ProteomeAccession	ScentificName	ProteinAccession	ProteinName	#NoLS	Positions	SegmentSeqs
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Y4	Protein kinase domain-containing protein	1	95-122	YQKCVIKVLKPVKKKKIKREIKILQNLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1D1	Uncharacterized protein	4	43-71, 119-141, 198-232, 353-377	RLEEKQSHARKEPKEKAKRQRGEAHSKDA, SLNAPKKNDEKRQKSVKQSRAQI, LTDTDKVKPKKEKKSKEPQKTETKKQRQNRQKAEA, EAWNTVSTKKTNKKKKEAATENLVD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1I9	SMP-LTD domain-containing protein	1	841-866	TERRPVPPPPLPKRRQPQPEQDGEDN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1T5	zf-met2 domain-containing protein	1	5-27	NGAKAAQKRARNEKHKNVPKAAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q232	Glycosyltransferase family 32 protein	1	407-426	LFSGSWRGDKKEKKKRRSQD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q289	Uncharacterized protein	1	8-54	LPFEREKETRRHKSRSSSHGRSSHGRSERPHRERTHRREKERARDSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2U9	Uncharacterized protein	2	65-87, 1155-1174	TDTESRRSEERNRSRPRGSRSAS, QLPPQQQQQQQQQRDWRNSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q350	Condensin complex subunit 2	2	79-102, 221-245	AETPGSSPRTPRRRRSVNYTTILD, VDEDGNVRKKPKKKTQRSSEATLAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3G8	FNIP_N domain-containing protein	2	318-342, 1159-1196	SAEDAKAKKKRLQPRQKRTPMYAVA, NYSTSSSRSTSKRREKERERRKEREKEGERNRERRDGV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q690	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial	1	10-30	AYVCRSCTQTLQRRLRRAYSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q795	Uncharacterized protein	1	94-115	LLKGWRQFIQHKRKNHLRSLNS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7C8	Uncharacterized protein	1	512-535	RAPEPTRSRSRSRSRPREPTSTSV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7H3	Tryptophanyl-tRNA synthetase	1	450-485	GKLTKNQLKKLEKQKQIEAKKAQKAKEKAEKAEKAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M0	Uncharacterized protein	1	572-595	EPTSAAKPSRRRPRYPKPVDWTPN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Z9	Uncharacterized protein	1	213-235	LERTKERWGPRRQAAREERRARM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q814	C3H1-type domain-containing protein (Fragment)	1	1004-1026	TPEECERRLRKERRRNLRVAFKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8N9	Sphingolipid delta(4)-desaturase	1	354-373	DQVGLRCRVKRKQGGRVVGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9I3	Vps54 domain-containing protein	1	168-187	APAPRRSSSRPRRGQTHGPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA78	Histone acetyltransferase	1	401-426	APDSRSSKAVKRKTKRRLSGPVVPRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAK1	Lipase_3 domain-containing protein	3	1-22, 223-248, 536-583	MGLFKWKKKVKKASTGGSQARD, ADRNPPPPPKSKKKSQGKAHSKGQTS, ASSRSYRNRPCPTKPPPPPPSSSCPCPACSSKRTKRTKSTDPDPDPNP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBF3	Uncharacterized protein	1	33-53	IPSSTPPSKTPKRRSIPLGAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCE6	RRM_2 domain-containing protein	1	590-614	PNAGQHFREEQRRRRSQYDRGTRLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE03	Uncharacterized protein	1	671-694	TSEVNTNSTRRRRAPKRRIVDLAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEX2	Uncharacterized protein	1	45-68	SPASPSKESQPPPKRLKRAYSESS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF22	Zn(2)-C6 fungal-type domain-containing protein	2	3-44, 60-84	TASSPSTRRSIRPHRKSRARCGFCKRRKVKCNEEKPCSNCVS, RCAAPTTRRGRGRPRKVWAPDCSRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF92	Mitochondrial genome maintenance protein MGM101	1	296-316	WVEHVVSKKRRQIWTRKDGEP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFV1	Uncharacterized protein	1	41-64	DEQVKLVRVKRRRRPQVETRRGRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGS8	Glycoside hydrolase family 2 protein	1	722-742	GKSAGRQKRGRGQYRFRWDDV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH09	Uncharacterized protein	1	581-600	ACGGRRRSGHQDAPRPRLRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHR6	Uncharacterized protein	1	37-62	DGALSPRSVRSRRPRRASRKGTAYYL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHV3	Uncharacterized protein	1	632-656	STNAVELRREKRRRDERRLELDLSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIE0	Uncharacterized protein	1	1-22	MTREADRKPKRRFWLLTSPRTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJG4	Uncharacterized protein	3	177-208, 291-313, 336-357	SPPSTITSRPQPRPRPRSKKHRTPGRRRAGTP, VEYRKREERESRAKRTARRRGAV, AASGVGKKGKAQRRKVRFLEMD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK67	DUF155 domain-containing protein	1	76-97	TASQASQKRRKLPLKNSLHRVA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKC2	Uncharacterized protein	7	56-82, 113-146, 153-177, 246-277, 517-540, 875-898, 1043-1064	PGAPGSLAWHRRRRRARALSPELPRAS, LPATQPTRVKSKRAKKKSSEKKRKAELKEAAKAA, VEAAIQDHKKRRHRSTAPSPFPPRD, SSARPQGKRPRRDSDSKPRKNRKSSRSSNLGL, DPSDTARKPKPKKQKRRPEAETAV, NAAVSANKKRRKGKKVVRPTSTDD, GSETKASKFSKRQRRASLSDVE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLT9	SH3 domain-containing protein	1	135-155	VLNARRKKLARRRQQIEDDEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMI0	Thioredox_DsbH domain-containing protein	1	522-543	REKLRAHREKERPRPPRDEKIV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN58	Uncharacterized protein	2	2-24, 69-90	DATYTQHRPSWRRKSRSGAGLDS, LLSHSPPPSRPRRPARGASVPY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN61	Protein kinase domain-containing protein	1	537-556	SFFSHLRKRARRFSGRHQTP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPQ7	Uncharacterized protein	2	429-453, 992-1019	AESSTGKKRPSRKRVNPKTQPNATA, GQAPQKSKRASARRKSRARKSSTPAVMP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZI5	Uncharacterized protein	1	36-56	DTPTYQRMLHKARRRRNFSEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q025	40S ribosomal protein S4	1	1-20	MGRGPKKHQKRLSAPSHWLL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0H4	Protein phosphatase	1	43-63	NPYHRVQPPKARRGKASRPES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2D4	Uncharacterized protein	1	433-454	GRVSGRSRTKRMRMGMRMRMRI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2V6	PWWP domain-containing protein	2	139-158, 324-344	GGAAKGKKLNKKASKARTLH, AETPAKDKKAKKRKAEDSMET
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3B1	IBR domain-containing protein	1	170-194	AISELDKRSKKKKEEEEEAEKRFRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4Q7	Uncharacterized protein	1	442-467	SSDARHDANRKHRPHRRHFSVDNFSV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q608	Uncharacterized protein	2	119-145, 186-208	SVDDLRAEKRRARRQRREMKRDRLLAD, LLHVTDTKSKRKRNCCRWVLFYA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R9	Uncharacterized protein (Fragment)	3	38-66, 143-165, 651-693	PQLFHDPVSTRGKKRKRRRDTQDEQAGND, KEEEKMSKKKKEAEDKKSEEKKE, KASITTKSSWERRREHKRAQAIEASKRRKRQRREEEKRGGGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6V1	PPPDE domain-containing protein	1	1-20	MPTRKHQKKSSRSHRSTLSL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q724	Uncharacterized protein	4	282-305, 1269-1291, 1524-1547, 1672-1691	GISSQPTGPKKKRTPQRAGSHLAA, YGGAKKSGRKGPKREVRPSRLAD, ALPSSRRSPRLQKRWSSSGRRASW, SSTTRRKRLGALRKMLRLND
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9L9	Histone-lysine N-methyltransferase, H3 lysine-4 specific	3	853-882, 1033-1055, 1104-1130	PQGAKARKKAPAKPKKKSKKQLFEEREALK, KYLPHHLKVKKAREERQAQNGKS, DSDVLRFNQLKKRKKPVKFARSAIHNW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAL4	Methyltransf_25 domain-containing protein	2	17-38, 142-165	YEIEGSPRSRKKPTRSNSTAAP, HDHDHDHDRHRHRHRDHRMSSSHK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAN0	Uncharacterized protein	1	74-102	IILPRQRDRARSKSQNRPRRDQSQDKISG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB77	Ribosomal_L18e/L15P domain-containing protein	1	1-20	MPTRFSKTRKHRGHVSAGKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBB9	Uncharacterized protein	1	203-228	GMYYKEKDRCKKCKGKRTVKETKALE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC99	Uncharacterized protein	2	373-394, 509-533	PDNSPHHRHHHNHQHRHRHSAR, NESGVRPAKKPRTRKDQEEHHFWAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEX4	DUF676 domain-containing protein	2	950-973, 1170-1204	AESPSAIKKRHRRELERAERENRE, YSERLEPTWRKEAKRRKREEKRRRHKEQMMAPDDQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHB6	Lysine--tRNA ligase	1	22-50	VTGERVSKSELKKRQKQRQKEAEKAAKAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHF7	Mitochondrial Rho GTPase	1	399-426	STTAALKVTKPRKRRRRPGRVERNVVLC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHK5	Uncharacterized protein	1	102-122	SYSFSARKRKLSKKGRHADVF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT9	TPR_MLP1_2 domain-containing protein	1	1932-1951	QQPPQQQQPQQQQQQPQPQS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK55	RF_PROK_I domain-containing protein	1	171-194	ANEARVKAKKMQKSKKAFRRGFDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK63	VanZ domain-containing protein	1	110-130	LCSWYHKRMLERKRRRKYAAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKB6	zf-C2H2_3 domain-containing protein	3	20-39, 213-236, 257-284	VSQGRKRPLRTYSRRTIQTR, VSTDGRVKPKKRAYKQPVKDMMQT, LYNPFNEKDRKEHNRRHAASSRKRRKTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL50	Uncharacterized protein	1	11-33	SFGLRRSFPPPQQHNPTNKPSPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL94	Uncharacterized protein	3	3-39, 693-721, 770-814	AGSTKDGLPHRKKPILKKEVKSLKRKRGEEDLNKLKA, DVEDKQIAKKRLKEKRERRKAREREELGL, EEEDREPPRKKAKKWFQDDSDKEEEKKKKKKKKGGKKVIEIGHEP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM52	Uncharacterized protein	1	511-535	KIAPTDRLSKRKRAERIQPLYNKYA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMA1	Response regulatory domain-containing protein	2	559-584, 773-795	ASSPRPTPATRPKKKKPVETPPLPAG, LEDASTKKAKAKKNRGAPNSSSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMS8	Alcohol oxidase	1	19-38	AEPQHAKRTPKCRCTPGEAC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNH6	Uncharacterized protein	4	78-101, 104-126, 153-183, 715-734	LTGSATQKKAKKSKSKQSEDVADD, DQEAKESRSRKRKREDVDQTAIL, NPENDVKQERKPKREKRKKKKQEDYPDAEMA, TSSTKTSRRTRTLRAFAQNK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q014	EGF-like domain-containing protein	1	69-92	RPPGGNTQPPQRPRRPSRVPSILD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0C8	DJ-1_PfpI domain-containing protein	1	195-222	RVRVPSRRLSCTKEKKKKEKREERRKEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0L6	40S ribosomal protein S30	1	24-44	QEKKKVPKGRAGKRLKYTRRF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0X1	Uncharacterized protein	2	16-36, 606-634	NDDPRPPSRSQSRPRATSPRS, QGGGEGKERYGRKKRRRRRPAEQFELDLE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q117	Uncharacterized protein	1	30-50	GAVHKRVKRVRSMSRGRRRAM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q176	SET domain-containing protein	1	105-130	PYGPWCCASKKLRKHHVRTREQQVRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1U1	Uncharacterized protein	1	129-148	VWRNKVKKVFRGKRDKARFE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q285	Uncharacterized protein	1	186-205	SEGRRKFPYVRPPPECRKFR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3J5	Uncharacterized protein	2	65-95, 1308-1327	RIAYLRYILQPRKKRKEYISAPKPRPHPRVH, RNLGTMRKAKEEKRKEAQAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3U4	Uncharacterized protein	1	70-91	ACVDVQHKKRGRPRLRDDGQAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q568	Fungal transcriptional regulatory-like protein	1	31-72	DQSSQPPKKATARKRTKTGCLTCRRRRIKCDEGKPTCNNCIK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5G8	Cir_N domain-containing protein	4	173-227, 229-271, 295-317, 338-359	DAQDKAKRREEKERRHKHRHSHRSHRHHDDRDDERHSRRRRSDSRDRSRSPRRYD, EEEDRRRRRDSRERRRDRPASMDSRDRRDRRDRREDRGRRSSR, SPPPRRREYSPDRDERRRRDRSV, AYTSRRRHDDRRDRYPLRQDRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7T4	CN hydrolase domain-containing protein	1	123-146	IEEEENKKKKKKKDEKTYYNTSLT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8G5	Uncharacterized protein	2	72-93, 459-483	ADQWKAHPPAHHRRHNHRGTTT, EATVMRSQKRRSRPRQDRQHAGNGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8Q4	Uncharacterized protein	2	104-140, 343-364	EGTKDNTKDKAEKKKKKKKKAKKKKAKKTTDAPKADT, RGDGSQQPAKRRRLRNIRTDIG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBH3	Uncharacterized protein	1	43-62	ITPGRYHNRHSSRQERPAAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBH9	Uncharacterized protein	1	15-36	VSLVRLKKGKKRFEIACYKNKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCV6	REM-1 domain-containing protein	1	92-111	TPTPRPQASQQQQQQQQQQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF04	Tudor domain-containing protein	1	226-251	ENADDKPRPKFKKIKATKELEKGKTK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGC7	G-patch domain-containing protein	1	77-98	DEGPGGRWKHKRLRDKAVSFVS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT7	BZIP domain-containing protein	1	49-80	AERRRIQNRIAQRNYRKKLKKRLEELERRAGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIB9	RNA polymerase II subunit A C-terminal domain phosphatase	1	16-35	TVVKLHKKPGDRIKKQETLM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJE7	Uncharacterized protein	2	77-96, 110-133	LPEKERERSRARSNARRGPV, GAGEPVRRQVRKRRSRREIAVGSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKM7	Kinesin motor domain-containing protein	1	912-935	SSAGGGKSRKVRKLPGKRWNAVGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLL1	DH domain-containing protein	2	221-249, 1187-1208	LPTSKLRRAPSRPMSLKRNKSFSKNQKVE, TESGSVKSIKKKRRSSLSDLKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM35	BZIP domain-containing protein	1	162-186	NAAALARFRKRKKERERSQQEELQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNR6	Uncharacterized protein	1	1317-1338	GPAPEKTEKKGRKKKAAAAAAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0D7	NADAR domain-containing protein	1	1-25	MPPKRSKPQHQKSKRIRVARPETGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Q8	Peroxidase	1	272-293	DEKWQWKKWNGPKQYEDKKTKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3B3	Zn(2)-C6 fungal-type domain-containing protein	2	1-35, 591-619	MDPTVRRRRRPALSCWECRRRKVKCDHSNPCAHCA, LAYPEKPTPQGRRRRRRQQQQQQPAGNGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3S1	RING-type domain-containing protein	1	678-698	TSTPRPPQRRSPPSEAENRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3W7	Origin recognition complex subunit 4	2	79-98, 155-180	EEPPRPPRPRQVLPRTNGET, ATGQEAGKKKRGRPRKRDREAIATAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q436	TAF1-like protein	5	200-219, 340-362, 492-517, 997-1030, 1084-1107	AHWISKKPVKPPKPLVPTKL, FLDAPPKKRRRETPKGLPPIPRF, FTFVKFKPPTVKKKKQLKGKRIPEIF, ARIEQERLEKNKERRKKREKQKKLQQKMREGGIP, DGGKYPKFRKRDGWRPTQNPRMGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q455	U2 snRNP auxiliary factor large subunit	1	15-60	SSSRDYPSSRRDRDDRRDRGDTRDRGGGRRRSRSPDYRSGRSRRDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q466	BZIP domain-containing protein	1	37-64	SVSERRTTKDGQPQKRRGPKPDSKPALT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B2	Developmental regulatory protein wetA	3	233-275, 495-514, 966-995	APIVKKTPVRKAKEAKTPKEARPPKEPKPKTPRSSKKRAEVNG, GCRLRKYRGKCDKARPSCNM, STAYSQQQRQQQQQQQRQQQQQQQQQQQQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5B3	SAM_MT_RSMB_NOP domain-containing protein	1	842-862	RDGNKGQKQEQQQQQQDKKVN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6J7	Uncharacterized protein	1	1-24	MGPWSRRRSRRNTVSRLVRHRDNS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q722	PHD domain-containing protein	2	3-23, 347-374	ATDPRRSSRARTNQSQSQNSS, ITVQTKADKKRSHKKKGRNQYTRDRDGH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAG8	Protein-lysine N-methyltransferase EFM6	1	186-205	TIFFCFKKRRRADMQFLKAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAK6	Uncharacterized protein	1	234-258	HLDNERPRDRKKRDRFEEELRRQTS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB07	SpoU_sub_bind domain-containing protein	2	83-102, 160-181	EERPSFKIRKGKKDITEYPD, VPRPDLRSPPRRRSARERQSVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD68	J domain-containing protein	1	57-79	DTVDSLRKQERRKDRKIWLLFAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDA6	Separase	1	1740-1764	LDKHLPSRRQVRGKKTTKPEQTAKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEK8	Uncharacterized protein	2	437-459, 468-494	IPPLSMTLRRRGRQKRPSVSSAG, AAAQQQAPKRRGRPKKAKSEPEPEPEP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QER6	Uncharacterized protein	2	25-50, 399-421	AASSHAAARRPRRNPNPSPRPPASCQ, IRYATYMRHKRQKEAEQRAKEAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFV2	MFS domain-containing protein	1	470-489	YLLWRDKKRAREKEAAIPQS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFX4	RRM domain-containing protein	1	92-133	FDRSERDRRRSPPRRRSPSPRRRDYSPRKDDRRDRDRDRDRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI23	Uncharacterized protein	1	105-130	GMAALKPRDRTKRKAKAKKRKGMTAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIU6	Uncharacterized protein	1	331-356	VLTAHRDPRNRQRSRLSRKERECSPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJY7	1,3-beta-D-glucan-UDP glucosyltransferase	3	288-316, 328-347, 1823-1849	VGFANIKGRSGKRKNKKKKATPENEAEAL, AEYRWKTRMNRMSQHDRVRQ, QIRPPIYSMKQTKLRRRRVIRYSILYF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKF2	Uncharacterized protein	4	85-121, 195-242, 1299-1322, 1732-1755	TDDGPPAKRRRIRGATPNNTVRKPKPESPPWKKIEPD, SGKQPPPKSPANRTPQRKPAAQDSKSSARSRRRSPSPKRPATPAKQSL, LTLDTHRRPHKQRPKVPQKIMSWF, ESTPLELPKDKKKSRKRGRDTRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKW9	Uncharacterized protein	2	122-144, 370-390	TTTTTKTTTKKPNRLSRIFHRKH, LWYFHKRGKEEREKREKEAAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLP4	CDP-diacylglycerol synthase	1	503-529	TSGFRRTWRYLREKIDKYRQGRRAEKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMF3	Chromosome segregation in meiosis protein	1	60-79	KELDLKRRPRAPRVKLDEAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNE2	Uncharacterized protein	1	97-116	GGEKAKKKKVNPKEGGGKKF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPX0	Uncharacterized protein	1	17-36	AEQARLRKARREAKIKAGAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQE2	Uncharacterized protein	1	593-626	VVVERRKREIKEHYERTRKKLRWQPPKGGKDSVL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Z9	Uncharacterized protein	1	405-425	ATPVPKKSRKRALLDQARKQL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q192	BRCT domain-containing protein	1	79-98	ADKPTRGRGRPRKVVVEQPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1D8	Uncharacterized protein	2	53-76, 202-223	VGTVLVCLRKRRRRLPFLPRGVSP, ITSPKRTPSRRLSKPPPPNSAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1W4	Uncharacterized protein	1	14-56	SRSPEEQFRVVRKRNRVPLSCYPCRTRKKCDRSHPCGNCTKRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4X1	Beta-lactamase domain-containing protein	1	77-98	LVEHRDDKNKNNNNNNNNNNNN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6E5	Lipase, GDSL-like protein	1	351-370	YDGVTKKTSRTGKRAKPFVH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6M5	RING-CH-type domain-containing protein	1	494-522	ALYTKYRRVQVRAKRRVRNVERRTGSRST
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q702	Uncharacterized protein	1	554-573	SGKILRRLLRDKEREARRAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q709	Zn(2)-C6 fungal-type domain-containing protein	1	55-81	HSDGRHKRVWKACERCRMKKTKCDGEF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q719	AB hydrolase-1 domain-containing protein	1	53-79	FNKLTSPAQKRAERRRRSISTTIRNAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q760	Uncharacterized protein	1	403-429	RTRENVWSRAWRRKKLREQQEGTKSKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7V4	Uncharacterized protein	1	16-41	LPSHPTYQGRRQQQQQQQQQQQQQGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8I7	GAR domain-containing protein	2	672-692, 781-800	LAPARNSRPRHQRDNREIKVY, HSPVSPLKVRKTRRSPTVNS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD89	Uncharacterized protein (Fragment)	2	418-437, 796-820	HIRLHRKRARIRERARQATR, QDRASPPTPPQPRRRRAASRADGSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE91	Uncharacterized protein	1	472-492	AARLITGRKHRWHRDKFLAQS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF36	Uncharacterized protein	1	797-819	SVSGDGAGTKKKNRRKKRKGGKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFB0	Uncharacterized protein	1	40-61	QNTDGNKPPKQKKRVRFVRGHD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGM7	Uncharacterized protein	1	33-52	HAPSNKTRTKPRGPGLFSRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH96	Sec3-PIP2_bind domain-containing protein	1	71-92	VAVRKSGRVRVHKSKENPNGTF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI67	Uncharacterized protein	3	22-43, 277-300, 796-817	NSPTATRSTPRKRRSSMANDAI, PIALDTIKKKHKRKWYQSVDQALQ, ISELRAERARKRKERDEALARE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJP8	Uncharacterized protein	1	987-1018	EVGRRPAKKIKVNVPPPRPRTRQERSAREPSD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL23	Uncharacterized protein	1	301-322	VDWARRVERHVRSRRAGKGRFI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLI9	Uncharacterized protein	1	52-75	GCGRRMRADNRKRHLKTCKGMRYE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN70	Glycosyltransferase family 34 protein	1	3-23	FALPPRKTSRPPPYLPRTSRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNA9	Zn(2)-C6 fungal-type domain-containing protein	1	2-64	LLYTRLAPPKQPKRRSRGGTKKKCDEKRPKCSRCQDQGVECVYEAVKPRQRRRRDSAAPSSPH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNL7	TauD domain-containing protein	1	292-316	LSASSTHRIKKKRRAYEGRKRVDTH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPD2	HIT-type domain-containing protein	2	12-34, 253-274	ICHTEPPKYKCPRCGVRTCSVPC, GPPAAKKRKTHHHNKNQFPTVC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPL0	Uncharacterized protein	3	178-199, 573-595, 678-697	QLATWKRFRYWQKKNRDIYNVE, DDTNHPRPLKRPRNDSNKPTSYA, TDVACRRSGRKLSKERVPLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1I1	Dolichyl-phosphate-mannose--protein mannosyltransferase	1	521-544	IVSLPPDHKRREKPERKVKTLPFL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2A2	DNA topoisomerase I	3	59-79, 129-151, 185-205	GAPLAKRQKSQHQKAEPDSDD, KSIRADAKTKKATPRKSIKEESD, APIAKKAKKAAPPPKKGKDTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4A6	PPR_long domain-containing protein	1	85-106	APQARPPKRVPAEKKPQPPPAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q573	Nucleolar GTP-binding protein 1	1	611-633	RTKAERQAKLSQRKMNRMARQGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5V0	Uncharacterized protein	1	598-622	MLINTRTARWRRRAPTTPSRWRVAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6S3	P/Homo B domain-containing protein	3	72-97, 99-122, 730-753	EHDVVKRELARRRKKRSLGLGGRDVL, GVLFSQKQRLRKPWEKRVVPRLFG, GIYLYLARRKRLRNKTRTDYEFEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q721	G domain-containing protein	1	380-406	ALSMNQARKKDKQARKARNEAKRLGIS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7P3	Protein kinase domain-containing protein	1	306-341	ETIRPTPKRAEKTRESRLKLPESQGHRRQRSRQGAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8F0	Ubiquitin carboxyl-terminal hydrolase	2	234-260, 922-941	PDLPFPQRTSKLRRRKKHLGADAERVE, SSNGQKAKQQHKESMKENKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8H4	Zn(2)-C6 fungal-type domain-containing protein	1	15-54	ADASGDAPRRKRRSSKKVKSGCASCKQRRIKCGEERPECY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8P6	Uncharacterized protein	1	996-1023	HHHHHHPHHPHHPPSRHRRSRSHTTGSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9K1	Cut12 domain-containing protein	1	517-536	ATRQRAKRSREDLKRVPHDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC9	Uncharacterized protein	2	17-39, 50-73	EIVLCKKAQKSKKSKSSSPCTVV, DICKDCEKSKRQCHKEWDKRWEKI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAU5	Uncharacterized protein	1	2-28	GDDELSRHPRNRRTKTRANDRRTLPGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB90	IPPc domain-containing protein	1	861-881	TATAKRFLKPKKKEGSDQERM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC83	Nuclear cap-binding protein subunit 2	1	13-36	QPSAYFASRNKRRRLEREQRDGDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC95	Tyrosinase_Cu-bd domain-containing protein	1	16-37	AWANPMHKRWKPNAPRNPDFPL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCN1	Uncharacterized protein	3	272-293, 682-722, 739-785	LNPSSRRNEGRRRVPRPERTDS, YSERPRDRERDRPMPRGRERDRDRYRRDRSRATDRDRNRDH, DFDYRSSLKRHSDRDRDRDRDRDHDRFRDRDRDRNRDRDRDLPRRGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDM7	Peptidase A1 domain-containing protein	1	7-27	GSQKRSFKINCTRNPTFKRFD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF02	Protein BFR2	1	538-561	LKENKTRKTVDRRASKGRKLRYTV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIQ7	