ProteomeAccession	ScentificName	ProteinAccession	ProteinName	#NoLS	Positions	SegmentSeqs
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RXV7	UNC45-central domain-containing protein	1	154-173	LGPLMRRKFKSRKVETACLE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYD2	TPT domain-containing protein	1	69-88	QPPPDRWHARRDSRVRWAPG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0D7	Dolichyl-diphosphooligosaccharide--protein glycotransferase	2	170-190, 909-935	SLKGPNFTRRERQHRNPSEAT, ASAAAFERGHKKKKATKKRGPRVLRVE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0I3	Putative mismatched DNA binding protein	1	204-225	QATTSRPSQRRRLQNTPRSQLA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S141	Putative FAD binding protein	1	118-137	LVYAPLWKKRHNREIRLSSA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2J5	Tr-type G domain-containing protein	2	633-656, 664-683	PRAVSEKQKKSKSQRRRRDFDEDD, YAERERRKARKAEKERQKMA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2S8	Nitrate reductase [NADPH]	1	37-56	SSSSSTSKPRQPTKVARSAP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3E9	Uncharacterized protein	3	40-62, 432-458, 516-535	QINPMPVRKRPCIRRVTRPELGS, PSPPPTAPGYRVKRRKRSATPEVSQQS, LSPAAKRRRTTRRVSTLEVC
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3M8	Uncharacterized protein	1	505-529	FARDVRVKRLHKLKKVKLVCKIPWT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3R0	F-box domain-containing protein	1	231-255	EMSPNCTCRRRSARNKSPKVLRRSE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5V0	RNA recognition motif-containing protein	1	236-262	SWGQQQPHKKRAKCRDWERKGYCQRGA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S616	Ribosome assembly factor mrt4	1	236-256	ELEAGKTRPKREGNRRQAMNG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S631	Uncharacterized protein	1	423-442	VHGVKHLKVRKSPERRMVES
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6C5	Peptidase A1 domain-containing protein	1	540-560	SPVKRMFTKVVNKKRSRKTVT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6P4	CUE domain-containing protein	1	110-134	SQWGEVSKPKKDRSRPKNKSDATTA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S732	Brix domain-containing protein	2	1-21, 364-405	MAKRRHKKRTHVGAHNPPNAA, ELEQRWEQRRKEKEARKKQQKENVEKKRKAKEAQRQQQQQSG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7I7	SNRNP27 domain-containing protein	2	14-115, 287-312	DKSSYHDDRDRRRDRDRDRRRDRDDDVDIRRRDRDRSRSRDRGDRSRRYRSRSRSRDRSRDRDRHRDRDRDRHHRRSRSRSRSPRRDRDRRDDRRDRERDEK, GNNVYAVRKEKKTKYRQYMNRIGGFN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8P0	Uncharacterized protein	3	431-473, 476-495, 570-597	HSARSTYKSYKSRRERKHREEEEREKDKKRRDKERERDGRSEV, RSSSRRDKDREEKERDGRSE, VGAPPAPKPKEKKRELIKQLFKMKKEKE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAE1	Peptidyl-prolyl cis-trans isomerase	1	395-507	VEEFRRKGEKERKERSRSRSRSRRERSKERSPPRRRSRTPRRGSRSPRRDRGRDRDRYGRDRDRERDRDNRNPDRDRERDRNHDRDRGYHRRDRSRDRGRDRDRERYRRDDRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAP4	Putative DNA repair protein	2	46-65, 179-206	SDPAERPAKRKRPGEGRIAA, NANTPGRPERRKRMTREEKQRRIQVHKI
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB17	Vac14_Fig4_bd domain-containing protein	1	1033-1055	ISTTRGRGIRRGRGRGRGRGRGD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB54	Uncharacterized protein	4	60-81, 273-297, 355-375, 901-927	DADGSATPRKNKDKNKDKDADG, DSDDDGRRRSRRRNRKGASRRDGDD, SLDIIKKNYKRKKYQNVDEVL, LASIKQLREERARKRKERDEALARERA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SBU1	Serine/threonine protein kinase-like protein	1	34-57	RSSEKNALKLSKKRRQHVFQDVVN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SC89	Uncharacterized protein	1	172-191	ELVKRKQKLMAENKKRRDDL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEF5	ENDO3c domain-containing protein	1	43-62	DGAPSTPRRRRAIKNEQTVG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEH8	Uncharacterized protein	2	395-427, 703-722	TSLRRKQSTETIRPKKEKRKTRRQPVNGEQKAL, PSSIRPSRYSRNRRGHSLRS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFY3	Uncharacterized protein	4	40-72, 83-110, 800-827, 832-851	HPPMTSKQAQKLYRQKNRQPRMSKEEQRRLERL, QEKRLNRAQFLREKKKQQEQAKLLERKR, KDKEKKADSTTPPPRREKRRFFTPSGNG, MTISRNKKAKEQEIERRRVQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFZ5	FAD-binding PCMH-type domain-containing protein	1	437-458	GEQWRLKKLRRIKETYDPENHF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGZ6	Zn(2)-C6 fungal-type domain-containing protein	1	3-56	GPGGGPPRRSHTKSRKGCDTCKRRHIRCDENFPQCRNCTKHKIRCPYNDQAPPD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHX3	ATP dependent RNA helicase-like protein	4	5-25, 41-65, 145-184, 721-791	KVLSRGIKPNPQKKKAQAATA, NDPVNINNRGQKRKRRDGDQGDGAD, EDEEGKKIKKGKKDGKKEKETEKKKKKKKKEEEEEEEEEE, LPDVKKEERRKLKSAWERRKEHNRRQAIEASKRRKKMQMQREGKKGNDGRDEGEKEKKKKKEEEEEEEEEW
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYZ0	HMG box domain-containing protein	1	179-199	RYSPRKPSEIRRRARRAQSSQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZU4	Uncharacterized protein	1	4-24	TAPSLRRRNHAWRQMRALEKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S012	Glyco_hydro_cc domain-containing protein	1	61-80	RFYTNKGKTKDWKTKQISTS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S058	5'-3' exoribonuclease	2	105-124, 1046-1066	GVAPRAKMNQQRSRRFRAAQ, YDDRRDARRDNNPYRDERRYR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S087	Uncharacterized protein	1	373-394	TECAEREKKKTTSRDQNNDEDD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1D8	Phosphatidylinositol 3-kinase VPS34	1	137-157	NQLHKGRQKCHVYRHRKADGN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1J9	Uncharacterized protein	1	1597-1619	VMEEGKKKDKDSKRRFGCRYLVD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1M4	Uncharacterized protein	1	13-61	VGSHRDRDRDYDRHRERRSRSRSRSGDYSRSRSRSPRARRFDDRDGDYR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S239	tRNA (Uracil-5-)-methyltransferase-like protein	1	23-55	LQNSPHGKQAQKPSKRQRKKDKKHIVQEGSHEE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3T1	Rad60-SLD domain-containing protein	1	61-83	EEEHREEQEKKRRKLSENRQSTV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4L6	Uncharacterized protein	1	96-115	RQQRDRPKAPAQPNHPPRIC
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4P2	Uncharacterized protein	1	107-131	KDNADGSRIRRRRRKKSNTNADDGE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4S6	PHD-type domain-containing protein	5	362-386, 400-428, 457-483, 683-705, 1085-1104	YFVPPSPSKKDPKPQPPKRSPYGDL, EGVRAASKNKKEKQEKEKQEKERAPKEPK, APATTRKRERSQDKKTQQQQQPKDRTD, RQPITAKRRQKQQRSSAPPRKSA, IVAVTKPPRRRKDDEQPPDF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5K4	Uncharacterized protein	1	134-164	VTSYVKVVRRKEKKRSKKRVRRRSGGARVTL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S635	Uncharacterized protein	1	116-139	HTDGKDEKIKQKLRRRREEDAWLD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7B3	Galactose-1-phosphate uridylyltransferase	1	23-43	LVSPHRTKRPWQGQQEAPSKN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7I8	Small acidic protein	6	21-49, 62-88, 114-142, 165-196, 213-244, 249-326	AAINEGKIAKDKKKRSKKPDSKNTAVEAE, NQANGNEKKSKKEKERKRKHEGDETVA, KDEHSSKRSEKSDKKKKNSKKGIDTKTQA, NEKVEVKTKSKDKKNKKDKKSKSKEQAQNTED, AKKKEESESKDKKKKDKKKIKKSDEKADKDKT, KEKVERKKDENTKSKKDKKSKEEKQEKNEKTNGNEKEKPKEKKDKKSKKEKKTETKASKEESKDKKSQSKKAQPSEAM
