPKPKGRPGRKPQTEA, EEEEKEARKRRAKSRKAAGKGGRRKQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G356	Mitochondrial import inner membrane translocase TIM40	1	273-299	IKAEPEKKETEKKTKPKKAVKVDSVDL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8R1	Uncharacterized protein	1	458-507	VYSAKHDNAQPKKQPYRRQPQPQRKKQAALKQSKKTKKKQHARHLLDEED
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GBT8	Outer membrane autotransporter barrel protein	1	413-434	MAERSVSTKKMKKRAACPAPAS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GCJ2	Swib mdm2 domain protein	1	145-170	ATNKSNTKKKRTAPKKKSATKVRDGD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GIC7	Elongation factor 1-gamma	1	213-237	LTNVPPKKPEQPKKEAKKEAPKPAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GJ49	ATP-dependent RNA helicase ROK1	3	41-65, 126-155, 659-698	HDEVPSGRGHKRKRTKDEVEEKEEE, LSERHKNQSKVTKSTKKKKKVAVEVEKETN, MISTESKWERKKEHNKKGAAAASKQRKKEAKQSRRGDDSD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDK0	Uncharacterized protein	1	11-30	TTPARHGHKRRASNDPFQDQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFM9	Transcriptional activator protein acu-15	1	21-43	AQACDRCRSKKIRCDGIRPTCSQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IG59	Uncharacterized protein	1	77-107	NDERTKKRAGTSKTNQKKPPKGHSDKHWEML
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IZL6	Uncharacterized protein	1	147-171	CCFFENQKKARRRAAREQQALREQQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1K7	Transcriptional regulatory protein moc3	1	4-43	TGHPSRACKLCRARRIKCDETKPFCLKCAKSKRVCPGYRD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2H1	L-arabinose-responsive transcription regulator ARA1	2	3-44, 51-77	VSKSLPPNVRRQRTKTGCISCREARKKCCERKPECTRCSLKG, VVEPKRSKTTKRTSPSFKKARNMFAGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2X8	Uncharacterized protein	1	279-303	RVRQVNQPAPRPRKKSLVKRVLGKI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBR9	Polycystic kidney disease protein 1-like 3	1	233-252	MEEARKRKKIEEEKRKRGEE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JE53	Protein SYG1-like protein	1	770-789	LDPNPKKKLNGKPDEKPSKL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JHT2	Putative transcriptional regulatory protein	1	25-52	AKTISACLTCRRKKVKCSGDKPCTYCSR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJ68	Uncharacterized protein	1	401-425	GAIMMKRSKTKKKMPLIRKKSAKAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJC8	Uncharacterized protein	1	510-541	IEARKWKASGRKVMKTRNGKKQKDLGDKDRYA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJN6	Putative transcriptional regulatory protein	1	21-51	ASKSSNPKSRTKPIACSRCHSRKVRCSGGHP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JN22	Uncharacterized protein	1	43-62	THTFPHKNCKNKRTHTHTHV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FBD0	Trans-enoyl reductase ccsC	1	263-282	PYYSKPRPEKRAFGKWWFRT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FLC3	DNA repair protein RAD16	2	142-162, 351-382	RALRHSKYSLNPQPKRKRFEL, DIYGPPKKTSKPVKKPAKKSARQSTRRPIPQM
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNV2	Signal recognition particle 14kd protein	1	103-132	SGMTALKPRDRSKKKAKARRKKGGAPTVTA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FR07	Deoxyribonuclease Tat-D	1	300-325	TDIAAQPHTKKKNQKKESEVPERFKV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FUC5	zf-C2H2_3 domain-containing protein	1	16-39	ISRPTTEKRRTLRTYSKRSRVTED