Alphavirus-like MT domain-containing protein	1	169-193	DYETANRRNAKKQRARAVQQNPAQF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK64	Bromo domain-containing protein	1	1026-1045	DEDLPPKQRRARPRLGATGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK76	CRAL-TRIO domain-containing protein	1	289-313	REEQWARPAKWEKKKKEAEAAAKNE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKJ4	Uncharacterized protein	1	62-82	STPEKKRPPLIPPQDHRRLRQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN77	Uncharacterized protein	1	268-291	VFVVVLRRRRTKRRQRDRGMGSGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNB1	Uncharacterized protein	1	642-667	LETSSSREKKKAGKRVRTRDEDDKSL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNR8	Zn(2)-C6 fungal-type domain-containing protein	1	5-34	HLTPNACLVCRRKRTKCDGQLPCRRCRSRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNX4	Uncharacterized protein	1	18-41	ELSRSESRERRTRQRSARPRLMTG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQC3	Uncharacterized protein	1	22-50	ANSGNNNKNRVSKKKKDDGPKPKKEDDEN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0V0	Uncharacterized protein	2	294-322, 600-621	VSSGSRKGRRSPAKKRKSKSPEERNAKEE, HPAHRMQQQHHHHHHHHHPPHR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0W1	Uncharacterized protein	3	318-339, 495-515, 643-662	LSPGRRAQTRRKPAPGRKPSRT, VNEKTGTRRRRQKAAARRQGS, ELNHNHNHHHHHHHHHHQGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1R2	DNA-directed RNA polymerase subunit	1	131-160	RDPKVRFKRVWDICKSKRRCDNDPPKQAED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2P5	Uncharacterized protein	1	100-119	NFVPQKRKSWHKVYDKYEKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2W6	Uncharacterized protein	1	1-39	MNGTTVKANDKKKRAKKGHYKRECRSPKKEWKPVPGKEI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q351	Uncharacterized protein	2	246-269, 895-922	VVGWHWFTSRRRRQRMRDAAARAH, GAWMGIAKAKRKQRKHPGTELRYKPYRI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4H9	Uncharacterized protein	1	410-429	QALARWKSLRERRVQAQRAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4L4	Uncharacterized protein	1	11-35	NANLDHSKLPQPKKRSRPEVISLIS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5B4	Uncharacterized protein	1	173-195	EAESRFLSKRKRRVSRDTQPVEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X5	G-patch domain-containing protein	3	3-23, 190-238, 257-335	LAAPKNKRKLGNDPNNTKWSR, EDDQAQKKEKKSKKRKTDSEAEVDNEGEKKRKKKKEKEKSSRRNAEPEE, SEAKNDEKAKKEKKDKKDKVDKRDKKDRKEKKDKKDKKDKKERRRKEKEASESGAETADRISKEKRRREKESKDAPETV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6H9	Mediator complex subunit 12	1	37-64	QQSQPQPQPQPQQQQQQQQQQQQQQQQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6T0	WD_REPEATS_REGION domain-containing protein (Fragment)	2	1054-1078, 1185-1205	TDGHVAVWKKEKKKKNQNPTAASSG, SNDQRVKLWRAERRREKEEEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q778	Uncharacterized protein (Fragment)	1	6-36	TYYNYGKKGHYKRECQSPKKEWKPVPRKEIA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q943	Uncharacterized protein	2	69-91, 530-550	EPAAEQRRRSPPKHDPWWNIHLF, LTPPGHPLRRRQKGVRRAAVW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9H6	Uncharacterized protein	1	51-71	DGVAPRAKMNQQRARRFRTAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAB0	AAA domain-containing protein	1	13-55	GGGKDGRDDKDKKKDKPKYEPPPRPTTRIGRKKKKAGGSSAAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC6	Chromatin-remodeling ATPase INO80	4	336-364, 430-453, 497-522, 1711-1733	VTERPEKGEKEKKQSRKSIKTSRNSDIRS, DEFQAWKERAQRRRQEMNRRDIAQ, LFAEKERKKDMQRKRRREKSMATTMD, SGEYDKIQKKRGGKRKRGGDGAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAX2	Uncharacterized protein	1	111-130	KPKGKDREKGAGKNNRPRPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD84	Uncharacterized protein	2	2-21, 73-104	AKSARSRVVKENNRRLKQNV, EDAKPASKKLSNKRKVEKRRRKKSSIVFPMRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE02	FAD_binding_3 domain-containing protein	1	149-173	LAEFKDKGEVRRRRRQQFHEGIENT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFF3	MFS sugar transporter-like protein	1	480-504	VFDSGRPAWKKYKKSSKLEELAREI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ12	Adenine DNA glycosylase (Fragment)	1	339-361	AVNHARKFPLRKPKKKVPLEDIL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJQ3	Kinesin-like protein	1	160-181	NALCDPRKRNHVPYRNSKLTRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKZ7	Uncharacterized protein	1	35-59	SLTHPVSPPLKKRRRAQSLEETEPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLW9	Brix domain-containing protein	2	40-65, 403-446	GITITMAKRRSKKRTHVGANNPATVN, IQELEKRWEQRKKEKEARKKQQKENIEKKRKAKEGKKNAAGDKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNR2	Uncharacterized protein	1	1-26	MPRSSQGTPRPRPRKPPMTRRASSNA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPY0	Uncharacterized protein	1	378-397	HWEARQQQQQQQQQQQQQQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q040	GATA-type domain-containing protein	1	911-935	ISSSSLSSSKRQRRHSKSVTAAEQP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0M7	Uncharacterized protein	1	220-240	SSSSPKPSHGRGERRQRTNSV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0W8	Fibronectin type-III domain-containing protein	3	336-362, 932-973, 1141-1160	ELEAEKREKRKEQKKKEEQTERLKKDV, ITSFFKSKPEKEKDKESKEKSKAEKKDKAKAKEGKEKSKNAE, KAPSRWLSNFGKKGKKEKES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q145	Uncharacterized protein	1	209-230	KGWTSSKRSKWLKDHKGPYTAF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1V6	Uncharacterized protein	1	790-820	AWCVSCQTKRTERRAPKCRKCRTAVIGQYVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3J7	Uncharacterized protein	2	17-43, 168-190	GSPTDEQDSQKKPRRSQRLSQRADRDV, AAVTKRGSRKKQATPAKQQDQND
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3R1	Uncharacterized protein	1	76-102	LLKDMLSKSYRQKRPKSRATMNERLAF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3S0	Anaphase-promoting complex subunit 2	2	148-172, 266-285	QQQQQQQQASSRRRRGRDRDVTTST, QGSRRRQIGRKEKGKGKGHH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9Z1	Uncharacterized protein	2	75-95, 1105-1126	NFVRRRHSSTWNKLTHRNQPS, IRDYERERRARERQRRLVEEEH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAL7	Zn(2)-C6 fungal-type domain-containing protein	1	4-29	TAVKRACDACHRRKVKCDGITPCRNC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBR3	Uncharacterized protein	1	7-28	STPAGRALRRLSRPNRRLPVFS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBS5	Zn(2)-C6 fungal-type domain-containing protein	1	6-29	SQACNACRVRKVRCSRTQPCTQCA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCA5	Fungal_trans domain-containing protein	2	4-30, 455-479	QCVPAALVPRQRRRRFPERELLERIRQ, MLLEHCFRRRRRQHQQQQQQQQQQL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE58	Uncharacterized protein	2	2-25, 663-694	TKLWLPRGLSRPLRRPVRRNGTGI, LGHVRRSQRRGPTPPPPPPRSEQQQQQQQREG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF37	Uncharacterized protein	3	138-162, 221-248, 596-622	ADITGPRRLRARRLKRQEHEPDSDS, PARASRTINNRQTQRRRKPTGTSPRRPH, DLRLARHQMKQRDRKVREQRQREEEVE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH95	Uncharacterized protein	3	60-81, 142-166, 914-938	QITFPARRKIVRKYGGRRSLPA, ASVAGRRKTADPRSKRRKTMGDMPT, HSSQQLRVRRQPRSPGQTRRQPTTT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHC0	Vacuolar protein sorting-associated protein 27	1	43-67	VQPKEAMRSLKKRINNKNPNTQLSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHK7	AAA domain-containing protein	2	422-466, 480-505	KKEREEKEEKEKEKKKKKRKDKGRKKSSKKTKKSKKETESESESS, SESEREEKERSKKKRKPAASAPTPAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHQ1	BHLH domain-containing protein	1	96-119	PGFPTRRRLRTRDGHERKRSRLSM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHY8	Protein SQS1	3	262-285, 451-474, 478-505	TRPPSQVSQKRSKARRRRLQALEA, WGYLSGRTRKRRSKHPPNFNVSDS, AALKTAWQRDRERKKSRKQERETLRSQG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI59	Uncharacterized protein	1	885-910	EELMQLMANKKKRKRRKGGGSGAGAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJF7	Uncharacterized protein	1	12-34	NYDTHHRTPRSRRRSQFHSQATC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJG3	HET domain-containing protein	1	1-23	MRRFFRRHRKTSAKNDDLQQKQR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLS1	Glycosyltransferase family 32 protein	1	405-441	AEEEQRRKAEEEKKKKQKEEEKKKKEAEEAERKKKEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNB5	Zn(2)-C6 fungal-type domain-containing protein	3	28-57, 133-155, 709-733	GSSAQGQKRAYRQRRKDPSCDACRERKVKC, QLPDIGQQPKRKKRPASIHDLAR, LPKPPPPPPPQQQQQQQQHHQQQHQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPM4	Uncharacterized protein	1	222-243	GARSWRTAARRHSRSRTAKEGC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ45	Uncharacterized protein	2	228-255, 322-359	AQGGEEESRRRRKKKKRIRVEGPDGPGT, PEQEGGTEEKKKKKKKKNKNKKKKKRERELSKEANGDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZZ7	Pre-mRNA-splicing factor 38	1	240-260	SERSRSRSRSRSRSASATRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1P2	Glycosyltransferase family 90 protein	1	64-91	DERAPLRARRSNLPKKPRRYFLPALVFC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E4	HTH La-type RNA-binding domain-containing protein	1	137-160	DSADGRKGRKGKKGRTADKDAPSD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q302	SAC domain-containing protein	2	117-140, 1105-1131	GVGNGPGRRPKPKQRMHRFSLYET, EEDALKKRYKAYRKWLRGKSLFKQQPV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q348	Uncharacterized protein	2	42-64, 98-123	ALGVKLGHRRKLQRRIANSRGIA, TVGTVVTKRKYRRHPKPDENAPERPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6A5	Uncharacterized protein	1	70-98	ASKRAGKKLQLGKFKKKDRIAEKGRPPLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7K6	Uncharacterized protein	1	2-21	APIAKKTGAKKGPKVTKKFI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Q1	C2H2 transcription factor	1	205-229	EDTQTQRSRSKPKRKRFCCDIPGCS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7U5	Uncharacterized protein	1	36-55	QRELEKKKRRSLFGFGKKKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7W7	H/ACA ribonucleoprotein complex subunit CBF5	1	437-489	SAPEERADEEKKKRKKHEGETPEEKAERKRLKKEKKEKKKAEKSKESKEAEES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8E0	Uncharacterized protein	2	235-260, 305-343	EADARKGSKANKEQKKKMKERAEGEA, GAPGKPMPSDKKKEKKKKSEEERKARKEQRRRQAEDNGT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q922	Yippee domain-containing protein	1	290-312	GVWDPKVVARRRKSKSGNARRWW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9Z0	Uncharacterized protein	1	43-67	KAVTQACHTCRRNKAKVCRESHCDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBA8	Uncharacterized protein	1	948-975	DVLARAKSSRKERKLKRARSPVKGSYGT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE17	Uncharacterized protein	1	304-328	RAELRMFKEKRRAKKEEKRRAWLRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE56	Uncharacterized protein	2	503-526, 622-652	PSLSHCQTKGRRQQPQPQPQPQAC, QTGRAERAGKRERRRMWWRRKAGREDREVSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH16	Uncharacterized protein	1	571-594	ELQNKPEQAGHRNKKRRVSDPESD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHH6	PNPLA domain-containing protein	1	17-41	EPASALRSSKPKPKRAPTRVSIVAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJD9	Uncharacterized protein	6	80-104, 124-149, 158-180, 215-237, 253-275, 414-437	AAPTSKQKAKPAQKQSSNARRKRGE, DEPAPPAKKRKLVKRSKKSQAPSESE, QEAAPKLKAKRQSKKPTNGDSEL, IDEPPKRKQKPKTKPDPEAKPSS, IDEAPPPKRKRNPKKAAGKQSTS, DDEGERRPAVRKKGPAKRRADLAF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKH6	Non-specific serine/threonine protein kinase	1	732-754	AEPVKKKKGHRGRRGGVKHRKGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM05	Uncharacterized protein	1	41-67	SDGNPLPVTKRRQKKNARERDDDCGNR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMQ1	Aa_trans domain-containing protein	1	441-467	AARSRGGRGGRWRRKWRWDLEHLETGL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNW7	Uncharacterized protein	1	4-23	EERVLRLRKQKRMWFEKMMR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP74	Zn(2)-C6 fungal-type domain-containing protein	1	19-65	PVSASKEQQTRPPPRKRRRIVISCTECHRRKQKCDRKFPCTNCVSRN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q098	R3H domain-containing protein	2	10-41, 202-223	SQRGSHRGRGWRGSRFRRGRQHGPRRSDPPAE, THLHCVKKWHTNQMKERRENPG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0D1	E3 ubiquitin-protein ligase	1	1993-2013	