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7M6	Putative rho guanyl-nucleotide exchange factor	1	1184-1208	DATPIFERRPFRRKRRSSLSDLRSL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7Y1	AB hydrolase-1 domain-containing protein	3	27-46, 357-381, 692-723	DWTSRDRSRHSKSTREEPDD, AKPRDSRSEKSKRRHSGRKQNLGLD, SSSLTSSLPKQKRTKREKRHTDTKENKDQPKG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S899	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase	1	245-267	QAISRPPPNRSRSRAQRRFSSST
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8J5	DAGKc domain-containing protein	1	3-31	RLSKLVSRAFMRKRSKRQQQPSRADPSSP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDK3	BZIP domain-containing protein	1	31-56	PGQPTTDQKLKRKRENRYKNAPPAVL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SE94	Uncharacterized protein	2	67-86, 167-187	NSNHNNSKQRRHSHSGHTNS, NTPVRYKYPHHSPQRPKSILR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFD6	Protein MAK16	1	292-328	DEEELKKKKAGDKRKRGKAVKPKARKRKELEIEREEA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFM8	Uncharacterized protein	1	6-31	AAASSQAQARPRKRPRTTRVSEAGNT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG39	Myb_DNA-bind_3 domain-containing protein	3	87-107, 156-181, 445-464	KTDNARKKYRLWRGLREDPEF, GSGGAPKRVTKKKKQQQQDQQQQDQQ, PDALRRHWVKRLRELHNRST
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG83	GAR domain-containing protein	1	596-615	AFTSRPSRSRNRNYNPEIKL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGI8	Uncharacterized protein	1	90-110	FPYPRPQQQHHQQPSRQVQAH
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHB2	Uncharacterized protein	1	470-492	KFDHPDTKMCKRYQRNKVSTACA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYD3	PSP domain-containing protein	3	1-30, 120-146, 572-591	MAAPKMTKNQLRRARKKELKKAQAESKEVS, EDEEQQPKLSKKKRKKLNKLSIAELKA, MIAQESRKRLKREEERKGRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYH8	Uncharacterized protein	2	100-119, 637-660	QQQYQQQRQQQQQQQQQQNN, GWIVRDTKGKKRDDGRRRWKMGAE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYN2	Nuclease-like protein	1	665-691	GVRGYGQKTPPKRQKRRVGQRALEEAE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYY5	Uncharacterized protein	1	1-22	MMPPNERQTKKRRLDTEDETQK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZ89	Uncharacterized protein	1	35-55	LTSQTQPKKPRRAAASQRTKG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0N5	Clr5 domain-containing protein	1	113-137	MYKGQFAKWKWTKYNKPNNTNSLKP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1J2	Ribosomal_L16 domain-containing protein	2	69-90, 224-243	LEPNIKRTQKMRKGRPRVPTGG, LEDLKRPRKKLPPPPEAAES
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S289	Exosome complex exonuclease rrp6-like protein	1	749-770	ALKEAKRARRAAKKAARQAKQA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2H6	Putative GTPase activating protein	1	659-683	HNVRSQSEGNRRKQQKHQVLGPYKF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2U4	Nucleolar protein 58	1	454-523	DIDSKSPAKEKKDKKEKKEKKEKKEKKKEDKEEKKKDKKRKSLGGEDVEMADADVGENKKKKKRKSEIAE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S384	Uncharacterized protein	1	150-175	SSGMEEVSKKHRKRKKQAQEAVVLNS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5W8	LysM domain-containing protein	1	93-113	SEKIDEKKKKKEEEEAKKKRE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6K0	DUF4211 domain-containing protein	2	126-147, 176-195	ESEAKLPFRRIQRTKRRISTSS, DKPLQRPATKRRRLVCRNSV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S762	20S-pre-rRNA D-site endonuclease NOB1	1	419-439	EDQKEYQKKLQEQRRTKYQDL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7G8	Putative nucleosome assembly protein	1	273-298	LTVRIEQKKQRNKTTKQTRIVKKTVP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9M5	Uncharacterized protein	3	120-143, 157-190, 507-541	DVTGLDKSKPKKRKRDPEVLSGIV, AEDPREKKMKKDKEVKKRKRENEPKKQAKSKYTD, WENRGELNRAWKRRRKLAGKEKRYRENKARMARAI
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAN2	Protein kinase domain-containing protein	1	28-48	AGPWKIYPAKNKKTGKECSVF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SBG0	Peptidase A1 domain-containing protein	1	1-21	MSPKHHERQCQRQPSRWSHLG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCV8	U6 snRNA phosphodiesterase	1	14-38	DHETRSMSPPKKKAKTAPSSPPPPL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SD03	Mitochondrial distribution and morphology protein 12	1	338-359	QPQTPPPKPRSQPRFRERRVDD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDE9	Uncharacterized protein	1	115-136	NGEPKPRGKPGPKKKQRLEDGT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SE43	Helicase-like protein	2	25-46, 100-120	QSPMPARKCLKRKPSADFEEKV, FLPDYLQKRRREFNQKRELLH
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SE84	Uncharacterized protein	1	539-559	CVKVRGRKEIVARRGKRRVVV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEW0	Uncharacterized protein	5	157-178, 184-211, 228-247, 1383-1405, 1610-1652	ELYGLRRSSRPTQRRKIVESED, ESDAAPARKTTKKRRVERSQPASKRGTP, AKARSFQKKARRQELQGVQR, SPAPSMSKKPSQRDRDHHRSYSN, RDEPPRERDRDQPSRRPPPSRDPYRDDRREQRHEERRNDLDRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SF97	CID domain-containing protein	3	90-110, 478-504, 553-580	AELKDKKRLPSVRRRRLHILY, IPLHRHKCPSQCRLSRRRKQILLPGAS, RRFLHSWHRVGRPRPHPLRRARISRAFL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFN6	Uncharacterized protein	1	297-320	AGNEKPTKRQTRQQRQRQRRASAL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG38	Mitochondrial import inner membrane translocase TIM40	1	402-436	EAAADRAKKERKEKNKEKEKGKKKRQEEVSQKEEE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGV3	Uncharacterized protein	1	346-370	DRSPSPEPRASKKKKKDPLPEIELG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHA7	Uncharacterized protein	2	285-306, 673-696	DDMDRRRRRTSKTQGSPSRQAL, PSEVPTSPTRRRKAPRRRIVDLAT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHU3	Uncharacterized protein	3	414-439, 441-462, 559-585	QEKYDREQIRKRERRENKQARQIEKG, DPEVVAKKKLRKEEQKAKGSSP, GVEDVKFKKAHRRRRGSSAKRKTQSYW
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SI20	Structure-specific endonuclease subunit SLX4	5	252-276, 312-339, 659-681, 684-706, 1093-1118	QPSPEASPTKPRIKKKQRTLTELAT, EEAKTVPKKPTKRAIKPRGNASRKKQEP, DETPPEPPKKRGRPRKSSTSTTS, AKETKTTKKKTTKTESKTRKEAE, DSGADKRGTLRQKRPQQVLSRVPRLT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	P0CU28	40S ribosomal protein S24	1	99-128	LAAKVEKASRQQRKQRKNRLKTLRGTAKVK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYF6	Nucleolar protein 58	3	473-500, 512-531, 545-582	KDASASDKKDKKEKKKEKKEVASSKITE, MSLSKFTKKLEKGKIKIKPD, EAETPVKSKSSKRKHEPEEETPAKEEKHKKKKKKSSKE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZ08	RNA polymerase II transcription factor B 73 kDa subunit-like protein	1	628-650	MEHYERTRRKIRWQPPRGGRESV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZ21	Uncharacterized protein	1	148-175	AITPQQPQTRKKQKHLKPIRRPLTKEEL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZS3	Uncharacterized protein	1	35-54	GEERAPSPKRSKKEEPEASA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZW4	Zinc-finger transcription factor of the Zn(2)-cys binuclear cluster domain type-like protein	2	27-68, 70-94	LLYTRVAPPKQPKKRSRGGCTYCKEKKKKCDEGRPSCSRCIS, GVECSYEPIKPRQRQPRRREASATP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0H5	Uncharacterized protein	2	155-180, 490-510	RDTAAPKQKKRYPCKYAQKLNCDKTF, GDENQRGKRRKMNGEAADKDK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S119	Uncharacterized protein	3	18-145, 169-190, 998-1026	EDRIRDRDRDRDRDRERDRDKEREREREKRHRERKSERKDRDRERDGERDRERDKDRDRERDRERDRERHKDRDRERDRDRDRDRDRDRGRGRDKEKRDRDKDRDRDRDDRSRSRSRNHERDRDRDSC, GRSPSGTSRRHRHKDSLERSDT, DSASQVSSNRFRRPKRRRERATPAPIEEE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S163	5'-3' RNA helicase-like protein	1	97-118	LLKKCDTCVRNWHRNRDPYLKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1F2	Mitochondrial GTPase 1-like protein	1	343-365	SLSQARKREKLARLAKREQRFLG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S459	Uncharacterized protein	1	632-674	NDDPRTEKRKEMDRKKRLEKLKRAAGKKKRGRKKIHEDDEAED