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FY22	Kinesin related protein 2	1	1117-1136	LFNKRTSTRFQGKGPRKQTS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G5R4	Uncharacterized protein	2	12-33, 63-86	ADEPRRRSGRISSTPKKSKYFE, EEEEKPKRGRGRPKGAVAKPKPKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GF36	Pentatricopeptide repeat domain-containing protein	1	586-607	ANGKDDAKRKRATKKAAQSALP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDW6	Vegetative incompatibility protein HET-E-1	1	176-196	AQWPRLRKRYARPPSHSDRLY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IT22	Phospholipid-transporting ATPase DNF1	1	21-61	RTRWATRKMTIKSSSKKRLSLMNRAHHKKKNSEKSRSSGGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J165	Ribosome quality control complex subunit 1	1	72-105	EPEPEPVPQPAKKKNKKKKKKAKKQAAQSKDESE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J3P6	Chitotriosidase-1	1	1153-1177	ARTWARARIRQVRRVYNSRNNLNAQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8X1	Transposon Tf2-6 polyprotein	2	894-923, 2108-2130	HIATRCPKPRRSGPKKVKKVEKAKRREESS, IDAAAWKRRGRGRRREVLVKWEG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J9V6	AP-1-like transcription factor napA	1	78-102	AATTAKPPAKRKRENRYKNAPPSVL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDS6	Putative WD repeat-containing protein	3	2-29, 208-236, 555-575	SSFFTIPGSNKKRKRTAAPEAPKKRIAA, LPKNQFQQTTRKKPKKPPAPPRKRPELQT, GKEHRLGRWQMKKGKGKNGGY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQP7	Cytochalasin cluster regulator ccsR	1	40-59	RSACDRCRAHKLRCVRPPGC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FII0	Ribosome biogenesis protein	5	1-29, 171-197, 787-809, 1003-1023, 1075-1132	MDDQVHKPHRKAKDKKKGHTGDRNPKAFT, DLFKKVQTLKDAKKRIKRRLWSELYQG, GYVQVRIKKHRWHKKILKTNDPL, TPSQKNSQYRKIERETRHFNP, TIRNDKVARRAAKKEEKRAEYRKKVAESEEKKEAREKKESKEFWRKNGRKRQAADEGA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FKQ1	Ubiquitin carboxyl-terminal hydrolase	1	569-596	APMAVAPRPPVHRRKKQPTDRWWRISDE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FLP3	Isocitrate lyase	1	26-45	EVKRWWSEPRWRFTKRPFTA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FW35	Protein TANC1	1	6-32	DLASDRTNRRRLQNRMAQRKFRQARAE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G2W5	Uncharacterized protein	1	69-90	DMRPKMEHFRRHLNRHRDRYAL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G6N7	Protein lsb5	2	48-67, 208-237	AARAIRKKLKYGNVHRQLRA, GFFSGSKDKKKKDKDKKGKRKPFNLELEKE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GFI9	Lysine--tRNA ligase	1	24-49	GEMISKTELKKRQKAREREAQKAAKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILJ2	Fusaric acid cluster transcription factor FUB12	1	383-411	GYPENCKLVSRQQRKRRRRADVLTQEEHY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INH1	54S ribosomal protein RML2	1	219-244	GTLAKGGFKTRRKHNFNKWVVEPRAR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IRZ3	Uncharacterized protein	1	95-115	WQFYRNKTRGNWKKTRWFSTP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IZG2	Uncharacterized protein	1	79-102	DNKIHYFKRYVKFTRKNIIRKAYT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IZH1	Intracellular hyphae protein 1	1	160-186	TATPPPPPGGKKTKRRRRNASLPAILP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1C7	Uncharacterized protein	1	399-421	SPAASGRPQRTTRRTRRTQPYPS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J237	Patatin-like phospholipase domain-containing protein	2	147-172, 224-246	APVNQRVAKRGSRRRRNRAKGAAEAL, TWRGTRERLRRSMRRTNNYRDWV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JB37	Uncharacterized protein	1	266-292	AEDCPEAKRIRRLRRPREPRTNRGADP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCS4	Uncharacterized protein	2	50-75, 88-108	ATERMYKRQFMKWKWRKYNSEGLRQS, EMTCQRPRRRRLGPLLGRRYT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCZ4	