IEECTRRKCPTKGKDLTEPAI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0I4	Uncharacterized protein	1	231-262	DRFGSRARAAWRRKKAEKQQRLKTQRKQEGAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1V1	Uncharacterized protein	2	35-58, 456-476	GPQLPSEAPKKKRRVLPYEKLYIS, KPTVLGQKKAEEKKKKKETGT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q279	Uncharacterized protein	3	61-80, 334-387, 786-814	SPSLQPTRPRRGHAHRRSAA, ESPEPPKPLTKKRSKKKKKVKTWAGSILTRKGKYHYGKKHKRRAPTPTPPRRFE, PMEREPEKKTKGSKSKRLSRMMQFWKSKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Z8	Six-hairpin glycosidase-like protein	1	111-135	HTDGKDEKIKQKLRRRREENAWVDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4D4	RNA helicase	1	694-722	VEDLQRTKRQRMRKMAKKIEKKERTLLGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4W1	Protein kinase domain-containing protein	1	74-93	PGLPRTQTFKRQRSEVRSRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7A0	Uncharacterized protein	1	69-94	DDDGQHQHRHHHHRHQQPSDRRPVLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M1	Importin subunit alpha	1	11-30	RTQFKAKSTFKPEELRRRRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8L9	Uncharacterized protein (Fragment)	1	39-60	KSRREDERFRRQQHQQHQQREE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8V5	ULP_PROTEASE domain-containing protein	2	496-517, 622-645	GQSPSSKGKRARKAKPGPKLLN, ETILSEKRSQRKKQPASQGSRCSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q908	Uncharacterized protein	2	28-51, 231-251	PEELDRLRQHRDRHRSRRSEILGG, DDPPPIRSRPRPRPRLPQPGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9R9	BZIP domain-containing protein (Fragment)	1	118-137	ATDTPPTKRKAQNRAAQRAF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAA3	Chalcone_isomerase domain-containing protein	1	22-45	VVVPRRSIFSRRNDRRRSSRAVEN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAR2	Uncharacterized protein	1	594-613	PGYHMKCKMRQANRVMRQYQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB41	Uncharacterized protein (Fragment)	1	400-423	VSAHRPTRADCHHRRPRPRASSLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB70	Uncharacterized protein	1	627-647	VYYWRVRGRGRGRGRVGKREL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD27	Uncharacterized protein	1	33-57	PYFSRTPTRKCLSRKQRHTSHGHTW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDA2	Uncharacterized protein	3	1-25, 46-116, 222-245	MDKEQRQDKDKRRAVPKFGSFKPNP, RQGRADKDSRSRDRGRDRREADRGHRRSSRERGRDRERHRSRGDPERDRERDRERERKREKDSERGRHRSP, AFIPLSPPRKRKRHHNGHDEDGTH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN2	Alba domain-containing protein	1	6-45	VMQSSSPKPHHGKRKLHSDSNERSPKKRRAGEPRSHTQGQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG51	Uncharacterized protein	1	115-147	NKTSAKGKATTTKKKKKQPKKPERFTRMKNDAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGI1	Ribosomal protein L19	1	160-179	DAKRARTKAARERKLERQAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ44	Polyketide synthase	1	1936-1957	GLLSPTKTRNPPKTQPNWQTET
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJG7	Uncharacterized protein	1	380-400	GVINRLKTRVNKRRICNRFHL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLB6	Uncharacterized protein	1	332-356	FVVVGMRSWKRRRRREEPDEMALRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQB4	Uncharacterized protein	3	333-357, 798-820, 981-1001	PLDFGERLKRRRKSRSPERIPEEPS, FTPPTAKAKKVRRSPQSKPHLIA, EEEERWRKKCHLWINNQADRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQE4	Uncharacterized protein	3	342-362, 748-767, 905-925	HPVSAKERQRLLKRQRSQLLS, PAPLRKPVSKPKRRPALREI, EGRTRAGRRRFRKTCPPQRVD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZX5	Trimethylguanosine synthase	1	167-198	DEENKETRSNKKNKKKKKAKKHRGLDPSLRLD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q065	Uncharacterized protein	1	40-63	AIIKDIRRFKKRRARKSAVATPGT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0D3	Mago-bind domain-containing protein	1	121-148	DPEAEKEKKVRNLKKKLRQAKELKEKKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0M8	S1-like domain-containing protein	1	1-26	MPKNKGKGGKNRRRGKNENDNEKREL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3W6	4HBT domain-containing protein	1	26-58	QEQKRSKQRQSAPIAQRCQKKKKQPAHSGLEDH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6X4	Zn(2)-C6 fungal-type domain-containing protein	1	18-56	GGNANPKQKTQMHRRSRTGCYTCRLRRKKCDEGSPICTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7P7	Uncharacterized protein	1	4-47	YDRRGGGSSYNPKKRRYRDDDDYDRRGPRRRYDAPPHVRVRKQL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q956	Uncharacterized protein	1	201-222	VRVTMMHPKKRDKRRASLDEAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC5	Uncharacterized protein	1	1-20	MDFRRGARGRRYPRPEFYRC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBN8	DUF2431 domain-containing protein	1	49-78	HQDEIKGSNKKNKKNKTANGRQQKNQQPTI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBV1	SNF5-like protein	1	144-176	IYPSQKPRPGKRTTPPLKFSKRDMKKQAEQHEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDJ2	Uncharacterized protein	6	303-347, 402-427, 433-458, 497-526, 528-555, 684-705	DTSRSRSRTRSRSRSHSRSRSRSRSYDRKEQRRSRRQRSYSPSGD, RSYRSSRKERDSEKRRDRDREKDREK, REKDRDGHRHRSHRSHRDREHDRDRD, RDRDRERDRDRDRKDRHRDRDRDRDRDRER, RDRDRDRESRRDREKDKDRHHRSSKTTA, VGDEERKSSRRKGRRGEVIVGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDT7	Uncharacterized protein	1	179-204	GIEIVKRRNKRARRARLTYMRKPKHD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF79	Uncharacterized protein	1	104-146	STSVSRRDRRRSPPNLRRENKNMATRRRRRRLEQQRRGRQARG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFJ3	MCU domain-containing protein	1	468-496	RDEEFTEQERKKKRRRVHKRGQAEGRASV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFY0	DNA-directed RNA polymerase subunit	2	2-23, 1519-1543	AVETRTRRRKEQLVDQLPKRFK, EDAWKKDESIRRKMRLEKRRSGMGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG66	Anaphase-promoting complex subunit 1	3	92-112, 307-328, 1709-1733	GVPLPGKKSRKSVKAEDKDKA, GLEDTAPKKRKAKRSPDLDDLL, GTTKGKGKAKKGSSGKSKKKVSLGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGF2	Uncharacterized protein	1	119-139	VFEKRFRAIVKRERERKLRAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHB1	Uncharacterized protein	1	66-91	DHPVQRLRSKSSLRRRRRGLASPFVN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHD2	CCT-epsilon	1	19-42	RPFIVVRDQGKKKRQHGNEAVKSH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI79	Glycosyltransferase family 90 protein	1	83-103	AAAYRKRRGRHPPPGFDQWYQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QID2	Chloroperoxidase	1	238-261	GSNSTSGSQKHRRRLPRRRAHFGF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ74	DUF2235 domain-containing protein	1	47-72	GPEIHHRHQDSRRHHKPRKIVLCFDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK32	Uncharacterized protein	1	107-127	AGTGTVRKKKKDRHAYHTVEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK54	RNA cytidine acetyltransferase	2	61-93, 1046-1065	KNKLLGFTSHRKKRENKIKKEIKRGIREPNSED, EKGGDKGHSKSKKAKREKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK90	PCI domain-containing protein	1	14-39	GGYRGGKDLKPKGKKASKKEGDDEMT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNP9	Uncharacterized protein	1	160-179	EFSCPFRKRNPVRFNVRDFQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNT3	Peptide hydrolase	1	469-490	GLPRVDGKKRRWDAHRARMLKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPS4	PNP_UDP_1 domain-containing protein	1	167-190	NVNEALKKIKRRNKYTRPPPESDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZY6	Uncharacterized protein	2	1437-1462, 1519-1538	PLVEEPTPGRRRRKGRKAKEDEGLEE, PFAHSPPSRHPPPHRRQQTL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q269	Uncharacterized protein	1	956-976	GQVKAKRPTRWQSFKEPLRLM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3E6	Uncharacterized protein	1	1270-1290	RTWKGGRKVRVDEKVVRPRRF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3G2	Uncharacterized protein	3	183-209, 349-370, 549-590	TPGSHQAQLRRRRSSRQHAPTRSSSPG, ESLSRPRRSFFHSQRRRLTESL, EASKNWKWKGKEPSPPKPRSHDTRKTRRSKKSDQPADLHQRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H0	Zn(2)-C6 fungal-type domain-containing protein	1	136-158	CEVCRSRKSRCDGTKPKCKLCTE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q494	Uncharacterized protein	1	537-561	VKFVKAWLKEWKEKEKCRGRKFCWP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5K0	Uncharacterized protein	1	31-50	VERSKSSSWWCWRQRWQSAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6N1	Uncharacterized protein	1	24-50	ESEDYQPQPQPRKKRNQRAKAGQGPLD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q863	N-acetyltransferase domain-containing protein	1	158-180	DAYDMRKPMKRDVKRQHVRDDGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBP1	Uncharacterized protein	2	199-221, 409-431	DTAEDTRRTKRRKLNPDRHTSAF, EDPSSHSRPPRQPPRRGNRYSVG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBS2	Ribosomal protein	1	90-109	LKKLNKNKKLIKKLARKYDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBW3	Peptidase A1 domain-containing protein	1	34-63	LEMQRRAPRNPLHRDKRRRKRGTLEVGLDN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCE5	SUN domain-containing protein	1	137-157	QDPANIRSHRQREHRERDPSM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCN0	Uncharacterized protein	1	33-53	EVFGQKQDGKRRKRTELAVAI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCX1	Pre-mRNA-splicing factor	1	1280-1313	NDCKSRCPSRLIDHRFERKKEGKKKTNMPFSQTS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE70	Protein kinase domain-containing protein	1	638-664	RWSNNRDRAKECPRHKGRDRDWNWNFD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFM3	Chromatin-remodeling complex ATPase-like protein	1	928-953	GEERMRKIEHQRKMLRKKMNQYRVPL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGK4	Uncharacterized protein	1	624-648	TPSQANKAAPKKKENKNAKAKATAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIL4	Uncharacterized protein	1	491-511	SEPNKKQRETSQERADRKRAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIN3	Uncharacterized protein	2	44-71, 76-96	NRSPPAAVTKRPRGRPRKAKNNTADTAI, SESDRISRSRLNRKRPSSEVD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL72	SH3 domain-containing protein	3	59-85, 325-347, 612-632	EKYEPTAPPRPTRSRPKKEPEVVPAPA, EAAAKKEKSKRLPKKRLDSQDTV, QLPLRSSRPAKDRCRMTNSRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLV2	NUC153 domain-containing protein	5	25-52, 61-83, 481-507, 592-619, 659-678	FETDPRYKLPSKKTLKTKIDKRFSRVLK, KVDRYGRKLKTDTKKKALQRLYE, EETTIEKYKRKERERKERKRAMALAKR, KEIARAEKLKGKKKKKGKKVAENNGGLQ, LEEGRKKRKAGPEDSPNGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLX8	Rab-GAP TBC domain-containing protein	3	39-61, 993-1012, 1045-1066	AHPPPRFQSRHQQHWPGFRPWRR, ELVEEKRKERREGIRRWKAE, EDVRRKTPLFGRRKDREQVRAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP20	Uncharacterized protein	2	22-41, 183-206	QPPNQRSPPRRALPDRDVDA, LRALLPQIKPRRGRKKPEDEEPGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1Q8	Uncharacterized protein	1	105-127	AEKEWRSRRARRLAAQRERREIR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q252	TEA domain-containing protein (Fragment)	2	77-100, 910-937	GTPAYPRPQQRQEARLRGRKQGRG, QTVRSRRGSEQQQQHHHHHHQHHHPSGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E7	Nitrogen permease regulator 3	1	465-484	AIERRFRDKARKNRGVGKSD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	49	1-29, 79-108, 119-144, 499-525, 547-567, 703-747, 781-804, 928-951, 1459-1484, 2707-2732, 3049-3071, 3141-3166, 3211-3238, 3285-3312, 3404-3428, 3561-3585, 3753-3780, 3879-3906, 4059-4081, 4157-4183, 4293-4319, 4416-4442, 4598-4622, 4730-4755, 4850-4875, 5025-5050, 5153-5182, 5276-5303, 5523-5551, 5623-5649, 5809-5832, 5896-5920, 6034-6061, 6159-6187, 6364-6392, 6473-6501, 6566-6595, 6686-6710, 6806-6833, 6985-7011, 7090-7118, 7197-7224, 7369-7395, 7443-7467, 7519-7548, 7726-7754, 8162-8181, 8626-8646, 8922-8944	