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S461	Uncharacterized protein	1	1102-1134	EDFFARLRARRVEQRRRREAKRQELKANPESQP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5D5	Uncharacterized protein	1	44-71	NYRRTFITPSKGKRKRSAHKKDAPAAPV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5H6	LysM domain-containing protein	1	18-40	DSDATTVRPRNRRVRSSQYLSEA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5K5	Uncharacterized protein	2	288-309, 1135-1154	ESELIRKAKRRQMKQAREGTLI, RQAAQYRRERRQKDLEAQRA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7L2	C2H2-type domain-containing protein	1	136-155	MDHVHKKRVETLRRRRKEAA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7V2	Putative ribosomal protein	1	452-495	DIEFKRPRVHSAKPPRKPRGWEAKRQGPKYRHLWKYTKRIRGIE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S837	Methyltranfer_dom domain-containing protein	2	110-130, 216-236	VKDIRRFSLRRNFRPRQAKLP, SGFAEREKRVRNKKLYHRLLE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAK1	Histone acetyltransferase	1	408-434	RQILSRKPRGSRKRSTGRSSRRRTSRN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SBE7	Putative microtubule motor protein	2	581-603, 612-635	EERAAEREKKLRRKKLEEEDEYQ, ENSIEPRKSRTQKAPSKNTETSKF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SC70	Uncharacterized protein	2	90-117, 127-152	TQQQELAVRQRPKKPRKPYPVRFVETYP, CDIPPIEVSRRKKQRQPPQTPVTGPR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCN4	Uncharacterized protein	1	94-114	LWGRRAGKDKKGRQRKLPALV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCP5	PX domain-containing protein	3	217-237, 833-855, 908-935	RMISERRKLRHRKHAEFILRV, LIAWQEARKRWHHNKTRQKMAAE, LDPIEAERKRRARRQDRLRRNAGEPQKP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCY7	Phospho-2-dehydro-3-deoxyheptonate aldolase	1	18-38	TPDSWRSKPIKQCPEYPNKEG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDM0	Uncharacterized protein	1	3-35	QGTLKKLSKPTKAKANQKPKKGVTKPQKPKLKS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDQ4	Nucleoporin NUP85	1	150-178	EEEEKKKKPQLLKPKGKVQEKKKDEPVRG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDS2	DNA polymerase lambda	2	44-68, 148-167	FKSQAKLTFPKKQKGKDQEDPELSR, LPSTAGRKRKRQAAAQKAVH
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SES7	Uncharacterized protein	2	72-93, 183-206	SKDVRRTHRTWCPKYGRVPKCD, SSEPAETKRYTRRQRPNITEPTGN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SH94	Uncharacterized protein	1	385-407	GYELRDAKKQNKKHDQELNPALR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHW6	Uncharacterized protein	1	493-517	QQQQQQQQQQQQQKQKEKEKESEKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYG9	Cir_N domain-containing protein	3	74-101, 252-336, 339-395	TSHPSGSDREPHRKRKRRGEDDTDFEMR, ELEELKREERRRERRDRERKRGGSRSRSPDGKERSHKRDRSRHRYHSQDREEKRDRSRDRREHRDGDGKRHRDRNKDCSRRDEDL, ERHTDDDRDRRRYRHKDPRHRDQSRDGKRHERYHSRSRERDRRRTDRDNRHRDDDGS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1Z9	ANK_REP_REGION domain-containing protein	1	240-264	ISSPQRQPRPCRVRVPKPSQKQTMV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2E1	Uncharacterized protein	1	74-101	AWQGLIKLYQRQKNKKLKEYQRTAVRLA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2H3	Nucleolar protein 9	2	1-48, 734-801	MGKNRKSKRQLIRDEKRAKKRERELAEEEERQAKRQRRAERDNAENTY, EEGKGKEKGKAKEKRDKVQSGEKEREKKKKSDERKKSTDTRDGEEKQANDEDRKKREKDKKKEKKSSG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S321	Mannose-6-phosphate isomerase	1	812-834	AEEEERKKKEKEVKGEKNEETKE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S393	Uncharacterized protein	1	918-940	GHGGKGCKCHDKRQTHNQGDEKV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3W9	Uncharacterized protein	1	107-129	TPRDTRRAKARLRKLFFKRRDGS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4A2	Sulfite reductase-like protein	1	1246-1265	QRDFGDRKNRKHARLKYTID
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4A3	Chitin synthase	2	160-182, 1318-1337	MTAPRRTVRLQRRQDLPPRPQCK, LRSPRWKTTKSGKIRPGGRW
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4N9	Zn(2)-C6 fungal-type domain-containing protein	1	13-37	GGACVRCRKGKTKCVYENGRAPCKN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6F2	Chloride channel protein	1	74-98	QDAVREQLRRKARRRRQAGPYGALS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S784	Putative TATA binding protein interacting protein	1	474-495	ISISQPPPSRKRRRQSSVAGAT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7M9	Putative transcription factor	1	358-377	GPASTKSKSKRKAEDISQGN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7U5	Putative sequence-specific DNA binding protein	3	380-409, 990-1019, 1242-1271	RPASRSRSKQPTGRPRGRPRKKPLETGNTS, WDKDAARLNQPRKRRNKNNNASKNKKSEPK, QLPPRTPSKTPRSGKRRTPRSANNANNNHL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9B5	Ribosomal protein L18-like protein	1	179-213	HFGFGPHKHKKPYVRSKGRKFERARGRRRSRGFKV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SA65	Uncharacterized protein	2	68-87, 528-551	LALSKSRREHLRNRDNPPEN, TPTVVTRADRKRMKKLEPKTPTVE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAM1	Uncharacterized protein	1	21-46	EKTPPMIPPRPAKRLQRSISPNPDRF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SBF6	Uncharacterized protein	1	123-142	YIRPSRKQGKGPKGRAQKAG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SC98	Inner membrane translocase subunit tim44-like protein	1	112-133	EEEPKKEKEESKKSKKDEMPPP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCB1	Uncharacterized protein	1	45-87	EQMGKGETKKEKKKDKKKREPELPAVEELPKRRRGRPPRRYLE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCJ3	Beta-glucosidase	1	789-812	VQFYVRRCDEKGRNKNKVVRPEKE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SD22	Mitochondrial 60S ribosomal protein L2-like protein	3	6-31, 134-153, 355-410	KTSPLQPTQCRSPNRRQPNSVQSPGP, AYKLKSKKTIPKKLGAKRTG, GTEKTESRRARMRSRRKKRAAYFRELKARRVAKARRREESKRRLREKRAVLLAQRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SD55	Uncharacterized protein	1	1157-1179	STEGSFPKRKTRRVRDPYAIDFS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDA7	Transcription elongation factor Spt6	2	77-104, 112-143	EEEDEEEKERRKKKKRRIREEEEQLDEE, ATQQWERPRPEPKFKRLKRGHRAESRGSERRG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEU7	tRNA (guanine(37)-N1)-methyltransferase	1	714-743	DDTSESKSRSPSPKRKPRPTTQRIPLPPTI