Putative glutamate carboxypeptidase	1	24-44	ALHKRISDHKHHDHGHKKRDL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JM99	Enhancer of mRNA-decapping protein 3	1	184-211	HEASGPSQPKKKNRRREKAKAPRNGTAE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JR34	Uncharacterized protein	2	1-23, 632-654	MTRVPANQRKRKRDESDDKKAAT, DAPVITTKRSSRQRQRSGGDDDK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JS57	Uncharacterized protein	1	164-189	AGPNRTDKRVKRHRPYPTKKDLPPKV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JT79	Adenosine deaminase 2	1	1-21	MLRKKLSNHRRRHQSALTPDI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FCP3	Developmental regulator	1	58-84	PEDTEAQREKKKRNKSKPLKAGVLRNE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FZP2	Nitrogen permease regulator 3	1	138-167	IHVPESGSWKKKKKKKGKPERAKSVRTEES
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G2R5	Coq5 family	1	278-297	VTERYWSKEQKEKLRPKLTA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8W2	mRNA cap guanine-N7 methyltransferase	2	6-38, 47-73	DDEAYDARKRKRSQSPAKKGKRREDENDQLPQP, AKRRAVSPSEQPRKQKRPGARARISEA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GAU1	Calcium-transporting ATPase	1	147-173	TDRRRIFGENRLPKRKQKSFMRLAWIA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDN1	Uncharacterized protein	2	1-20, 34-65	MSQRRERRWRRRDLGAVSAR, FFPAVRDNHQPRPHRRRRRCAHLQPRRKPLGD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDT1	GTPase-activating protein gyp3	1	711-741	GDPNAPRPAKPVKKPRSRRKNQPSISSNRLP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IVD6	1-phosphatidylinositol 3-phosphate 5-kinase FAB1	2	578-602, 1915-1942	SANRPQSSGHKRHHSKHHNNFLARF, QLSREFEKERQREDRRKRLAKGTQPRAG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IVM7	Uncharacterized protein	1	10-40	IQPHDPGKKVRLRAKKVPKPGKPHRSTPHAR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX19	Uncharacterized protein	1	9-34	PAVQSESKSAKKKKAKAIERTESPAP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IZZ5	Putative ATPase YjoB	1	406-425	RAAYCKFWQKKLKSNKEIEF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J0H1	Uncharacterized protein	2	111-130, 202-221	VDRSYRKVIRSQSQKQKLDQ, PLETRYQRSRQKQIPLNEQD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JH89	Transcription activator AMTR1	2	104-123, 175-196	QSSYLKHHHHHHHQDHQTHQ, AATATKSKRSNRECKRGVRLNF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JI32	Rubrofusarin-specific efflux pump aurT	1	549-568	EWKSVKKEEQARKKAKEDAE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPB2	Forkhead protein sep1	1	582-604	PQESPSKKSVKRPRIERTNSASA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FPY0	U3 small Nucleolar ribonucleoprotein IMP4	1	1-22	MLQARKQSRQRRDYLHRRALTL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G366	RNA helicase	2	35-58, 688-711	LPNPRSARQYNKYQANKSKNYETF, NQQLRDNQRRRALKNQSEKDRLRM
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G4X0	Dienelactone hydrolase	2	79-103, 481-510	MGDPKKYRGKLRSLSKKKMDPCQTF, PEDSQKPKGGEKPKGRKKPKGVEQPKDVEQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8D4	Myb dna-binding domain containing protein	3	127-149, 233-254, 358-401	PDNSKDDTSNKKRHRNIATKDDF, KAGSGKTRKKAMKPRRKWSEAE, DGIPKAKKSRAHRKKLEDLAELGIHGPFKKSHRRERRPFTDQDD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G9S5	Uncharacterized protein	1	424-444	QLYVFCHRYRQQNQRKGQAGA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GAN5	Uncharacterized protein	1	251-270	SASNALKKLKQKRNFARWFS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GBX6	Good for full DBP5 activity protein 2	1	278-303	