MREHRRRSPESTRRRRAERRRSREQLAAA, RSFFASSSVKKVKKRRSFRRKNTSSSSVDS, RSSFERQQAKYQQRLQNQHQHQHQHQ, QQAQQGSPRERRSKRARDSDRRSAVET, VEDRRDKRRDERDFDRRDERR, HERMARSAEKKRDREEKRKLESADYQEERSREREERRRLKGKDVV, PEAAKPSREQRRAEREKTRRMLEE, AVERARSRSREPPRPRDREPVRDP, VASSGSGKKRKSSRRKSTKDAYEIPE, RESTPTLGKRGKKKKRDNGPDANLEG, TEAMGKKGKKQQQQQRKDAPKDT, AEASGKKGKKSKSKKKKQAAAEPEAD, APPEPAHASKKSKKKKKKQAGQDGSEAP, VEPSSTGSKKSKKKKKRGSQSPEETETR, DPSTTGQGKKEKKKKRQSVSFAEPL, NPPASSPKKSKESKKKRNSLSDPET, DRSPYSLLNKTKRKRKKPKADAEPWPMG, LKRAAAKREKKDKTAKKKRKSSVWDEPW, EVAVGKKSKKGKKKKMASQTLES, VEAPPPTKKSKKDKKKAKKAAKEQIEA, EEAPLSRKKSKKDKKKKKGAAVQQDSQ, EASPAQSKKSKKSKKKKKGAAHPEPEP, AEQAPTKKGKKKKKGKGSKNVESGS, SGVPAGGKKNKKKKKGKGSKSLDNEL, AQDTPAKGKKSKKKKKGKGAKAAAES, PQEAPASKKSKKKKKGKGSQVLEPQP, EETSALPTKKSKKDKKKKKGKGPQTPEPEP, AEGTEPQTKKSKKKKGKKGKGKASEPEA, DQETPAPTKKSKKDKKKKGKGTKVPESEP, EQAPDVPSKKSKKKKKGKGSKTVEPET, QSSESQTKKKKGKKGKKAAAEPET, VVSDIPAKKKKKKKGKTASLEPAPE, EQVSDQPSKKSKKKKKKGSKASDSEPAS, SSAVSAKQSKKAKKKKKGKGKDAEPEPEK, AQGEPITKSKKDKKKKKGKNKIAEPQPEL, EAQVSPAKKSKKDKKKKGKNKTAATEPEP, EDAPVAPTKKSKKDKKKKKGKGPESTQPEP, DLLAAPAKKKGKKDKKKNKAAALVS, AQDAPIKKGKKGKKGKKNKAAEREPIPE, ALGVSVKKGKKKKKSKNKTASPESEPD, ETQDAPVKKGKKDKKKKSKNKVAVPESEL, ETASVPAKKSKKDKKKKGGKGKATAPEP, EPEVAPAKKAKKDNKRKGSKQLLSEPA, LSTESAKKSKKGKKKGKQAGLEPET, GEASSVLPGKKPKKKKKKGKKALEPLMGSE, VVEFTGKKSEKDKKKKKKGKKTDSAITSG, EEEKKKGKERRERTASPEPT, IGSPRSPTRPHSMRRRQSMQV, TLTLLSRRPSFKKQRDQDTEAVV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3T0	CBF domain-containing protein	2	9-32, 251-272	AAKAAGKRKRQENGDVSKKRRKSG, YVEPPRKKKHPLRSLSQHKKQA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q448	Uncharacterized protein	1	44-70	TAVAAQQQQQKQKQKQKQRALWDQIVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q550	Uncharacterized protein	1	103-131	TIEATPVSKRNHNRERKRPNQTTKLSVKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q643	ATPase, P-type cation-transporter	1	237-260	IAASTNKKRRKAGRSMNWRKYGKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6X6	Uncharacterized protein	2	288-310, 707-727	ESGSSSRSSRKQKPRLKVNDVIS, QGLMRKRKTKMLRHEWHEHFF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	17	154-182, 272-295, 420-442, 543-565, 627-652, 694-721, 750-776, 794-820, 948-972, 1105-1163, 1364-1387, 1497-1526, 1652-1675, 1777-1805, 1851-1872, 1878-1897, 1985-2041	FTSEKGFRQAAKKKKKNNASAKTNNNANN, WAAFTFSSNKKKKKAKAGSAADTA, FSMAAAKTKKKKKTSLWGDPEPE, DSVTVTKNKKKKGKNPVTDSSLQ, DIWNFTTSKKDKKKKKGKTAGVDVDP, DSWGASTSKKEKKKKKGKKDEPEPEVEP, WGVLGSSKKEKKKKNKKGQLEEPQPEP, VWGLSTSRSDKKKKKKGKDKVAELEPE, AALKAKKASSKKKKLNKSDQEKLDR, AASSGKKSKKSKTKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKKKKDKDKGKEKENEK, LEDKKTKSSKKSSGRSKNKEQVIN, TWTTTPSKEPKKPSSRSKPEKETSTRKKTS, ATLDPERSERRRKHRQYSRDDDIV, AEEARRAKDEARRERRRRQEQEEEARRQE, EADARRAARHHERRRSYQPEES, EERRLRREARRAAKEARERE, GMTPEEYDEERRRRKRREERERERERERERERERKKERERLREKYRERERRTGSDGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q755	MFS domain-containing protein	2	37-56, 524-548	GEPLPKKRFWFQKTRPYDPD, LVKAYYVFRNKQRDKKWNAMTPEER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Q7	Uncharacterized protein	1	57-78	LSEEEKKQFRPWKRAADRKYQL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7V7	Adaptin_N domain-containing protein	3	693-717, 728-753, 761-785	PAEGVVVKKKKTKKKGTGTGTGTGK, GEEAVVKAKKKKKKEKAKSGVEGEEV, GEGEPVVKAKKKKKATRVVRLDEGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8N4	Uncharacterized protein	1	39-62	IKSAYRQLSKKYHPDKNPNDPTAH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8V6	WD_REPEATS_REGION domain-containing protein	3	6-27, 43-67, 203-235	TAPGGQKKRKRTAAAETTPKKR, PANAAAAVPKKKKKKAVERDESISG, LPKDQWPQTTKRKPKKPPAPPKRRPERICFAKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBB8	Uncharacterized protein	1	2-49	VAAKKHIPIVKKRTKRFIRHQSDRFKCLDSAWRKPKGIDNRVRRRFKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCN2	Uncharacterized protein	1	956-978	GDLGILAKPKRRKRNILGRAISN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD11	Uncharacterized protein	1	263-311	GLCIWCRRPNPDRRKKGCPTCLPRRAGLTAEWRRKRKAAERRRRGELGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD42	Uncharacterized protein	2	2-21, 147-169	QLNKERQRKVRNALHRSLPR, LDRFVMKEKRLPRPQRRAIRLLY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEN3	Uncharacterized protein	1	30-52	DDTATAILKKKKKPNQLMVTDAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QET7	Phosphotransferase	1	73-98	EAGGLKRFSRKLKRQFKERLWSNTEC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHC4	Uncharacterized protein	1	11-30	TSFKRHFRSRPGTRQNLGRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT3	Uncharacterized protein	2	1004-1024, 1064-1086	STVIEAIKKRQQKNDRVKGPG, TQSPAGTPRRERHSRHQNPDGSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJB5	Zn(2)-C6 fungal-type domain-containing protein	1	40-63	CTIPPPRPMGRPPRRQNRSQSTSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJF3	PDCD2_C domain-containing protein	1	17-46	THERRLYVFACKRKSCRRKDGNIRAIRGIR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKI3	Uncharacterized protein	1	129-176	ECTAPSTSTWRKRKRRDDKRNTCAITTTSGTKKRPRREQKENAGKQGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLE3	DHO_dh domain-containing protein	2	12-36, 599-619	RRQIEGLRKLRQRRLHSTNKDSART, VDEAKKTPRKVKPRVMVKVSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM45	MFS domain-containing protein	1	16-36	TRIAQADKKPWYKKPNLRFLY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QME7	BZIP domain-containing protein	1	87-113	TTVTPEPEKKPVKKRKSWGQVLPEPKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN28	ANK_REP_REGION domain-containing protein	1	406-431	CENCIGRERKRAGRKKSKHPQDEEAW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPN8	JmjC domain-containing protein	6	563-590, 879-900, 1037-1056, 1062-1086, 1124-1150, 1165-1185	EVDDNGRPVKKRRKRKAKKGDVYRCHVC, QVPRSHHRKRPKLGPEPQRDEQ, SGLAAPPKKRGRPRKSDVSG, PPVPEPEKPARRRGRPPRARPSLDA, EPVASTGPRKRGRPRRNPPPEAPAKKS, ADKMRLKGKKFRIGRRENLES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZQ2	Uncharacterized protein (Fragment)	1	628-648	RAVVRDRERRLQNKQDKTVYM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q001	WD_REPEATS_REGION domain-containing protein	2	158-181, 569-595	GEGHRSSWGPRRNNKRFPKVPSDE, ATRASSVQPRPERRHRLHHRYSNGWES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q023	RNA-dependent RNA polymerase	1	36-57	SSIERPRQRHHEQGPLRRRPGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1H9	Uncharacterized protein	1	196-219	GPCFDTQSPRKSKKKSSLENLESE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2S5	Uncharacterized protein	1	313-335	LLGLRREKRKEEVRSRSRTRSGT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q447	Transcription initiation factor IIF subunit beta	1	227-247	FLKTREKPTKAKKMENKATRW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4L9	Glycoside hydrolase family 2 protein	1	41-62	GTNPWPQHPRPQLRRDAWKTLN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4M4	Uncharacterized protein	1	108-129	ASKMRPAAHCARRKNRIRFLDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4P1	Uncharacterized protein	2	1-23, 29-48	MLTKPNLTHRYRPQPPKSFHDLY, QRFYVLSRVRRGKRRPLATS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4Z8	Glycosyltransferase family 20 protein	1	25-44	GSASEKKQPKPVKLETQPSL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7K0	GP-PDE domain-containing protein	1	355-375	LWYPLNTRGRPKKGRGAGQLG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q865	Uncharacterized protein	1	1-20	MTAQRRPRFRKVQSFRTDYA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB19	Uncharacterized protein	6	21-44, 274-294, 373-393, 843-862, 1132-1158, 1193-1212	NHAPMFKKHKVLPHPRKDELQRSG, MKNVTVRKRRPARPTETHDPE, TAPQRRKTLRHVKKQSTLRDS, SLSRNVRRRNERPGLRRRST, GDRINIPRRLSERRRERRTEELRGKIS, LMLLQQRQQQRQQQQGERRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB75	Uncharacterized protein	3	1-27, 61-83, 1192-1214	MPPKKFVRRERKRKVLERKRAQERATH, GVKVSSKKAKRLEKYIENKLKKD, GLGWPLPMRKIKQKRVLGKGWVV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBW4	Uncharacterized protein	1	284-305	GTYCVWDVRKRQRLRSFPKLAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDM6	Myb_DNA-bind_3 domain-containing protein	2	83-103, 408-427	KTDNARKKYRLWRGLREDPEF, PDAVRRHWVKRLREVHNRIA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF46	Uncharacterized protein	2	53-76, 287-313	KEENTPKRGRGRGRPAKKAKVAAE, DSDQERANSKKKKKGRRKSAKDAGEDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF52	Uncharacterized protein	1	1291-1317	SLPKAPPQKLSQKEKKRQQQVAQAAQA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFG2	Uncharacterized protein	1	555-583	EEERKRKAEKEERKEAKKRGKEERKAAKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFL8	Carbohydrate-binding module family 48 protein	1	684-709	DGATDKATSDKKKKHRISGFFSKLKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN4	Plus3 domain-containing protein	1	210-241	REERSNRKEQRERENDRRRHRSPSYRRSRSPD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG21	Uncharacterized protein	2	1-22, 210-231	MSRVAKRSTKRSVKTKERIALA, LGVFRCWFKKRNMKNIRLWAHR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGF6	Calpain catalytic domain-containing protein	3	23-65, 621-656, 967-994	APTNNNSNDANKKKKKRKLPPQQSINRIWKRFSNKRFNKALAV, EARQKERHRLWEKRHLNRQITKKQGRKNNQKLEAKQ, DSEVEKKKKEKMMGKKGKKKDNDGDGSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKA5	Flap endonuclease 1	1	366-395	LEEQNEAKKKKLKEEKKEKAKSKAKPRGAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLB5	Uncharacterized protein	3	194-216, 1164-1187, 1245-1273	NDWQKEWQFRKLNQKKEDRSVAL, VRWAARRLPSWRRRKNAEDEERGR, FAVDRTKKTEGERKLRQRKRSGSAMRSAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNC1	AIP3 domain-containing protein	1	176-203	INLLHGLKRKQTRLRQRQQRERENAPLG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPE2	tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase	1	1-22	MPPPNKIGRPPKQKQNALQAAI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPU0	Uncharacterized protein	2	2-22, 113-144	TSDTRPPPAKRRRALSPHAAQ, REDEERTRRNREKREKKKRRKEQAAKEKSKSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQF1	Leucine carboxyl methyltransferase 2	2	86-112, 120-141	VLVRNFLRTLRRPRQQQHQQHGRPEEG, EEEEEREKRKRGRKGVVVNLGC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q013	Uncharacterized protein	1	335-367	NTLSGRRRHGANHRRRRSSRSHRHKVSLKEAAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0U2	Uncharacterized protein	1	350-369	LARSFARYRRRQPQSPPPLV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1H4	Uncharacterized protein	2	89-116, 121-141	EELPPPPSTRRSRSPRKTTRIKRESEEP, ATPVPPRESPRKRQSRSASAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1N9	Class I unconventional myosin	1	969-988	SRPTPKGKPVPPRPITKGKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2A0	Uncharacterized protein	1	302-325	CVEIRPPRKHSKQSESPSRKQRTV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q542	Uncharacterized protein	1	6-28	GLKVGGKKKKSDDRPDSERQAQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5J7	zf-3CxxC domain-containing protein	1	1-21	MVPTAKRYKPKAQRYEETTAM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5U2	Clathrin heavy chain	1	1519-1540	AANIYRKNKRWEKSINLSKQDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q600	SRP54 domain-containing protein	1	229-248	ATGRKGKPAKAAKRGRKWDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q661	Uncharacterized protein	1	1-32	MPVAPLRAWRVRRRRRFRVRYRYKYRLNILYR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q839	Uncharacterized protein	1	60-88	APSQDTTPKLSKKERRKRKQAEREAAAEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q995	40S ribosomal protein S24	1	99-129	LAAKVEKASRQQRKQRKNRQKTLRGTAKVKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9N5	Uncharacterized protein	1	52-74	FEQHASKSRRKSCRSPSPMRTLE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAE4	Uncharacterized protein	3	1-21, 589-612, 730-753	MEPSSKRRRLAPKVPDPPAVS, STPSAKTKARKPLQKQTPKQEVRC, QTTCLVTRRKPPQRSACPKPDCQS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBJ7	Uncharacterized protein	1	1324-1346	TNQVTARRLRRVRQRMGAYRHDL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEY5	Uncharacterized protein	2	623-645, 1037-1063	KVNQESPSRKKPKKDGRRVSVVE, EDIAHMIRRGRKGPKKRKEHEIYGRRW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG12	Non-ribosomal peptide synthetase	3	1381-1402, 7456-7475, 7657-7677	IDYASRKDRELQIRNNRQKLQY, LDPSSNKKSSKKSSRAGAGS, AGEAERPKLRRKKVASFPVGL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHP9	DBF4-type domain-containing protein	2	377-396, 599-623	RDRGREKDRNRDKGRDRDRD, ASVPVSQSKPRRDPKPGYCENCQEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI51	Ubiquitinyl hydrolase 1 (Fragment)	2	23-44, 248-280	SSLPVRRSGRARKRPSGHGEDS, KEKRARSSAAMQRRRKKKPKKERVKAGKSGDTP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKN8	Flavodoxin-like domain-containing protein	1	1240-1262	LVQRDYGDRKNRKHARLKYTIDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLL0	Uncharacterized protein	2	11-35, 71-90	FSFWKEKKNNTGDHRPKNEKQKEPA, CPYGRRRRSHVPPPRSPRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY9	Uncharacterized protein	3	40-64, 636-665, 692-731	