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SF84	Uncharacterized protein	1	81-100	STPVRRSSSRRRGFMRPQGT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFZ1	Putative WD repeat protein	1	1019-1046	SQLTSKTKDSSKSRKKMKIRDQEEQTGP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGF4	Uncharacterized protein	2	26-63, 200-222	LPPTSFSKKTAAKKKPDEVQKKAVKKRKRENEFDDAPR, ELEGTGKKKKKKGKGKKFLGEVG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGV0	Protein transport protein sec16	1	2041-2075	EEGGDGEKKKKKDKEKQKKKKKKKRGIMYDDEDDD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SH60	26S protease regulatory subunit 4-like protein	1	11-52	GHDGRDEKDKKKEKPKYEPPPRPTTRVGRKKKKQGGASAASK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHR5	Uncharacterized protein	1	355-374	DWYHDIKRKYSTPRNSRSNE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SI48	Uncharacterized protein	1	45-67	LPCVHAPRHGCKRHNPRNHDIFF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SI68	Mitochondrial import inner membrane translocase subunit TIM50	1	36-60	MSATRDSKSRFSKPQNPPAQKPSQP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RY93	Uncharacterized protein	1	21-44	NGSPPPAQSKRDKRRQMLVDKLAT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZL0	Small nuclear ribonucleoprotein Sm D1	1	82-103	DDAPKPKNKARKEADRGRGRGR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZU1	FHA domain-containing protein	1	89-109	DANQWNRKRPLKQGPWTNGKT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZV1	Polynucleotide adenylyltransferase	1	1157-1178	ENAGGWQRSKQRKKVGGGDSKH
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZX7	Uncharacterized protein	3	264-285, 724-745, 749-780	RQSTRKGTKSSRKESKRSSPTV, TITHLKRHINDRHCKTRRYFCT, CPYSRQGGKSFPRKDNWRRHMKNKHQIDPDTG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S015	Uncharacterized protein	2	4-24, 410-443	NLSASHQKKQHQQSSRSSFPQ, GDNSNKKETNKTKGRNKDMSQRPRSRPQHQQHLS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S030	Uncharacterized protein	1	675-706	GGGGGRWRHRDKHHKGDRNNDKNNNNNNNNNN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S044	Uncharacterized protein	1	62-81	SGPVSSKASKSKRIRWPSVI
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S124	SANT SWI3, ADA2, N-coR and TFIIIB'' DNA-binding domain-containing protein	4	19-39, 581-603, 639-661, 799-822	APVPGRRSTRQQQQHAAQPQQ, AVAPPAKKPRGKRKKNDAQASAG, MSAAARKAKKPQERKAWVRSDVR, VEPQPQPQPQPQPQPQPQPQQQAP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1F0	Uncharacterized protein	2	7-33, 488-522	SSLFPNRPIRPLPKRRLRERLSPEVAE, LAQQRRAQWERMKKGKHKGKKSSKMSNKNNHAAQD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S219	Uncharacterized protein	6	5-24, 42-62, 160-250, 975-994, 1190-1220, 1286-1313	SSFRRFDRYRDRPVDHGRGR, DGSDRRSRSPPPPRDRSPYGD, RDRPHFRDERSREREREREREQRERERDRERERERERERERERERDARDRDRDRDRDRDRDRDWQRDQRDRPDFSRPRRPSPPPLRARSPP, YNVKPWWKSRRVKKICEENP, KKRELNLKEKLKKQPRRRKKGGRTKQKASVL, TVAARVGRRRLKKRRPRGAKQQQQQQQQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2I5	Uncharacterized protein	1	1-23	MPKTFEKTRKEIAKKKKGNLSTL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3A1	Uncharacterized protein	1	25-45	LSWKNGSKPKAKFPGPRQFPL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4B5	Uncharacterized protein	1	47-72	RGTHSTYCWIRKKRNKVKVYLNKIQE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S600	F-box domain-containing protein	2	30-49, 656-681	LPETDTKKKGRERLLQGLQR, AGIDGSGARRRRRRVRAAQQVHDQDA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6L8	Enhancer of mRNA-decapping protein 3	1	190-215	EYGDVAGQKKKRRQRRQVSSRGVSHE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7F7	Uncharacterized protein	2	81-106, 291-310	ATSYEDSQPRDRKRRTYAPGTPEKKF, GLEAKFKRVRQTTRFRNGRN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7K0	Uncharacterized protein	2	549-569, 723-743	QQQQQQQQQQQQQRRRRQEEL, DSWPRPKSSSGEKKRERMDLW
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8D6	Protein kinase domain-containing protein	3	826-853, 881-937, 941-961	KDSMILHRKRQEKRRKRREENERAVEED, DDDRRSHHSRHSRHSNRSKSRSRSRSRSRSKSRSRHSKPKKHKANTKVKIKHPRYSA, TSSPKSPKSPKSAKGNNNANA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S900	Uncharacterized protein	1	858-878	RSSKQPRSEPTTKRLRRRLLT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9A3	Mannose-1-phosphate guanylyltransferase	2	58-77, 160-205	QGSQKRKRSIDDEPRRERER, QRKDGVQSDPKKRKRNFSNRTKTGCLTCRKRKKKCDELKPECNNCY
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAL8	DUF676 domain-containing protein	3	682-706, 957-981, 1157-1209	TYRSMVRRRKLIRERYRRGRAKPVP, GESPSAIKKRHRRELERSERENREN, TVKVAFKRTKMAWKKTKRFYQEKLEPESRKEARRKRREEKRRKLHEMRMSGDS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAN3	NAD-dependent histone deacetylase-like protein	2	337-356, 565-585	RKRKLQRDGTEKKPRRRPGD, ESSAKEKGKGKGKGRGRRGGQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAY2	Histone H2B	1	32-55	KKTAASGEKKKRTKARKETYSSYI
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SBP8	Eukaryotic translation initiation factor 3 subunit M	1	65-89	ISPPALPKRNKSSPPHRQPEPVRYL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCC8	Putative fkbp12-associated protein	2	13-36, 160-185	LEDNPRRGRGGRRGGRGRRGHGHG, EPTAQQLTPKPPKPPKAPRVTTKSSA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCD5	Uncharacterized protein	1	133-154	ERLTSKRKSYKTTSRRRRILED
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCG7	Uncharacterized protein	1	348-374	EEQTAPPVPPRPRKKGKSKQESLGSES
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCI8	Autophagy-related protein	1	104-130	TLYFRHRRSMSPPPPRRRRSNGSLTPS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SE54	Putative GTPase activating protein	1	114-133	LPSLSNMKRRTRKMTEQSKT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEC6	Uncharacterized protein	1	43-62	QLFQRPQQPQQPPPRPQPPF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SF46	DUF3835 domain-containing protein	3	246-270, 510-545, 554-573	YGPEPPPHPPQPRKRAKPKADVSAQ, SDAPPAKKEKPKAKEKPKEEKPKERKKKSVSFASKL, GPAPPPPKPKQRKTVHVGDI
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFQ9	AAA domain-containing protein	2	81-106, 594-619	AGNDETQKKAPPRKRTRHSAGSNITA, KTGSKTKGTANKKKRKKKLDGFIVSS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFZ4	Uncharacterized protein	1	60-87	ADTDGKKDKPKPKLSPKKGKGRGKGKLP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG37	CutC domain-containing protein	2	12-31, 71-95	VIFWKKLIPHSPKRLGKDLE, GRMAVKYWRHEQKLKKQKLEAEKVM
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGU6	Putative amino acid transporter protein	1	588-610	VNGFISRRGGRRRGRRVVDEDAE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGV7	Enhancer of polycomb-like protein	2	220-242, 564-594	DPYVCFRRREVRQTRKTRARDVQ, GQQPHPQQQQQQQQQQKQPPHPQQPPAPMQS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHC9	tRNA dimethylallyltransferase	1	412-432	LWQKHIKGRKHTNAVRSAKRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SI31	Reverse transcriptase domain-containing protein	1	411-432	GLPYSPPKKRRVPPPDMHRWWQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RXR6	Putative rab guanyl-nucleotide exchange factor	1	1209-1230	ASLLWRIKRKKGVRKAGPGTTG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYL9	C2H2-type domain-containing protein	2	279-303, 353-375	KCPYEGCKTRPYRRNEHLKRHIQCA, EEMRRIHSRRGSAKTKKRLETTA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZY5	RING-type domain-containing protein	1	623-646	NASTAPRRSTRRRVITRRSEPESR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0E2	Uncharacterized protein	2	1-20, 208-282	MGKRTKQYRKLMRQFQLLGF, RASANGEEEKRKKKKKKRYGPKGPNPLAVKKPKKKQPPPPKKKDEPPPSQASGEKKSKRKRRKKQKSEGGGSSEG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1D0	Putative WD repeat protein	1	559-579	RSTTRPPAGLRHRPERRFRLG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1J6	Stc1 domain-containing protein	1	376-397	HNYNSRRGNSHRRNNSHRRDES