HAKEDQPKSKSKKRKQEKTQSREENI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IBU2	Uncharacterized protein	1	761-786	DPYMRERLFWWQRRRREVPGRRSDGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFQ0	Uncharacterized protein	1	103-142	EPWYCPRKFTKRETTNKYKGRCLHGRPKTRKAPNNHWTAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IP38	Regulatory protein GAL4	1	140-164	VSSTPRPNPPTSRKRRRQSSSSAGL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQ73	Uncharacterized protein	1	32-67	KVPSEKEIARKLRKRELDRRAQRQARERTRNRIAEL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IYK9	Secondary metabolism regulator LAE1	1	24-50	RTGAPRDRDDHKNRRRHSRAAQTHTTD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J104	Transcriptional regulator RPN4	1	9-35	TQPLQQQRFYRHQPQPHRQPQGHHFYP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JA20	Calcium-independent phospholipase A2-gamma	1	1229-1255	KLEQCFGTSDHRKKRSRDEDNDDISRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JES9	ATP-dependent RNA helicase DBP10	6	611-633, 678-702, 751-773, 796-815, 828-870, 883-907	VMKQLRKRITPHRGNKKEDKDSD, ISNADEGKGKKKKNKQPDSWRDSDV, GEPTKTRGMRWDKKQNKYVARAN, FQSGRFDKWRKANRLGRMQV, DQSGPRYKHKLEKAPKQADKYRDDYQVRKKRVAEAKEKRIGKF, AEDIRKARVEKQKKMEKNARPSKKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJR7	Phosphomannomutase	1	19-44	ERISILPRLLRRHKRQARASQHISPP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JKX0	Uncharacterized protein	1	33-65	DKDAQKQDQNKDQNKNNKNNNNGKNNNNNNKNN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JLI6	Uncharacterized protein	1	54-84	LYFYRQSLNRISRRRRRQRRHIYHKTDNQYV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPL9	Tyrosinase	1	429-448	STLVQKRKRALGRRDRGKIS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPM9	Uncharacterized protein	4	128-148, 167-187, 565-585, 607-643	ALPYAKRRKGRGRPPGHLSVR, NSSIKRPCSPRPRPAARCPLP, GPSNQQHQQHQQHQQHQQQQP, APQQMQQPPKQQQQQQQQRPEPAKRKSWFSRRFSKSS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQ39	Increased rDNA silencing protein 4	3	27-46, 575-595, 597-618	NLAFSKTKPKPVPPPKPTST, ALPNRTKSPRLRQTLRQPPSK, DDEDEIRKKKHQKASNKHSHAE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FI29	C-type cyclin	1	709-729	GGWGGGRRNHHHDRRKGRGYY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FKL8	Vacuolar transporter chaperone 2	2	137-162, 608-629	YTGFLKIVKKHDRKRGDRYKVRPMMQ, FSLSKYSKAKRAQKNQVQLPEG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FXL1	Phospholipid-transporting ATPase	1	644-666	IESARKKRKGKGKDRKKAADQPD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FZM3	Putative RNA-binding protein	5	15-46, 56-82, 96-123, 126-181, 285-325	DDAATAKKSKSDKKDKKEKKEKKAKAVSTEDE, IALEESKKDKKERKRKEKEARKAAAAA, VDPPADGEKKKKKDKKSKKAKTEEEEAA, EEEVKEEKKSKKEKKDKKKEAKAKEETKPETNGEEKSKKKDKKSKKTKEEPTAPAP, AGGGGKSKFRREKIKSRNVQLDENRVKRMQKEEEYKKQRVS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G5G1	Sterol 3-beta-glucosyltransferase UGT80B1	1	720-746	TPEGRRKSSVVKYQKRQRGRVKEVARA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ID38	Uncharacterized protein	1	25-49	TSPEPSPTSRAKRRRGTEAQPSQPS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IE59	Phospholipase A I	1	458-489	VQEPVKDCLRKAKRQRPAQSRMTLRKRRRVAS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IP88	Uncharacterized protein	1	57-77	CLPCRSKHLKCDGKRPQCSRC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQI9	Uncharacterized protein	1	1220-1241	VETPTRRPPRQVRSMRSLQRFD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IZS0	Putative transcription factor TDA9	1	23-42	RGEHLRRHLRTHTKEKPYGC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J0L9	