VENATLRRQCRPRARPIQQLCRLHT, RPEPVNAAKNDKNKKKKTKGGKTGEDQDGE, NAWVLNKPKKETKSRPRKSMKGVKKLTKKMKREREAESAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNM4	Uncharacterized protein	3	675-698, 858-878, 1275-1297	MLNLPPKLSKKPKKPARDTRHSQV, EVYGPAKKKKAKKAAPQPGPA, EEETLGQRRRRLQREREAREREM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP42	Uncharacterized protein (Fragment)	1	491-514	RTSSCPSRWNRTRHMVQVKFKQGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPC1	Uncharacterized protein	1	44-65	GGDGARPSKKRRFNPRLDEAVI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q386	MFS domain-containing protein	1	20-40	GTQNNPPRAHQQKRNSQSPVA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3R4	Fe2OG dioxygenase domain-containing protein	1	7-31	GSADGKNPAKKRPKNTLGREDAKAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Y0	Uncharacterized protein	1	43-63	TETVRRKIYYRRPGSPRRAAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q468	Uncharacterized protein	1	1751-1771	PPKGPVPKRSLEKLKAKRESI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B3	Uncharacterized protein	1	58-79	QTTAKPNHKDLKKNRKFDPTTQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4U0	Zn(2)-C6 fungal-type domain-containing protein	1	56-82	CTKHNKPCLYLRPAKRRGPQKGYRTAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7R6	Uncharacterized protein	1	228-247	GPTTRSFRARRSTSRKGRAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Y6	Uncharacterized protein	2	188-215, 229-253	RGRYRDRDDRYRRDRRNDRRRDSRDEEE, SALATRARRRSRPRRRSMSRSSDTR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB16	Uncharacterized protein	1	278-301	GCCCTSRRDLRTGRRVIRNGRGVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB44	Peptidase_M48 domain-containing protein	1	40-59	QPSFRPHAPRSQNQQRRFYN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBE8	Uncharacterized protein	1	231-252	RLRSKRDKLLEEKKNRERRLKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC62	mRNA-capping enzyme subunit alpha	1	375-401	AKSIKDSWKLRQQQQQQQQQQQQHREH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDS8	3-phytase	1	468-489	VDKFTPKNWKEQCRMNRDQPAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG46	Uncharacterized protein	1	199-224	MLDGANRHRRRRRRRRRFSGAPDPGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGU0	ANK_REP_REGION domain-containing protein	1	535-563	AVMGVCVRKGKKKKKKSRNEGRAKSRGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJI9	Uncharacterized protein	3	1-22, 486-505, 542-579	MSGLHARQRQHRRQNSTPSAFD, QCPTCKKCFVRQHDLKRHAK, GVVRKVVKRGRPKKIRPDMDERRDKAERTRRKNKLTSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL11	Uncharacterized protein	1	113-134	YGALRALRKLRHQRMQKRLFVL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLU4	Uncharacterized protein	3	576-599, 656-678, 715-747	QQQQQQDQQQQRHRRQQQVPEPER, RRDLDREARRRAAKRRSEREAAA, GAAVTGREERRRRRGRPRKTERRKVEDENTQGM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP77	Uncharacterized protein	1	32-78	IMRRVDSKPQSSRPQPPRPQQQQQQQQQQQQQKQKQQQQQQHARPGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPF4	Uncharacterized protein	1	528-552	GGPRGGFRRGRGRGRRDYRGGRGGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ31	DNA-directed RNA polymerase subunit beta	1	124-144	IVYSRDRKKIVRKDIPLCRIP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ57	PPIase cyclophilin-type domain-containing protein	2	195-236, 496-515	VNPFHDMKKRERKVRQEIPQQFPLEKKQKKRKGGKQLLSFGD, EKARTLKEEKRATRHPHGGL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZJ1	Uncharacterized protein	2	70-89, 93-114	QSRHNPGRRGDSKSPRPPGN, NNNNNNNKNNNNKNNNNHKRTS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0J4	F-box domain-containing protein	1	150-173	DDRVDQKYRNKHFPKPPPKHVQAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E5	MAP kinase kinase kinase	1	117-137	TPSNTYQPYTQRRPNQPGTSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2H7	Uncharacterized protein	1	38-60	SAEFRRQLRRSQRQQLRAEKSKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q454	DNA-(apurinic or apyrimidinic site) lyase	1	348-367	HAIGRRSRKRKVTTVVQVSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6A6	Ribosome biogenesis regulatory protein	2	111-132, 169-202	FAKRRGIKPKTREQRRNLRYNE, GTSVRGDKRREIRERVKRNERRMRRNQRIAEGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6G7	PCI domain-containing protein	1	202-222	TKYLARKPKKTPEQLEKEKKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6J4	Uncharacterized protein	1	768-790	LGAGEGGVRKRRKKPANRAVVGV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q806	Uncharacterized protein	1	597-619	TPAQRRALYRKAQHKSRETIRGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9G2	Glycogen [starch] synthase	1	493-518	SYMFDFTQKSRRQRINQRNRTERLSD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAP9	Uncharacterized protein	1	236-256	FRARVVRHRARERRKAREQAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB61	Ribosomal RNA-processing protein 36	2	138-161, 271-339	GHPSKSGSIKKKPEKRSSKHAPVE, LQEHRKREKELVKQGKKPFYLKRSEQKKRALVQQFRGMKKKQVDKVIERRRKKLASKEKKLLPTTRRTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBW9	Uncharacterized protein	1	1080-1102	EEQVRQGKLKKEEEKRKKKAALA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFB6	Uncharacterized protein	2	57-83, 425-456	PPSGIHNTPSRRPKRNRALAERLKSSS, RAGQVAGQRNPRRRMRRRRRRRWVERGGEEAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFH8	Glucosidase 2 subunit beta	1	162-185	EEERRQSKERSAKRKRTMAKEARE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKQ9	Histone acetyltransferase	2	104-129, 457-487	GAVSKKSQPSKKTQKRIGKREQSVAS, IVIPEKLLKQREKSRAKQKRVIDPSRIQWKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKX1	Uncharacterized protein	2	32-54, 169-194	VSSLLARKTPKQCKARWNEWLDP, RLANTQGKKAKRKARERQQEESRRLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMT5	HNHc domain-containing protein	2	325-349, 384-411	MCRKMWKNARSCSPRKRSAPRSADA, PAERQEDQPRGRSRKRRHSFEEEQDCKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY2	Type 1 phosphatases regulator	1	129-158	HSHLHRGRGHGKRSRRRKPSPNAYEKMPRY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QND3	Glycosyltransferase family 90 protein	2	3-22, 85-109	AAPSWRRRRWFEPQPWALLR, AVAGMVGKRRRRRRSGAMRARADEG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPB8	Uncharacterized protein	1	8-29	DLSRARSRSRSPVDSRRLRRLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPD7	Zn(2)-C6 fungal-type domain-containing protein	2	28-60, 845-864	EAHHNDRDDRPPPRKRQRVRLSCLECRRRKLSC, PSAPLYRRRRARADVPQMLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQG2	Uncharacterized protein	1	585-617	VTVAGRRPRRPRTEARRQREKAARERREREARD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0N8	Uncharacterized protein	2	1977-2000, 2038-2058	GPVKIPTGPSRQKQPKPPVDPSAM, APKGPPKKPGADPFIRRKPGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q123	Pyruvate carboxyltransferase-like protein	1	1-28	MPMLKDPSKKYKRFPPLKLPDRQWPDKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3P5	Uncharacterized protein	1	11-30	LSKVRSKYGRCDYKRFDNIA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3R9	Uncharacterized protein	1	362-381	RNGHVAEKKCKRMKESPKQD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q422	Uncharacterized protein	1	782-806	QEEEARRQQQQQQQQQQQQQQPQQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7W9	CN hydrolase domain-containing protein	1	652-679	AARPHQGPRQWQRQRQRQPSRLRHVVSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q860	Uncharacterized protein	2	133-152, 333-352	RESIKNKKRGDQLQKDKDNS, DMSKKTKRLERENENLKRKH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8X6	ATP-grasp domain-containing protein	1	605-625	LSPCEELKKRRPDLRDRIVVA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAU7	OTU domain-containing protein	2	15-45, 122-152	EQRDLQSRITNKKKNATKKTRKFVNEECDRL, SQQQQQQKQQQQQPRQKRNRQKERLARRAAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBJ1	Myotubularin phosphatase domain-containing protein	1	789-809	SSSTGRNRPAGNRKRRTEGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD73	Uncharacterized protein	3	509-531, 623-651, 712-764	ESEDKKKKSEKDDKKKHEKEDSE, ESENEKKKSEKNDKKDKYKDDKNKDVYKD, EKSEDEKSKKDKKKDSNKDDKKDIYKDDKKDKYKDDKKDKYKDDKKDKEEKED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDI6	Uncharacterized protein (Fragment)	1	259-285	HKATKPFRGRGLRRRDKKKEEDDEDDC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE83	PHD-type domain-containing protein	1	650-673	LSELRKLRESRQKQSNSRPKRLGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEY1	Uncharacterized protein	1	220-243	EYRAMVRQREERRRERLSRREEMD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGK2	Uncharacterized protein	1	57-83	LRMGNLFSKEKKRSKRRPDDSPPERYY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI18	Uncharacterized protein	1	353-372	QEQQRHQRQQQQQQQQQQQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIL7	Uncharacterized protein	3	8-29, 72-93, 350-370	MINGLKSPRKDRERNIMAPRYD, VLKQAKKKADIRVRERRAKPID, RPLWADKYRPRKPRYFNRVLM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIX4	Cation_ATPase_N domain-containing protein	2	315-339, 1106-1135	ALNQKERRVRPVKRKPNGKAGPHRY, VEAWKWAKRVFLRRRARKRTGRLWKDMDIE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKD4	Uncharacterized protein	1	129-148	YYPSAKPCVKRRHNNSKGGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL00	Uncharacterized protein	5	108-135, 188-219, 800-823, 896-916, 962-984	ESSSECSRGHRDRRGQRRHAPSNLNNMF, NVPWRKPGQKLAENSKKRKKHGSQDRPNWADL, LDENGQPKKRPRGRRPGSRTGTGK, QAAAEEHKRRREKKANQDEGM, STPVGKPKQTKLRIFRRNAPAHI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLL7	RING-type domain-containing protein	1	110-133	NGQSYPKRSNSLKRKRREDEDEDE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMS2	MFS general substrate transporter-like protein	2	47-66, 89-117	ETRPSGSRTRRRPAADPRSL, GQWSPRRPRAWYKRLFRLRGKKSDSRDEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QND2	HNHc domain-containing protein	1	368-394	ECGWLGEPPRGRRRKRSWEGLERDDGQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNY3	F-box domain-containing protein	3	21-51, 230-253, 315-334	DLTRPLTLRSRRTERQRRKQQKRANSSSAAA, ESTTRSIRRHSQNKADQRRHYRVT, LRILVRMDEKRRQERQKSAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP92	Alkyl transferase	1	333-357	VLVEWQWRQKQKARDERPRRRVKQA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPE0	Uncharacterized protein	2	83-102, 105-133	SSLARHRRIHTGKRPYRCDH, CSKSFCRKTTMVKHWKRTHQRGPHSPELD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0C7	Glyco_trans_2-like domain-containing protein	1	346-367	LVYTVSKKVTRRRAKSITADAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0P0	Uncharacterized protein (Fragment)	2	493-523, 553-577	SSPALRRHPLHRPDDRRKRFARPRERWDPAT, QGFPVWHRFRGKRLKKQIGNAFPPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q175	Pre-mRNA-splicing factor CWC24	3	19-40, 54-76, 335-360	VAIFKKRGAKGKANIRKRPVTP, SEDETGQRIKRRKRNHGAVAASS, NAAKKLQKLLDKKRERAAKRRQEAIE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2V7	Uncharacterized protein	1	31-57	GSNNDNRASRPLKRRKLAKTDVSEPQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3E9	Uncharacterized protein	2	249-273, 301-322	ATRNSGEAKRPPKHRQKKIHLVVLT, DAKARKARERAARRRARKGATT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q652	Uncharacterized protein	1	637-675	NDDPRTEKRKEMDRKKREAKKKKKKAGKRKSRAGDEAET
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q660	Uncharacterized protein	2	13-36, 720-748	EEERRRREEEQRRREEEQRRREKA, QPLGSISPNTQRRKRKRGSIAQKQGNGEF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q668	Phospholipase	1	321-341	VLRWNHVKRDKYKRNERFEWL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R3	C2H2-type domain-containing protein	1	577-598	AEAPPPPPRHCRRRSGTPGASH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M8	Zn(2)-C6 fungal-type domain-containing protein	3	175-195, 472-495, 524-557	NPASGKKGRSRSSKNRSRVNG, SQSSNKTKSYKAPKPKAKKPTSIA, EEQPDLSTKPRCQRCRKSKKGCDRQRPCGRCRDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9H1	Uncharacterized protein	1	567-588	STPSTSSSRRQQTKTRKRGEST