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S222	AIP3 domain-containing protein	1	187-214	INLLHGLKRKQTKLRQRQQRERESSQSA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S277	Component of oligomeric Golgi complex 3	1	84-114	IVRVQATVHVRKRKQKTRRRRGSGRGWEALA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2D8	Putative mRNA 3'-end protein	1	79-103	EVPLRPSPQRAAPPKKKPRTAGGFI
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2W5	Uncharacterized protein	2	187-206, 548-567	TRNATKPKKQQQPWNIENKQ, KDKEKDKQGKWESGRQKRTV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3H3	Uncharacterized protein	1	459-478	HPVPQQYRSRLKRPRSRVVD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4H1	Uncharacterized protein	1	4-26	AVVRSQQQQQQQQQQQQQQQQQP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7B1	Uncharacterized protein	1	685-709	REELEAYERHRRRFRRNQIESSSDE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7E6	Uncharacterized protein	1	464-488	KQRQISEKIQKKQPTKRLRAEEENQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7S7	Putative pre-mRNA splicing protein	1	34-63	VAAPIEKKVKKIIRKKRRPARPQIDPALVK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S817	AB hydrolase-1 domain-containing protein	1	591-613	ELTTTPTTPRKRLRKFCLLPTKI
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8V0	Uncharacterized protein	1	41-72	RCSSGRSLSNHGKRKRRTSRRQKDVDQEDRGQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S922	CHY-type domain-containing protein	1	661-693	GGKGTRDQRLMRRNDPRKYKRIGPAKKDKDKDD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SBP6	Putative GTPase activating protein	1	113-132	VTFDWTWKWKPPKPAEDRGG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDW1	Uncharacterized protein	2	12-55, 119-141	PSTPPPTTDQPPKRKRGRPPLSPSKRKPKPQPTGRPRGRPKGSG, AGEQPVKRKRGRPPKNRPAVPVA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEU2	Chitin synthase	3	12-32, 81-104, 161-194	TYEERHSYRTQSRRSRPADVE, PSSPSFQRKRSLIRPERNRITKDH, DDVEKGRTRRRTNSGKITKEKRKQQEQLRPPSLW
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SF95	Putative inositol polyphosphate protein	1	979-999	TATAKRFLKPKKKEGSDQERM
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFC3	60S ribosomal protein L4-like protein	2	182-213, 304-330	VEKVKKSKKLRAGKGKMRGRRHRQRRGPLIVY, KGEARTKRACVQKKNPLRNKQIMLRLN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG71	Uncharacterized protein	3	188-211, 226-246, 250-269	SDKSAPSKPKSKPEKTKSKDEVKP, SKASSYKKSKSSKQQHGPWSE, SEDRKYLWRARQTPNKKWDY
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGA0	Uncharacterized protein	1	25-44	ENQRFDFKKHRMRTVKAMAE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGG1	Metalloendopeptidase-like protein	1	1-20	MTQLQRPRFRKVQSFRTNYA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHL9	Uncharacterized protein	2	45-157, 1122-1149	SSASREESKRHRDDGRRRDNRSRSRNRDRDRDRVRDWSRERDRERERDRNRDRDRDRDRSRDRDRNRDREREKIRHRDRARSRERDASRERHHNRERDRNRDRDHNNPRDPRF, QELRRRNLSCKSRHGKSNTKEDKRKGGR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RY38	PPIase cyclophilin-type domain-containing protein	2	213-238, 536-561	VPRPLPATEKKPKKRKGGKQLLSFGD, RDLDRDRDRDRYRDRNRDRERGRDSD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RY44	HECT-type E3 ubiquitin transferase	2	2837-2862, 2999-3022	EEERRKREEERKKREEEERKERERKE, EIEQQERQERRRREREEQRRQAAA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYQ8	DNA repair protein rad14-like protein	1	175-197	EFERREAEKKRRKEAKFKEKLLD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZ86	DNA-directed RNA polymerase subunit beta	1	126-146	IVYSRDRKRIVRKDIPLCRIP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZK5	RING-type domain-containing protein	1	127-162	FTPPPPPQQQQQQQQQQQQHQHQQHQHQQHQPQRQQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S009	Suppressor protein spt23-like protein	2	410-433, 1323-1345	EQCIGRERKRAGRKKLKNPEDELA, QVTLRRAHARNRKKLAWDRNLFL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S068	Uncharacterized protein	1	1-23	MDSIPPKKFPGPKRPNYKLTTPV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0B5	Translocation protein (Sec66)-like protein	2	200-221, 234-253	VEKAKTEKEQPKQQQQQQETNR, ETNTPSATPSKKKKGKKGAA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0S0	RRM domain-containing protein	3	195-244, 271-312, 317-367	ALRREAKKAEKSSRRRRHRSQSRSKSKSRSRSRDRHHRSHRSRRDDHDDG, TPVEEDKDRKRRRDTPDDRRDRDDRRDRDRSRDRARDRDGDR, RRQDDGRDRDRDKRRRHADSPERSERRHRDLEDRTRRPKDRSRSRSPRRRD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S102	Valyl-tRNA synthetase	2	36-59, 162-182	AKFAAKQAKLKQQQQQQQQQAPKA, VEKMLWKKQKKTRLEIGREEF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1C0	CENP-T_C domain-containing protein	2	71-93, 534-560	ILTPHQRARRRSVRETRDSPRDF, LQELRMPPPAPSKKRKRAPAKSGGGAA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1L8	Uncharacterized protein	1	149-173	GEGPGQKVRKRRKGWRIAWRTRGSW
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3V7	KRR1 small subunit processome component	2	219-250, 279-322	SRYLPQFKKRTLSKRRKPFKINDKSKKPYTPF, AEAERAEKARQKKEEKKREREKEFVPPEEDGGKKKKRKVKHGEE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S400	Palmitoyltransferase	2	447-474, 656-684	CMIRTPLRSKHCRRCQRCVAKHDHHCPW, GRSAAGSLRAKNKRRKNPYNRGCVQNCKD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S463	Uncharacterized protein	2	18-37, 665-694	KAPVKFKGGRWRDRLKAQRS, DEDVSKSKNKKGKAKKAKYQRPKENPLLES
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4E3	Fcf2 domain-containing protein	1	168-191	SDSVSKYKRKYHEIQEHKKSGRKG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4R1	Autophagy-related protein 101	1	72-99	RRAGIGVPRRGRRRRRRRRGGGGNIPSS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5M5	Uncharacterized protein	1	398-418	EERAQEREKAKKAKRDQELSQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5R1	Uncharacterized protein	1	318-347	GKKPTRAELKMYKEKRRQKKEEKRRAWLRD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S682	Uncharacterized protein	2	252-275, 335-354	GVDEDRRRRRNKNIRKSWKSGASC, GTPTTTSTPKQPQKHPQQLS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7A6	Mannosyltransferase	2	16-36, 580-603	REFIHPSAKHARKKAIRNAFA, PDWSIVPEKYRRKWGRHCLLKQRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7A7	H/ACA ribonucleoprotein complex non-core subunit NAF1	1	429-449	YYDRRPRSDGRRENRDRRDQR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S855	Uncharacterized protein	1	472-503	KDFTKRFFDEREKKKPREKTPNWRQQNLPVNT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8P9	Uncharacterized protein	1	887-913	GEGLRKVREKERRAEEKREKERERGVD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8X0	Uncharacterized protein	1	153-173	SLDHPKCVEARKKNLKCKIVL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S915	Uncharacterized protein	2	26-54, 278-297	EGGVKKPERNTTKRASRRRSELEERIQAY, YHQQGEKRRRRSQQSPQQAS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAJ4	Tudor domain-containing protein	1	219-243	ENKDDKPQPKFKKLKATKELEKSKS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB40	F-box domain-containing protein	1	47-70	LWRWYCQKSFRYWHPRHRFHEKLA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB86	DNA damage-binding protein CMR1	1	32-70	TAEKIIPQPKPPKPKRSSTPRTKREPIQREPPRPTRQSS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB88	Uncharacterized protein	1	231-250	LSSTRVSRPKRPKYVFKANG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SBH4	Uncharacterized protein	1	69-88	GWEQRWKPSHAKKDTKGSDE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SBZ6	60S ribosomal protein L44-like protein	2	2-25, 73-93	VNVPKTRKTFCKGKDCQKHTLHKV, ECSVCKTKKQLPLKRCKHFEL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SC84	WD_REPEATS_REGION domain-containing protein	4	7-30, 69-94, 101-121, 479-498	KPTIPAPEPPPKRRRVHDDDDDDD, GRPSSLPRSRSRSRERNRDRDRSPAA, RSPSEKEKQPPLKPNYKPRLL, VKVWRHVPPRMKIKREENGV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCF3	Uncharacterized protein	1	284-308	MPAPPAQPPKPRQPQKPDHFQERIL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCY4	Putative calcium ion binding protein	1	822-841	QSPNRHKSSKTPANPSRSSK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDL8	Calcium-dependent cysteine-type endopeptidase-like protein	3	689-717, 727-774, 1262-1291	AREAYEKRKREKLRKKLRKELNERRKEDY, EWKTKARDRKVEKKLNKKLHDKRMAAKERAARKRREKMAKKVKRAEDE, EEASKEREKNDDRKRPKLEKQDSKAPKLER