Fusarisetin A cluster transcription factor fsa6	1	31-51	CLPFLRQKTPQHRSHGRFPIR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1Z9	Protein HOS4	5	139-160, 287-306, 679-704, 1032-1060, 1196-1220	ASSLGLKKKRLHDQSARSKDGS, SSNGLSYKKKRLPPPLQSTD, RDISKTKSPNRRERERERERERERDR, DDDKRRQEEKERRREEKRQEERKRREAEA, REEEERKERERKERQQREEMERKRA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2M2	Calpain-D	3	10-60, 86-108, 614-654	SEDYRRPKPAPASNNNNDQKKKKKKKAPPQQSINRIWKKFQNRKFNKALAV, AVEECRRKVKKIIQECRRVNMRY, ASDSRKQERRKLWDRRHMTREITRKQKEKNGEKRARRIAKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2M8	PH and SEC7 domain-containing protein	3	1-23, 385-404, 708-730	MYADIPRRSSRRRPDLNIDTSPP, KSTATSRKADHKPNNNHEEV, TESRQRGKTRKEKGHRQDKPSKE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBW0	Uncharacterized protein	1	676-704	APPPAATKTQLRRTRQRRGEDQTQNPDRP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCY1	Uncharacterized protein	1	72-108	RQPIRPPPLPTKNKRRPPRQLPKKKSKSTPKPSHRGS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDL2	Pre-mRNA-splicing factor cef-1	2	32-54, 169-194	VSSLLARKTPKQCKARWNEWLDP, RLANTQGKKAKRKARERQQEESRRLA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGG1	Chromosome transmission fidelity protein 18	1	921-944	GEVDPNGTKRKKQREETKEDIKVW
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JNS9	37S ribosomal protein S23	1	65-99	KVQHWGKHIRRGKINQNSKKKRENIKVKKPAPGER
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JP90	Uncharacterized protein	1	93-113	GKLYKQCERVRKRKEKSDMLF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQC3	Protein DSF2	1	683-706	DDDSNGKKSRSKSRTRTMFGIKTG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JR45	Uncharacterized protein	1	882-908	ERLEREKLEMRARRKRERLEARCQSGF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FJB5	Uncharacterized protein	1	285-307	KPLLGKKKIKFSRGKPALNRRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FXI8	Protein kinase	1	126-146	PWANKLRKKVFPNGRKWNRSE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FXL3	Serine/threonine-protein phosphatase	1	182-205	GSTMSRFPRQRRPQRQPTPSSPNG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8S8	Frg1-like family protein	1	1-29	MVKPLSFKGEKKPKKRKRTEVEAHDRDAP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GEK1	Mitochondrial import receptor subunit tom-20	1	27-54	DYNRRNKAEFRRELRRNERRQHKAEKEE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGR3	Uncharacterized protein	7	46-65, 78-106, 248-287, 289-308, 405-427, 474-500, 1517-1541	TPVTIKTRGHRANRSQTSLL, SSVSRKPSVRVRLTPSKKHRHDHIQITET, ADQVRSKKRHSGERRVSGEKLKDKDRKHRSSKSRTSSISE, QSEAGTRSPRRRSSRNHVDS, RSESGRDSRHRERRDREARHEYT, DATSPPADDRRQRRRRRADGSARSRSL, SNENTPKTEKAKKHKSRGSSSWFPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITM1	Uncharacterized protein	2	440-466, 471-499	AFCRTSSSKTRIKKMRRIVSNRMSDRS, TISKTTGRSKLARHRNRKMKYHSKERDRT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IVC3	Pantothenate transporter liz1	1	441-466	TATVAYLFKREKKKTKSERDEEGTEA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J599	Eukaryotic translation initiation factor 2A	2	523-551, 632-652	DENLSKAALKNKKKRNNKKKEGEANPEGQ, GQNPNAKKIRSLQKKVRAIED