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBI3	Ubiquitinyl hydrolase 1	2	862-883, 1115-1138	ETPKVLKRFNKRRPKWVNPVEF, QDTWYCPRCKEHRRASKKFDLWKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC64	Uncharacterized protein	2	2-21, 382-401	GYMYWRLKFKPNRANRSDAE, LLNRRASSRSGPRRRPPSSD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEC8	Uncharacterized protein	4	81-104, 445-473, 552-607, 676-717	DAYESESLRRPRRRRSLTSNTSLA, SSASSGRKSPQSRKKKRSKTRPVPFRSET, DLDHDRDRRGRKKKGGVPSPKRCRSPPPKRRPSPAPKARGRSPRKLTDQRSPRLRS, IDIVKGLEQKRQRRREKYYQKYCNRARKEKTQTKRPPPGEGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEW0	zf-primase domain-containing protein	1	580-599	AARRGDKSPVRKKTRFVTDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFB5	Oxidoreductase-like domain-containing protein	2	100-126, 370-396	AAASEDKKPARRTRKPKQETSTPNSKA, VGIREFMKQEKRLKEKHRREGTLGGKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFK8	C2H2-type domain-containing protein	1	305-330	EKVRYFCDYKKCPRHKAPFFRQDHFR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFW1	SWR1-complex protein 4	2	13-40, 57-77	PSDQSTAPRPSKKQRTSAPRPNLKGLAR, VSFFKKRRFASRKPAARWELR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGF9	40S ribosomal protein S7	1	103-130	RILPRPKRSSRSRNTLKQKRPRSRTLTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHN0	PlsC domain-containing protein	1	738-764	REAMRERGELRRRQREKRRMSLADEDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIB0	Uncharacterized protein	1	66-86	VVPQTPPKKRRIPEKPFRFLD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIC5	Uncharacterized protein	5	3-22, 74-96, 110-129, 158-178, 242-267	RQRQRGSSGHKHGNERDRNQ, RPQNLHRGQHHREHRRHDRDQGC, VKGRRRVRWADQDRNDQQRQ, QYPLERRQQQQQQQRQQERTR, QEEQQEQQQRRRRRHRGRQQPSGYED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIF9	Uncharacterized protein	1	3-33	ASPCVSRPGKKNGNSPRVRKRQKPIALTVPG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIL5	Fork-head domain-containing protein	1	623-646	GMDRYHHHHHHHHHHPHHHQQQQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL39	Uncharacterized protein	2	419-446, 665-687	TVYPPNSPSKKRKRQSGPKGSRKNCCSS, TDTEKGKEETRLRKQLRKMEQVS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLJ5	Uncharacterized protein	4	1-24, 47-75, 125-151, 292-317	MPLWLFRRKSHRRRGRVSSIEDDG, TYDPSPPERQANKRQRTESNKLHRRARSY, DGDHLPRKLSSKKRRKEDRQREAEIKA, RELMERDQRRRARKRQLEQKKLELKI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD4	AAA_16 domain-containing protein	2	400-427, 442-463	LFSTHYHGSRRGRRRRHRQRGPGLSSSF, HGRGRGRGRAKHRKIARKLLGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0M4	MFS domain-containing protein	1	236-264	AVEENEEKKKKKKKKQSRPAPAQRTNPHF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Q7	Zn(2)-C6 fungal-type domain-containing protein	2	32-65, 83-114	ATVVRRRAPIACRRCRRMRSKCIHEKAKPPCRAC, PDQDREYRHPRARAEKSKKRDDTKARREGRDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0S3	Uncharacterized protein	1	51-78	ILAGEGARRRWKRKRDEREQGRKLVRTN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4Q1	Uncharacterized protein	1	322-342	GAQHRCYMKKDLKKAHQADSD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5A5	RanBD1 domain-containing protein	2	87-106, 124-146	QISSPKKKRARDELDENKDA, QDRTDRSEPEKKRPRDRQASASA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5G1	Zn(2)-C6 fungal-type domain-containing protein	1	1-33	MLRRSHKKSRAGCLECKRRHVKCDEQRPKCIIC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6L8	Uncharacterized protein	3	1-24, 122-148, 151-176	MPRNCKPPLCQRREQEERRQREEA, SGSQKLPKAVDRRRRRKTNNQGGHRIG, SGPSGDRRRPTTKRNKNAKRRLGAGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7B1	Uncharacterized protein	1	16-51	LSQRRGETCKKDKTQRRQGKRNEKGQRQKRHHLPPF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7I6	SH3 domain-containing protein	2	87-110, 439-460	SSNTPSPKGTPQKSRTFRKPFEAY, DMVQHLSRRKRDQQHRPQTSMG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L9	Uncharacterized protein	1	4-46	TPPPPSTEAAPKRKRGRPPLSPSQRKPKPAPTGRPRGRPKGSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8G1	Uncharacterized protein	1	16-45	LAVRRQFYPDRHPQRQPPRRQTPGQAQLSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q942	Homeobox domain-containing protein	1	181-205	QTAAERTAQRRKMKRFRLTHQQTRF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAY3	Ubiquitin carboxyl-terminal hydrolase	1	305-327	RWVDQGRQKMQRRIEERKKSGAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBN7	Uncharacterized protein	1	6-32	EFFADPNKPKNAKKKPILKELFRVAKM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCS1	Nickel/cobalt efflux system	1	367-390	GSVLIYRPWRRRMDRRAHRWAAPG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD76	DUF4484 domain-containing protein	1	602-623	GDRGSSSRRKTGQRRREEEEEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDJ4	Uncharacterized protein	2	233-255, 261-294	DEEGRTRAPRRQRRGRAGQGDAK, HSSHRHCHHHHQQQQQQQQQKRQQQSQQHKQDPL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDP9	Fungal transcriptional regulatory-like protein	2	28-51, 54-75	QACALSKVKCPKEKPSCSRCESRL, CEYFFTKRPGRRRGNSTAGPKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEI7	Uncharacterized protein	2	21-46, 205-231	EESISQRVTRWKTKQKKIPGRELAAQ, ARPMAECKWKPLRRRPNDVKLMKRESR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGR5	Uncharacterized protein	1	105-125	LSLRRRQQLRQRRRDAREYDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHK9	Uncharacterized protein	1	153-176	SLDHPKCIEAKKKNPKCKIVLPHW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI95	Uncharacterized protein	1	597-620	PPESGPHPSKRPRTPPRAPAQPST
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKC8	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial	1	73-100	KEQAKALKASGKKKKKNKADNQTVPGWE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKE4	Uncharacterized protein	1	33-59	WPTPTKWLPHFKSQRPQRDYARRNLKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLS3	Uncharacterized protein	1	153-182	AAKLQFTKKMPKKVTKERKGRRAMKREAAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLT6	Uncharacterized protein	1	757-782	GEVRQEKEEKRGRSRKRGGTRDAGLD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNX5	Uncharacterized protein	2	23-43, 564-584	AAAPSKAKKLKRDPTPEESNS, GLSRDKKPQARRAYGSQPRQG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP58	Uncharacterized protein	1	349-390	QENVEQPERKEKPKKQQQQQQQQQQQGKKNQKKEPEVPERYK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ77	Uncharacterized protein	3	91-110, 714-739, 792-812	DGTLRRSKPIDRRDHRVFKG, SCVWSFCARCSRRRRSRSNKLAAMSP, GSAPPPPYPHQHQQQPQQDMR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQB0	PUM-HD domain-containing protein	1	7-26	AANPNRSRGIWNNNNNNNNN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1R1	Uncharacterized protein	2	158-183, 207-242	SESREERKARRAARRLRKAEKAARKA, ASETKEERRARRAERRARKEERRRKRAEAAQKADQG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q261	Uncharacterized protein	1	360-379	LCMYDKVQRVKNKWKCILKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2H8	tRNA 4-demethylwyosine synthase (AdoMet-dependent)	1	22-49	TGNNRRAAKHGPRRIRGDINKKKRESAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4S8	C2H2 transcription factor	1	360-386	FGSGSSIPRGRRRRRRRAPVTAAHGGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9J0	USP domain-containing protein (Fragment)	1	601-641	QHPFDHNKKEERARNKSKTRDREEKKEKGKGKAKNAGKEKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA48	Poly [ADP-ribose] polymerase	1	148-170	SDNDAAPKPKRTRGRKAAAVQAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV3	Uncharacterized protein	5	118-137, 350-373, 776-797, 1380-1401, 1458-1482	LPTPNLKPRNVLRRKRSGLS, SGAKERKKTKGSSHRPPSPPPRKS, TSGPNKLRRRARSPRKWNLFGR, NNMGNRCRRTIRRLKERIHASA, AAAPERTRTKTKPKKDERSLPEMIN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCA0	Uncharacterized protein	1	9-35	GEDLTRRRRQTNSRYRGPKPQYNRVHA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE32	Uncharacterized protein	1	267-296	EEFRKLLKRTRADRKKAKRSDRNRLKRIEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFJ2	Uncharacterized protein (Fragment)	1	391-415	IVGQLLWHRDRKKRKYVTQGSDEAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFU4	Uncharacterized protein	1	59-84	KPENSVSKAARRREKHKNRISFTETS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG17	Uncharacterized protein	2	10-30, 270-305	DPNDPKWRWPWWKFRLPPDAL, AESGHVPPPKRRRRSPPPPRRRPLRHRRLINAHAYT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH12	Uncharacterized protein	2	1-22, 367-389	MPKSASTKRFRARERIQPSRAC, DGTVGVRRATRKRRGQEQDDDEY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHL1	Uncharacterized protein	1	51-74	VLLTSRGPRHRQLRQSHRPRAAAF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHP2	MFS domain-containing protein	1	559-579	AACGLSWKKIQKRRPAPAAAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI75	SEC7 domain-containing protein	3	34-56, 59-83, 1267-1286	PDSTTARRSARRNKPDLNINTSP, PPPPPPPPRAPERERKSNRTRGGGD, FSFSPNKTLRHKNRRGLGGN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIC0	Autophagy-related protein 26	3	50-75, 166-194, 351-374	DGRAVHRVSRKLQKKRRDGAHTPTME, TTVLPRHGRFRHKSDHRHRRKFSESRLLR, SGYLAKCGKRNPKYNRYWFRLKGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJE4	MFS domain-containing protein	2	1-25, 72-95	MYLAYKYAKKRYKERQAREAEQQTP, EDTADDRAEKKRRRTYRLKIILGL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK14	Uncharacterized protein	1	65-84	AAPFSKPKRRPSTRPCPGRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPG7	SAP domain-containing protein	1	321-346	MAGAEKRREGKRRGGRRRRQEGVEET
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPW4	Sde2_N_Ubi domain-containing protein	1	167-188	IKPEMDRREREKRRKRWEEIVE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZP5	Protein kinase domain-containing protein	2	74-94, 189-210	ESPDQGSRSRRNQPPHDQYGT, DETRRGGRSRHDHSRREKQTKF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0J0	Uncharacterized protein	1	477-496	KDPDEPPKRVSRFKKERAAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q162	General substrate transporter	1	305-333	PETFWDRKPIPRKVKKTRSRPNIFRRISS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1S1	1-phosphatidylinositol-3-phosphate 5-kinase	1	1919-1944	SREFEKERLKDRKQRAAKMHHTRAFL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E1	Uncharacterized protein	1	620-648	EDIERIQKQMPRKTKKKRKLDDDTWEEYV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4D2	Uncharacterized protein	1	833-858	EELSRRQLQRAKQTRRQRLEGCEKES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6A3	Peroxin-1	2	252-272, 1150-1169	STSTARRKSARQEKKPVLFFR, EGIRLAKKRAKQQLAKGPAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7G9	Uncharacterized protein	1	617-646	EEDAYFRKPVNPHRHQNRQRRIRPSDYREL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q875	Uncharacterized protein	2	39-63, 212-239	RKTVDAGKKSGQKRKRSEKDLDDAP, KLELEGQGKKKKKKKGKRGKFIGEQGDP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8K4	Uncharacterized protein	1	326-353	NQHHHGDKRSSNKQHQQQHSQQQQQQQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCW6	G-patch_2 domain-containing protein	2	20-44, 269-313	ASSPNGIKKRTRPTHVRRHRAHTLH, SRPVRLSDYRREENKKRQRIEDRYADSYKRERERERERERERERG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDB8	Zn(2)-C6 fungal-type domain-containing protein	2	25-64, 75-94	GSPGTLKHGEPRRRNRPALSCIQCRTRKIRCDRNEPCASC, EEARRPKPRLWRLSPAPPAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE43	Uncharacterized protein	3	7-26, 462-482, 490-512	TSALSRTRSLRKPTKTETTG, VESRRNRGRLHPSRRTSREQS, EEDEEQQQRRRQRQQQEKEEEGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHS5	Uncharacterized protein	1	191-219	EAAEARTRRRWPRPRQRRLRLRLRLKSLV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ5	Tr-type G domain-containing protein	2	605-631, 636-656	REDGSERREKPKKPKNRRRQEEEEDDD, YYEQRRRKKAEKAERERQRKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK79	HRDC domain-containing protein	2	698-719, 742-766	DDKAAKQAKKQAKKAAREEFKR, QARKALRAAKKAQKQQQQQQQQTSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKD7	Uncharacterized protein	2	16-35, 502-526	SQEHCPNKKIKSRDRLHGSS, SSKRNRASNSPPSNSRPRKKHDPAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKZ2	Translocation protein SEC62	1	327-357	KPVWAWHEPASKKKKKKKSKKSERSASGSAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL34	Rab-GAP TBC domain-containing protein	1	217-236	SKATEKRQSRESRPRPPSMA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMH4	TLC domain-containing protein	1	11-33	GNVVLVRRVKRKNESPMKQLTRW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QML9	Zn(2)-C6 fungal-type domain-containing protein	1	6-42	PDLEREMPAKRRRVRKGTRSCWECKRRKIRCMLPAPG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN53	KOW domain-containing protein	1	319-338	QEYNRKMRELRRQRGKPVLT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNA2	Uncharacterized protein	1	44-73	PLAHHRHHHHHHYHHYHHHHNNNNNNRRPT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP49	Uncharacterized protein (Fragment)	1	654-676	HTTLWRFSRRAVCKQLNNRENEF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1C1	Uncharacterized protein	1	98-125	AYRTYRSTAQWRKTRRARRSRSGGRMDV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2G6	Chloride channel protein	1	621-645	DSAGPASPRMRRRRRAEDELPQEER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4L6	Uncharacterized protein	1	330-357	HGSTPIQVRRPTRRRRRLSKVSFPFPPE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q515	Protein kinase domain-containing protein	1	25-49	PSNGNSPLLNKKRKKDGLKPIITTE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q527	J domain-containing protein	3	45-64, 117-140, 255-281	YFLAHARRARHKRTFSEDDR, TEEQIKRAHRKKVLKHHPDKKAAA, QKRHMERKNANARKKKKAEDNARLRKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7V1	Transketolase	1	44-63	FNRFMRFNPKNPKWLNRDRF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q918	Uncharacterized protein	1	509-532	TGPLGPKAKWLDRRKVCQTEKCII