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SED8	F-box domain-containing protein	1	337-356	WCYACEWKRKQKPESAVYKQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEF9	SAE2 domain-containing protein	1	616-638	RELADKFGRHRHRFARRPSPPGY
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEK8	Transcription factor BYE1	2	88-108, 190-219	SEPPKRRGGGGKKKKAAPEPE, KAYEEEKAEKRKRGPKKGKKRASDQKEEAL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFP9	CCHC-type domain-containing protein	2	198-219, 254-280	IRLHERRQQRARDRPTQRQVYT, QQGHIKRNCKVPRKTWKPVPLNKNAVV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG72	Uncharacterized protein	1	135-160	VKQLAAAKQRQKRKKKEEEAAEKARL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGE6	Uncharacterized protein	1	545-566	HGDGRSTKRRCVRIRVVQHGGM
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RY42	2-(3-amino-3-carboxypropyl)histidine synthase subunit 1	1	18-42	ESHTSQPTLKQPKKRFVGKRAAGEA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYN3	SWIB domain-containing protein	1	60-79	QANHLAKLRSRKPTDKNLPD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0D0	Putative specific RNA polymerase II transcription factor	1	591-610	SSNLSKHKRTHEVKGRFTCT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0W9	Uncharacterized protein	1	347-368	LSESSSSKQRQKQEPNQTTQQS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S358	Uncharacterized protein	3	137-168, 194-215, 1080-1099	TTYAEEKLKWVPRKRHHSRWPIEPKKQDRMVA, AKQMARRCTRRLSRSPSKQLAA, TAKRSTRSSRLPPPKPVAKS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S468	Putative elongation factor	1	1025-1059	IEAPKKAKKLTSSELRKKKKERMARRKRGEEVFSD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4H8	Hydroxyacyl-thioester dehydratase-like protein	1	387-408	ELRICVQKKKGWKRGVRAGEMD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4T4	Calponin-homology (CH) domain-containing protein	2	267-286, 424-444	AEKEKKRKEKEAEEARKRKE, KADERKARSRSRSRPPPQSPG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S524	AMPK1_CBM domain-containing protein	1	95-119	MTAPDKQPKPLSKPRQRRPTYAQVA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S588	Putative sequence-specific DNA binding protein	2	369-391, 473-503	PMSSKNGSKPRRRTLKNLKPSGE, WDPDCFAEGRKMKKKKKRKKRKRKRGSDAYS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5B7	Uncharacterized protein	1	435-458	HTLPLRPHPSSKPKQKRYILGLRS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5J4	Uncharacterized protein	1	26-48	ILKNREGRPSKRANKKVAEEENY
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5M3	Uncharacterized protein	1	409-436	HTHKPVSPTKKRGPGRPRKINPNPDSKP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6T7	Uncharacterized protein	2	401-423, 427-451	SSGPSSKRGPPCQAKYQREHEGQ, RAGATLQRKHLPRRPRQREHQAQEK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S790	Putative DNA damage protein	3	462-484, 649-672, 984-1005	NSPADSKKSRSRRKAVEKSDNKT, SSPVVVQRRRREARKKAPAPQSVS, ATTGNSRGGKKRKRASAASSVI
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7S3	Ubiquitin thiolesterase-like protein	2	13-32, 759-839	ERNGDKSSSHRRNRSSEPVP, NGSASVSKEKRGKKEKDKKKDKDKNKEKEKDQDKEKDAEKDKEQHRQGNNKKERKPSKSRDRSDKNKRRGSKEPSKSDSEP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7U9	Terminal hydrolase-like protein	1	403-424	DEAIKRCKIPPKKRVTTTKTKQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S847	Putative pre-mRNA splicing protein	2	13-40, 280-312	YLTAEKKSSSGTKKRKRKQTTVSTGLLI, SPEDRGRGGNRKGKKEKSKRRPTYQGAWPPNRY
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8Q0	Uncharacterized protein	2	20-41, 223-246	WDVVVGKKPKRPPGSRPLPGPW, VPSSISPWKRRERARHLLEKKLFK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8V3	Ubiquitin-protein ligase-like protein	2	39-88, 1547-1567	AQAPAPPPSARKRKNIPDSPPTSTSVDTPSSARRSKRQRVAHTSPPPQPA, SKEFCKKKLKMWRDNDPNGDD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S912	ARF GTPase activator-like protein	1	26-49	LEPNKVCADCKRNKHPRWASWNLG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SA03	Uncharacterized protein	1	107-131	DGSTVVSKTRRHRNRRVLHKSTTYG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SA24	Drf_GBD domain-containing protein	4	19-39, 117-139, 171-193, 914-942	DSASPGPRQNHQRSKSRSSVL, SRQADRSPERRGRERDRERDGPS, SGDPSRPPRSTRNNENSPKKAKS, ETPRSRGASPAKKTPKKQAKADGQQPAKS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAA9	Uncharacterized protein	1	54-77	HRSPQRGSRAKRLRRSKMRQSISW
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAG8	Protein kinase domain-containing protein	1	58-82	KVFAAHTGHKRPKPPKPFTRSGPEL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAG9	Glycerol kinase	1	554-574	FYPKMDRKKAERLFRKWEQAV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAU9	Uncharacterized protein	1	689-716	ELNIKEIEKKHRRIQRAKRDERRLQLDL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCU1	Uncharacterized protein	1	462-482	VSEPRYTKKILNKQNIHEVKE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SD02	BRCT domain-containing protein	2	120-140, 301-327	VSAPSTRQRGRPRKVVQETGT, GKDGEKEKLKQKPKPLSPKKVNQMTLT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDB5	Fungal_trans domain-containing protein	1	661-684	SSWELALRYKRPQKSNNPGGHRSG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDX2	Obg-like ATPase 1	1	124-150	YYNFTRTYAKRAKPKKMPPKQAAQEKV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEN3	Uncharacterized protein	1	85-107	GAEKPPRSTNHSKHNNKSHKSTH
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEU8	DUF1752 domain-containing protein	2	74-105, 432-462	RLEASKKMRESRTKSPPPRRQRASSPRNHGGW, GLLMKRLNPKKRWPTPKRRSSHRPPNGESKT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEW9	Uncharacterized protein	2	57-78, 299-322	LLYYFRSRRRHHQSLNGRNPFF, VRPSRSFSRTRYPQRRHSRVYSSS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFW6	DUF4604 domain-containing protein	1	175-197	VGTAKPAKMKKAKKIKLSFGEDE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGW1	Zinc finger domain-containing protein	1	7-29	GTSKYIAKKMKQKGLTRLRWYCQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGY6	RING-type domain-containing protein	1	199-230	EQQAIKRQTRQRLEERRRRIREQRAEILRRRD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RY55	Uncharacterized protein	1	799-818	VPPVQPQQQQQQQQQQQPPQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYD7	Uncharacterized protein	1	90-111	DNDSVKKPKNNSKTDPNFKCCS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYG5	Ctp-dependent diacylglycerol kinase-like protein	1	72-101	PDFRRMTRSRSRSRSPVKPRKTTTSRKATT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S067	Origin recognition complex subunit 1	2	217-239, 599-620	DLIKRGTKATRRRKAAKEPSPEG, AASTLNKQSKKKNSRGRVTIET