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8D0	Meiotically up-regulated gene 89 protein	1	14-44	IDSQHDKGKKEEKKKSRRPANTAFRQQRLKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQ68	SWI/SNF chromatin-remodeling complex subunit snf5	2	130-165, 703-724	QVIYPSQKPRPGKRQSHPLRWKKKDLKKQAEMHEEL, NFEVHLRNKQHRQKVDAREGKD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FAR4	Uncharacterized protein	2	1-22, 35-59	MKKYLDKKKYSRLSMRGRRLLG, VFSAEHKPVNPTKRKNRPNFFPIPL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FHM2	Alphan-acetylglucosamine transferase	1	287-311	FSDWPMPKPWRPRTKKQWEAALPGC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FI59	Anaphase spindle elongation protein 1	1	229-250	RLKAKRDKLSDEKKNREKKLKD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FKN1	ATP-dependent RNA helicase mss116	1	1-25	MERGRGNNNRRHPRRDNRRGGGGGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FM73	GPN-loop GTPase	1	304-326	LPELQRRREEREEQKRKTREQEL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G0P0	3'-5' exonuclease	3	60-87, 92-113, 391-414	SLSDVEGKKRCRRCNARCNKGGNKYKGD, KKGNRNPRKHSAAYKPNPKPRS, ENENSKGKQKGKEDKAKKQKGSGL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G4X9	Alpha-1,3-glucosyltransferase	1	1-23	MSSPSPHKPRRRAGKKGTGISGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GF78	Sterol regulatory element-binding protein cleavage-activating protein	1	1007-1028	GGLRRRMYQRLEKRPSRSQDNW
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILJ7	Transposon Tf2-9 polyprotein	3	88-112, 297-318, 341-375	AEGRRKPLPNPPKFTGRRKDYPAWS, VSRARNKKGAPEPQRRRRYSSS, GHIATRCTKPKRPGPKKIKKVKKAKKSEESSNDSA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INJ1	Dehydrocurvularin biosynthesis regulator	1	13-50	LADSTGPTPKRRKLRKGTQSCWDCKRRKARCTFSADTP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IR35	DNA mismatch repair protein msh6	1	160-192	SDESDAPSRSKKRKRPETTKKTQSRKKTTVSSP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IRB3	RNA-binding protein 8A-B	1	140-164	ARAQNRGRGRSRSRSRSRSAERDAG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IRD3	Cytochrome P450 monooygenase 2	1	471-492	ASNPTARVRVRRRKEIELDIDC
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J380	Uncharacterized protein	1	255-279	HPVQERGRRGKDKSAPKNRGPFWRG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4I9	Aspercryptin biosynthesis cluster-specific transcription regulator atnN	1	10-34	RTGCITCKIRKVKCDETKPSCTRCL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4Q2	Phospholipid:diacylglycerol acyltransferase	1	106-130	KHAHVVQHLKPKTRKRRNTAIFLLG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J6G4	Nitrogen assimilation transcription factor nit-4	1	475-499	LILLHRPLMRKRKSRRSVSKSASSP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8M8	Serine/threonine-protein kinase PRR1	1	345-364	AFDRRDNKRRRWRAVKTLGQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J9G1	Sterol uptake control protein 2	1	37-73	GVRGTRIGHKKSRNGCQQCKKRRVKCDEARPCRNCVR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JEZ8	Uncharacterized protein	2	1072-1096, 1130-1180	RDQIRPATFKENKTRIKRVQESSDS, SEISEPKSEVEKKRKKSKKSKEKLDKTAIKGKRPSERRKEAKRKEKRKSED
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JFT3	Putative zinc metalloproteinase	1	1-21	MRSHMPPPKRQRVSHQPVPKD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJ17	Spherulin-4	1	435-457	AALSRLSRLRKQKRFLKERGSDL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNH5	BZIP transcription factor	1	16-46	DDAASRRAKKRELDRRAQRAARERNRNRIAY
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FP91	Terpene cyclase/mutase family member	1	33-55	EQEWPKRPRIEAKTDRTKWRMKD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G379	Uncharacterized protein	2	261-304, 371-413	DRLTEKQVQRRVKKKERKKGKRARKMRRKLSRQERRQSERNGTS, EKAEESERKKREKTDKKREKRAKKRGKHHAKDHKKANKMEFIV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G416	C6 finger domain-containing protein	1	4-32	VGGRSKACDNCRRRRVKCDLTTPECNRCL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8D5	Protein mesA	1	181-208	EEDEERKAKEARKRRRKRLRNRAAGIID