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0D9	Uncharacterized protein	1	467-491	AEYDNHGRRHPRNRRLRPATGPRYH
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0V7	Putative response regulator protein	4	2-21, 95-114, 606-634, 820-842	GDLRSKLRAKFPRRNSGISP, LKNGAQSTNKRRQRARHLSL, TPPAKTSPPRPPPSSRKKKKGPDVQSLSA, NEEHTAKKSKAKKYRSAPNSSSS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2B0	tRNA (guanine(9)-N1)-methyltransferase	2	76-120, 302-321	LSKSQLKRLRKQQYWEQQKEARKAKRKEKRHERQARKRAEREAKI, REKGLCYKRAKQYKVRTAKL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2J1	Eukaryotic translation initiation factor 2A	2	517-543, 618-638	GENLSKTALKNKKKRNRKKEGGAGGDA, PTNPNAKKIRSLQKKIRAIED
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2K9	1,3-beta-D-glucan-UDP glucosyltransferase	3	275-300, 314-333, 1813-1840	VGFANLKGRKKGKKGKKNDQPQSEAE, AEYRWKTRMNKMSQHDRVRQ, QIRPPIYSMKQTKLRRRRVIRYSILYFT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3J3	Uncharacterized protein	2	14-33, 417-438	QTQYHRQTHRIRDTGRQRDS, LLLFWFLRRRRHQRLARGEIPP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3S0	Uncharacterized protein	2	321-342, 752-806	PSARTLRRRLLRSRRKNEDILR, LDREAAKKRAKLKQEKEERRKVKEKLKQERREARRRLKLEEKRKKREEEGKGDEY
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6C0	Helicase-like protein	2	207-234, 347-368	SKMSARQLNVLKRKRKREAQKAAQGKSG, GAGAGRRRGKTRKENNDLNRQW
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7G0	WAPL domain-containing protein	2	11-32, 98-127	FTPKKRITTYGKAARRRVQPRV, SGPSKMKQEKDEAKRAKKRRLTREESDQGK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7N4	AP-3 complex subunit beta-like protein	1	241-261	TIYARKCFPRRTKIVKIREKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8E2	Uncharacterized protein	1	441-470	GSPRQGSRGVEKKKKKKKRKADRAAENAAP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9P1	Uncharacterized protein	1	171-190	VVKGRLRKERPSKAQAKQPF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAQ3	Uncharacterized protein	1	310-355	QYHLQRRITKRDPRRICVPRPNHLLQRQQRLKRPTRPLHDRRHADP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB80	ATP-dependent DNA helicase CHL1	1	65-84	ICSALTWLRHHKRSRFSASF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCD0	Serine/threonine-protein phosphatase 2A activator	1	48-76	IPNLRDKIPKLEPRRRKKPEPENPMPVPE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDE4	Uncharacterized protein	2	121-141, 798-819	LSPQSPRKPPIKRFPIKVSAP, VSSSSPLARRRRRRPTSAASDP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SE53	SHNi-TPR domain-containing protein	1	417-440	ATDLTGLVRKKNKRKAEEPEETVA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEZ0	Uncharacterized protein	1	31-50	TSKAKAVEVKKNKKKVESES
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFU8	Defective in cullin neddylation protein	1	1-20	MPRTPKPKANASQQKPYAKG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGM9	Uncharacterized protein	1	40-60	VERAQRSRDSRSTRDRNHSPS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SH15	Heat shock protein hsp90-like protein	1	244-270	VEDDEDKKKEKPKKTKKVKETKIEEEE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHU0	GPI-anchored wall transfer protein	1	106-129	YALPPNVSRRKKPKLPPNAQPKTA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYG0	Putative exchange factor	1	44-72	LSQPPPPPPQQQQQQQQHHHHHQRRAFPD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYH9	Chromatin modification-related protein	2	1277-1299, 1301-1320	GHTSTRRSTRREANHNNNNNNSN, NSHNSSSKYQQQQQQQQQQE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYK2	Uncharacterized protein	5	29-65, 355-378, 477-499, 742-765, 792-813	APSPSPKPQLRPKAAARSSKIPRPSPRGKKGLQQHGA, ESPPQPPPPRRGPRQIRYRRTSSE, LPPEELKRRLQRLRQRQNQMLFT, DSQFVLPRRRGKSRRRTARASLPV, RTSPCKYDPTPKRRRTLHRSDI
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0B8	PWWP domain-containing protein	2	120-143, 336-357	GAGESKGKKLNKKQSKQRVLHLDA, ETKSAKSKTKKGKEEEKKVEKE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1G0	Phosphatidylinositol N-acetylglucosaminyltransferase-like protein	1	81-113	DDRRRIRHNDGSRSRSRRRKRFQKLLWVKQSYP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2N7	Uncharacterized protein	1	51-71	SNKTRMSPPPVRRRSPPPPSS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S455	Non-specific serine/threonine protein kinase	2	50-105, 143-181	DTPSRAYHDPLRRRNQSPRGWKRSRDDYRDYRDHRDRRDRRDSRKSRPHHESGSRD, RERNRDGYPEKRPRIRSRSPRGRPDKERRDRDNDRDRDR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4F3	Nucleoporin NUP82	1	33-56	VPLAYGKKIKPGPRRTIARRGTEI
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S689	DUF2431 domain-containing protein	1	22-63	NQAQKNQYRSQHQHQNPKNKPFSRPPPSKKQKTTHSKDNAAS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6G8	Ubiquitin-like domain-containing protein	1	46-65	SSSRRRRRYSHQPLAQHINK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6L6	Uncharacterized protein	1	515-536	RNSRSSSRASRWRRKRWDDGIG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S731	ATP-dependent rRNA helicase rrp3-like protein	1	457-488	AKNEMKKLQEEQDRKKKKKRKAGSVSARDDMD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7B0	Uncharacterized protein	2	436-459, 542-561	EAIVRKVIEQKRRRNTNKANDDQG, TSALSKPRQQTQPSQRPKGV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S831	Gal4-like Zn(II)2Cys6 binuclear cluster DNA-binding domain-containing protein	1	10-58	ASTPKEAASTRKRRRRAPAGGAADDCFTCAKRNVKCDRRRPYCSQCLEI
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9R4	C2H2-type domain-containing protein	1	237-258	STAALRKHTRRAHRPPSFPCPL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9X0	Aa_trans domain-containing protein	1	497-519	AHRSGKRSLKTKWTKNMFRFCVV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB55	Uncharacterized protein	1	555-583	ILTRVPKPSSPIRKQRKSKGTNRDRDSAT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SC52	Chromo domain-containing protein	2	103-139, 320-359	EYHNWERKMKERVRKQEETKRTGRPRKKRIVEASEPQ, VLSTAKKKVRPPKLKDSLAKRRQPPSTKKKQKATDPEPEP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCA8	Fungal_trans domain-containing protein	1	8-27	LSTHRRAWIRTSRKRSLESS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCB2	Histone acetyltransferase GCN5	1	28-48	SETDKDKKEENKDKKTVAKPP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCI6	RING-type domain-containing protein	1	327-348	TSSTIKQKKVEAQKERRMRLKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCY3	SET (Su(Var)3-9, enhancer-of-zeste, trithorax) domain-containing protein	1	81-105	ASNREVKKTGKNKKQHGSLRHKYAT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SD17	Uncharacterized protein	2	1-26, 1139-1158	MLAWPRTREGKKRVTQPPRNRHWAET, PCSATVRQRSWKKRFLSLRY