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G9D7	1-alkyl-2-acetylglycerophosphocholine esterase	2	1-33, 571-596	MSEKTPPPKDDRRRQSAKKHPPKTLRERFLHTL, DNEARLRVKHWVRHNKHSLFRKDKGT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GIJ3	Ubiquitin-like modifier HUB1	1	1-75	MADSERPRSRSPRRDRDRDRDRPKKQGGFRWKDKSRRDDRDDRDDRRGLERGYRNRSRSPRRDRDRDRDRYNDRD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IHX2	Sphingoid long-chain base transporter RSB1	1	267-288	LTSPRLRRQPLRSRRRQGGPSP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILT5	Uncharacterized protein	1	139-158	EQLRSRVLKKRRTDLGQRYP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IN35	Dehydrocurvularin biosynthesis regulator	1	6-48	LEDPPSENGPRPKKRKIRKGTTSCWECKKRKIRCQFASASHEI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INI2	Ubiquitin-40S ribosomal protein S27a	1	92-128	RLRGGAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IPB6	Histone H1	2	87-108, 184-204	GTKLAKKAPKKEEKKAAPKKAA, AAEKKETKKPAAKKADKPAAL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ISW8	Uncharacterized protein	1	650-676	LPLGWRNGEKRLKKKRSAFGWLKKAFS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IZB8	Putative transcriptional regulatory protein	1	3-30	PDDGLRLQRHKQRRVADKERKRAVRACD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J288	Uncharacterized protein	2	9-28, 629-649	TDPIHRMPRKPQSYNDKYVV, GSEQIRKQRQQRYATRVKHLE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4T2	Ras modification protein ERF4	2	56-82, 351-370	TNATRRCSRWCCSKKTHPRPGPHPSVG, STPRLPEKTIRKRRPSTPPP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JFG9	SH3 domain-containing protein	2	63-88, 304-329	EKFEPQAPPRPTRTRKKEPEVTSPAS, HADAAAKKEKKRPPPKKRTDSQEATE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JG94	E3 ubiquitin-protein ligase itt1	1	585-608	AMDGRGGRRQNQQRNPNQNQAQRV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JLQ1	Putative transporter	1	462-485	CMAFTSKTYLRRHNKKLRAVADDT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JP84	Mutanase	1	626-649	SENCYVSKRRNPLVKKSNKKLAAP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JSH8	Putative transcriptional regulatory protein	1	48-70	ASGHNKWSKIKHKKGATDAQKNS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FED6	Uncharacterized protein	1	351-371	LDEPRSMPIRRQKKKRYLGRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FEN3	Brct domain-containing protein	1	782-802	PSNEEQPQTRRRKARVFGRAI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FEZ6	Cytochrome p450	1	229-248	STKNPWKKRKAEQGLQKLKD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FKQ4	Heavy metal translocating p-type atpase	1	32-51	AEKKRTQNRISQQCAREKQS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FMR1	DUF3669 domain-containing protein	1	385-404	ASTGPGSNSKKKKGREYVGF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FT35	Zn 2cys6 transcription factor	1	12-39	PTEACQACKYRHRKCDWGRSGCQQCRNA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FVE0	60s ribosomal protein l19	1	2-28	SSSATNQWPPRRPSKRSKLRNGTFIVP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FWR9	High mobility group-T protein	2	49-80, 87-106	ASSTKTKPKKTTTTAAKKKPVAKKPAAKKPAA, AKKPAKTKTGQGRGRPRRAP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G074	ATP-dependent RNA helicase dbp6	3	48-70, 95-148, 160-210	TASPYARYVPSKKPKSRPSIVSV, GQETPAKKKKSRKSEEVAPLDDMDVDTPKKSKKEKKEKKEKKNKKDDSEEPQVD, EGEEAGEKKKKKKKRDSDNADGRDDDELKEKKDKSRKKKRKDEEITEEDDA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G7P2	Chromatin modification-related protein EAF6	1	139-159	TSATASKSGKKNKKANEEDSD