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SE22	Telo_bind domain-containing protein	2	752-771, 1693-1718	DRYMRRYQPRKPPAPQKPKD, IMIMEQKGRGRQKRLRSARHRSEDLP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEN0	Uncharacterized protein	2	108-133, 472-497	CRLFGGKCLKHRKDRHLRDEETRFKN, VLVALKECWKRWRRHKRGSESSDEDN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEQ0	Uncharacterized protein	1	21-42	WFIVEFRRRNDRKRGPGPTLLP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SER9	Nucleoporin NUP84	1	78-104	DSYYTFTRKRLDRLRERQARQRSAQRG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SF98	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit	2	7-32, 602-625	KVLLSRSKDSSKSKKNKDSNKDGTAS, EQAARRRKQLEEEKKKRQGQQGDE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFC1	Uncharacterized protein	2	11-36, 406-431	LKTGSWRTSRSRSRDPRDSYRVRYDA, REMPSSSPSRRRNRRREVQERERSSS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFP8	Uncharacterized protein	1	42-62	LVVVQGRRYRRQRPRSREVTV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG46	Uncharacterized protein	3	41-64, 466-488, 578-599	TPEPVEHRSRGKKRGRDDSYNPPT, ILDRGIRRTHHRARKQRRVDGSI, GVIAPIKRPKKKPVEEEEKQVD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG50	Cysteine-type peptidase-like protein	5	22-62, 102-128, 184-210, 213-238, 989-1015	SSPSQPPKFRSNNPERAPPLDNPRPPKRAKLNSPKKPLEEI, ESTACLDFKREKKHQQKRPNGSGFRVP, ILSYRASPRKCRSRTQPNPPKKRASSE, EDEKKSDSPKRQKMDPKTPNEQKKSP, WWHGCESPNTRKKRQPQPTQATKSATS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGG6	Uncharacterized protein	1	61-81	ADREERARRARERDRGARRIE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZB4	Uncharacterized protein	2	113-136, 490-517	ERQPQRSLLRSPPQRRRRTSEEEE, EEEEEEERRRRRRRRRRGQDQKRSIVVE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZM2	Transcription initiation factor IIF subunit beta	1	230-255	ENYLKTSTKPTKQKKMENKATRWPEN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZV0	Uncharacterized protein	1	224-244	GEENGKRKYKPKHPLLPTPAV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZX4	Uncharacterized protein	5	115-134, 136-155, 175-203, 210-241, 494-516	NPSQGPPKDRRPPPPPFREG, PPPPPGRRGPPPPNHRPTRS, PEPPRSPHRRPERPDRPERRPRRNSESSI, MTEEERRERERRRERERRHKEMKPKPSRKLDI, GLLGRMKSLKGRRKPPAPPDADA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S049	Type 1 phosphatases regulator	1	116-144	DHDKGGCSHRRRQKQRKRNPSPNAYERMP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0J1	TRP_N domain-containing protein	1	1073-1097	PEQPPEVPRKSSKRKSWVKSQSMVA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S164	Uncharacterized protein	1	136-169	WRGLGRKPWKSENGNRNQKQQQQQQQQRRWSKLL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1J3	Replication factor C subunit 1	4	10-42, 105-124, 985-1013, 1022-1041	PKGSAPPKPAKPAAKKEEEKKARAKGRKVIEDS, SPEPKPTKNGTKKPVTAYKK, LDLNKDKYIKMPKAKKPAGKKASKAAKAA, DDAPKKGKGKGKGSGRSKKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3A6	Uncharacterized protein	3	671-692, 2522-2549, 2557-2580	IDVLRRLKDKRRSIPEHGSRYF, RLIASKCKPKDVNKSKDKVKTTKERGND, KDLSPPPGPGHKKKPRMTLPILPQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3L0	Uncharacterized protein	1	103-126	LIKNLLKCLKKPKKAKKAEAAAEE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4K8	Uncharacterized protein	1	717-736	PEKVEKKRSRMYGRRVNREG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S510	Serine/threonine protein kinase-like protein	1	685-707	NRDWIWKFDWRSKEKRNPLGCLE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S557	Sister chromatid cohesion protein	1	1896-1932	AGGAAGQKKKRSRSSSQQPPRKRGRPRKNPLPEAASA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5M6	Non-specific serine/threonine protein kinase	4	3-23, 33-54, 93-112, 273-293	RTSTVRRYGKTARKTRADELF, TEKTEEGVKKDKKRLNKEEVVV, NRTHHPQKERIDHKSQRPSA, ETHQAFHRRMKRKDPNRLQFY
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8B9	WW domain-containing protein	3	124-151, 403-425, 515-561	GGAKPVEKPQPKPRPQPKDKPKSKVAIP, TPKLYWPEFKRKYRKEGPMRDTS, DEAARQAREERRKRHEKALQERERAVAEEKKRQERKLQIERERLREE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8Z6	mRNA cap guanine-N7 methyltransferase	2	19-38, 343-369	PQPFDAKKLAPAKKRPCSPS, AKVVEFNKKLQEKKKKKKFQAAQAAGS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCN9	RPN13_C domain-containing protein	1	16-36	VDQSSKPYKVKPKPTPGYIYL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDJ7	Uncharacterized protein	3	110-137, 141-162, 1008-1030	ESAPPYISYERRRIRRRRPFTKDYYELA, GTTMRHEKREYRRWEHRYLPCF, LDPVLPLPGRRPKRKLDSELTDA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SER1	VPS37 C-terminal domain-containing protein	1	242-265	VKRYREAKKLYYLRQERKERWDEG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEW2	SLD3 domain-containing protein	2	196-215, 413-440	ALVACRERLKPKKQMKAEET, VDDSEKGSRPKKRKRKKPKLGKDGLYPG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFG0	Uncharacterized protein	2	7-33, 593-613	PTPLSRAREAPTKKKQRKAQEVSDGEF, VEEGREVGGKRKRTKLKLNRT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGI2	Uncharacterized protein	2	187-219, 437-457	DRDRERYRDRRDGRDRRDRRRDRRSKEREDEEL, LFAEKLEGRNKKRQKAEDLFY
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGM3	Putative transcription factor	1	39-74	NDNPKQKTVMHRRSRTGCYTCRLRRKKCDEAAPICT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SH01	Uncharacterized protein	6	52-71, 174-195, 302-326, 455-479, 579-609, 658-680	AAPNRASTHKRKQPEPSLLV, DRMRIGGRDKVKKKKPMTGAAG, STTSPPPPRVRECCRKKSADKMALS, GSKASKKVPTKKTADKLRQKKETEQ, VEDETPVKRRPSRRHSRRRPRSPSPARREEG, GTDPQQTKKPKPQRTPSLKAVPK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZ98	Bms1-type G domain-containing protein	1	5-38	VSNGQHHHRPTTKTKHKPFKSRHATKRALRDAAK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0G3	Putative bhlh/zip transcription factor	1	278-298	SQEARRKRRRESHNLVERRRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S280	DUF155 domain-containing protein	1	74-95	TTTTTTTKRRTPPLKNSLHRVA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2X1	Nucleoporin NUP37	1	51-79	ATVVWRGGRRLKPPKPQTNEKRNGTKPED
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S406	Mannose 6-phosphate receptor-like protein	1	147-169	GSPCGAPENKRRRKRQYLEDDPE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S424	Protein kinase domain-containing protein	3	128-153, 268-288, 701-730	QPVAEQPQPARKRRRSRGPDWAEFYK, QASQKRKRTTRQQVANEARRR, TEAARIRLERQRQREQQQQQQQQQQQQQAN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4G9	Homeobox_KN domain-containing protein	2	251-279, 297-319	LNKQGVPIKQHKHRHPPPGHDQRKKNLTF, EAVRATRRARSRSPKENALPSPK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S507	60S ribosomal protein L25-like protein	1	29-50	KGVHSHKKTKVRKSTTFHRPKT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5G9	MFS domain-containing protein	1	499-519	VNWVFRTRPLRKRKEELARAA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5S7	J domain-containing protein	1	232-251	GGSSSESSEKKKKKKLKPIG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6I3	Anaphase-promoting complex subunit 4	1	371-404	ERQATINYGKQRRKKNKPPRKKPQRPLRGAKSLL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7H0	Serine/threonine-protein kinase-like protein	2	470-496, 503-545	YIPSYDRDPRRDDRRRRDDMMRDDRRG, RDQYRDRRRDWDDRSRTSRTRSRSRSPMRDRDRDRDRDREPRD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7Z2	U3 small nucleolar ribonucleoprotein protein lcp5-like protein	1	278-303	TNFVRLPKESKKERAKRARMEGRSGR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S849	Zn(2)-C6 fungal-type domain-containing protein	2	82-104, 125-144	SETAANPRKRKKASRACDFCHVN, CLYLRPTKRRGPQKGYRTAL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8Z4	WD_REPEATS_REGION domain-containing protein	1	186-209	RDSGSSKGKLRKPKNNMSKTNSSF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9M2	Glucosidase 2 subunit beta	1	162-183	EEERRRSKERSIKKRRALAKEA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAJ9	60S ribosomal protein L8	1	239-262	GIMGFKAQKREEKRKKSLETAIKV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAM9	Uncharacterized protein	1	255-278	EYYRDLGRHARKKRSRGIAPQPTV