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB63	Uncharacterized protein	1	20-41	LMPPPPPAKRIQRPKRVLDEET
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDG6	Uncharacterized protein	1	336-358	RGACWSRRPGNRPRRSRLADQSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDX1	Uncharacterized protein	1	478-502	KGYTDRDSRNCRKYQRNQCTNVCAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEW8	Uncharacterized protein	1	303-324	ESEPGKPKKGKGKEKEVKEVKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHS4	Uncharacterized protein	2	1-38, 141-173	MAIDKKRKRNEGHGKRSKAPPASSKRQKSNSGKRVVNV, GKDAPKRDAETQKKDKKRGKKEKQSSKVESANG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHW0	Zn(2)-C6 fungal-type domain-containing protein	1	129-153	PGGADRLQKRWRNSRVHRRIDRILS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIW0	Uncharacterized protein	1	338-365	RAFGEREKGGRRRRWGRRESRGSTCRTP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK59	Glycosyltransferase family 71 protein	2	71-98, 503-533	YANYNHHHHQHRHQQHHQHHQHHNNDDE, MTVIREKKVEGKKKKKEKKKKNGEEEEEEEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKH4	Clr5 domain-containing protein	1	554-573	AEELRKKRREHSWLERVRLE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMA5	Uncharacterized protein	1	66-86	YPSNWEKRHGKTPQKSRPPAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN54	Uncharacterized protein	1	272-299	VQFHDLDKEERRRRRERQASDRRRWVME
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP91	Chromatin modification-related protein	2	12-32, 759-778	VTGSSRRQPVRQTRVNPPRTS, GNAKWYCEDCKKRLKITERR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPC3	Cir_N domain-containing protein	2	254-346, 356-397	RELRELEKEERRRERKRRKREEEGEEEGKEERYDEKTRRRRRSRERRRDSPDGDSDPARRERSHRHRDDGRGERDRYRSRERERTSRNERDGS, YQDRGRDGSRERRRRPEEDDGREWPRRGDGDRARRSHRKEDL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ53	2-(3-amino-3-carboxypropyl)histidine synthase subunit 1	1	21-40	AHENATKQPKKRFVGRRAAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ95	Uncharacterized protein	1	17-40	NGSPPPAQSKRDKRRQMLADRLAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1U9	Cytochrome c domain-containing protein	1	294-313	SVWVKRYKWAWLKSRKIVYD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2A5	Uncharacterized protein	1	1591-1620	SISGKLKPLIKRTKPEKKQKIEEELRKIKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3M6	Tyrosinase	1	27-47	YDYGFDVKKRVKRQLGQRSAM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5D9	Uncharacterized protein	1	244-267	GGSGMRRRRSRSRSRNRSRSSTST
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5T0	Uncharacterized protein	1	818-848	KLAEIFKQRAKKTNKKKAKKDAKDTVVNFKH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8J4	Uncharacterized protein	1	21-40	SSARIKKNPKTQQIKFKVRC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q989	Uncharacterized protein	5	12-44, 46-65, 71-97, 134-164, 170-192	AVTESSQKHEKKHKKAKSDHKKKRAREDDDAAV, EETPRKSKKTKGTDAEERAE, ELGSDELTKKKKKKQKAQEEDEERQNG, APVEEERKSDKKRKQKKSKKHKSEEAEEMPK, ADGEGKEKKKRKSKQSSTTNATT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9S0	Uncharacterized protein	1	44-71	HASGGGGMRKRPKKKRQHKTFRTYDLSQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9T0	Uncharacterized protein	1	9-37	RSFSDGPKGRAQRPTKKQKKVASYHSSSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV9	Uncharacterized protein	3	39-60, 75-95, 502-527	KEQPNTGRARREKARRASSPIT, GDSAKKPSKDREKSASSKKAL, IPKSRARATSRAKSRPRSFSHNPSKY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAY5	Uncharacterized protein	1	15-34	GERRARKEIEREQKRKEGAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB55	Uncharacterized protein	1	11-34	ADDRKARLAKLKSLKRKQPTGADA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD55	HMA domain-containing protein	2	189-218, 227-252	CLPSRRPSTGSARRRRRRSKESALRSRTSA, ADAACCSTKKRPGSRKKNECRSSSDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDW8	Uncharacterized protein	1	83-106	NELEREQSRYKNNKSKNNNDNNIQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEC4	Uncharacterized protein	2	32-53, 74-106	EHEARARDAKRKEEEKRRLEEE, ARKREEEQRRKEEEERKRKRKEEEERQRREEEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIN5	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	2	16-39, 41-69	GYACQACTKRKVKCDKAAPTCSSC, KSKLSCGYEPPRPRTRKRKPSEDVLERLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIX3	Uncharacterized protein	1	414-433	QMKLWHARRKAERTQWWEAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ57	Uncharacterized protein (Fragment)	1	5-30	AAKLPGRTNKDCRKRWINKVCGNLKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKH1	Uncharacterized protein	2	110-140, 220-241	AEVLQNKERVKKRKKYERKQKLRKFFCQGEK, RWASCKRSEKLGRPPNKKRLFL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKH8	SWIB domain-containing protein	1	143-165	AKTKMKAKATKKKSAKRVRSDDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP14	SWIB domain-containing protein	2	26-47, 175-196	QANHLAKLRSRKPTDKNLPDGV, TDSPSKTKAKPAPTKRPRLSHF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPA8	RRM domain-containing protein	2	73-95, 660-685	FSYWPGKVSRHPSKPSRPSRAYL, AGEQQPSKRSGRRRGGRGRGDREAKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ06	Uncharacterized protein	2	1-20, 43-66	MPPKKNEKGGKKDAKKIVED, SSLAQQKRKEAEKKAREQEKKAAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZJ7	Cytochrome P450 monooxygenase-like protein	1	171-194	LFMARDKQKHARRRKGYDPRITKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1W1	F-box domain-containing protein	1	1040-1059	FDDRKRTSSKSKRGESQGRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1Y1	Ubiquitin carboxyl-terminal hydrolase	1	606-635	LSTHSAPAARTKQRKQQSRWWRISDDKIKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2M2	Uncharacterized protein	1	293-313	ARPAQPEKRKSWFARRFSKHG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B1	ATP-dependent DNA helicase II subunit 1	1	574-594	ERPAAKRTKVAPKKADRGQMS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4X9	Protease	1	48-71	PPLEHRWHASRPRRGQNNRTVERD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N5	Uncharacterized protein	1	16-37	LSPTQICRRLRLKPCARRSASA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q681	Glutamine--tRNA ligase	1	34-63	WVSKGELKKRLAKRAKKALKEKNKDAKDTT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7D1	Uncharacterized protein	1	556-577	AIPKNPSGKILRKQLRERAQKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7D5	RanBD1 domain-containing protein	1	703-722	GSNADKAKKNKSPWKVQGVG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M4	Uncharacterized protein	1	262-281	LSPREKWREERVQREKENKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q896	WD_REPEATS_REGION domain-containing protein	2	21-42, 95-117	ASSPPRAPSSRAKERRNPSITP, SEDAHRGKRRKFNHSTPEKQAGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8J0	Uncharacterized protein	1	224-248	LRAVHRQMRRICRNSRKCKDKMEYT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9Q2	Matrin-type domain-containing protein	1	22-41	ADRMRDEPKHIRDRLNRDHE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9X7	Uncharacterized protein	1	414-433	QTKLWHARRKAERTQWWEAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAH1	Uncharacterized protein	1	44-63	STASDKTRPARRLRPPTEPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAI6	Zn(2)-C6 fungal-type domain-containing protein	1	64-84	VECFFTRSKRPVRRGANNAAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAX3	Uncharacterized protein	1	691-717	WPPAAARGRRRSKTSWKDQQQQHPLVG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBA9	Aa_trans domain-containing protein	1	320-346	EESALLTPSRRKRRRKHRGGSGQNSPM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD54	Uncharacterized protein	1	7-27	QSQLKKKASFRDRLKAWQKPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDU3	DNA ligase	3	86-105, 115-137, 702-721	STENSKKRGRPARPAVAAKE, EVAAPASKRPRRGRKVVVDEDED, GYEPSKRSRNWLKIKKDYLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDZ8	Uncharacterized protein (Fragment)	1	6-27	ALPGRMRNPYRQSRKNASVRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEK6	Uncharacterized protein	1	430-449	LERERERELKRSMKKQTLRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI26	Delta 8-(E)-sphingolipid desaturase	2	131-154, 545-564	LVIQQQQQQQRQRQQKRQELTPRD, HLFPRIPRHNLRRTQKLVQE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJX7	Uncharacterized protein	1	166-193	ARSERRRTYSRHASRSRHRSHSGHRHGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL86	RING-type domain-containing protein	1	184-207	ILRRKVSKLFRRAKEQNQKVKGRW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN45	GRIP domain-containing protein	1	15-45	ARGPAAASKSKKKGNKKKKGNKGNTAGDDTN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNS1	Double-strand break repair protein	2	519-544, 618-641	SFISGQQRQAQRRKRFKEKPLDWDSD, RAAAAKKAPVRSRKKANSFQDSEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPC6	Uncharacterized protein	1	218-239	SGNPGEKQVRIRQRHRRAMSDS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0I0	Uncharacterized protein	1	270-289	QCGKCGKKKVSYSQAQTRSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q287	AAA domain-containing protein	1	3-30	ASDATGSVRRRRVRRRRHDKAAVSARLV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E2	Uncharacterized protein	5	8-27, 246-281, 469-509, 562-583, 654-684	DAPLRERTTRHYYREERRDD, RSETRSRRGSRSRSRSRSRSRSRSRSSSRSRARDKD, DDDRDRRDRSRDRSRDRSRDRSRDRSRDRSRDRRRDYDDYD, DSEDDRKKSKKLKGKQIITTAL, LRHEMRQWKLEKEKRHRRRLERQRQLANGGT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3X5	Uncharacterized protein	1	64-83	EETHAEKKKRRDRGVELGNY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q618	Uncharacterized protein	3	52-71, 1159-1186, 1526-1588	LPKARRCFKRGEIPHGRRSV, GEPYMLKQKGKKRRNKYRNKSRLSSQTA, TAAEKSRGIPGKKKKKKGTSKKGNKKKTKGKKGNKKNNHNKKKKKKKRQQKGKRKEPASDLDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6S8	Serine/threonine-protein phosphatase	1	500-524	DSNALKSHIKKGRNKRAQMLNSPPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8P0	Uncharacterized protein	1	375-401	KGSTETIRPKKEKKRPTRKQPTVAAGN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA47	Uncharacterized protein	1	1-21	MDSPTRRRRPAVHRFSLRYLL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAR6	Protein kinase domain-containing protein	1	1187-1213	GKPRLTVSSKGRRRRPSSKTLQQVLKC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBF7	Uncharacterized protein (Fragment)	1	10-42	VTYYNYRKKGHYKRECRSPKKEWKPAPRKEITA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBP7	BHLH domain-containing protein	1	184-204	EEWHKMRKDNHKEVERRRRET
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCU0	Histidine triad-like protein	1	68-89	AEPSAKEGRPRQPQKKSFFDPF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFT9	Uncharacterized protein	2	4-26, 266-314	LADGSQRQGRQPRRRNASTNSNM, VEVGYLMWRRRRRRRRGHGDESDEKTPAPARRRWWKRRSKDESDRGLFI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGY1	Uncharacterized protein	1	16-39	KCQVPGCHKKHTGHTQHNKRKVYS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHW7	Uncharacterized protein	1	378-408	DSDSDNERPKKQSKKKRKKGKGAQGKTVAFP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ96	Mannose-1-phosphate guanylyltransferase	1	345-372	RMVRALLLRRQRQQCRRLKKAWATKAIA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ7	Uncharacterized protein	1	536-561	GPDGRREKGLQPRKRLKKPLFEILNP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKG7	Uncharacterized protein	1	5-30	GLAYKLGKKEKGKNKYRSYKEVGQII
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMB7	Uncharacterized protein	1	53-112	DSYHQSSRPRDSHRNRDRDHRNRDHRDRDHRDRDHRDRDHRDRDHRRRERSRPPETGRTR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN69	RING-CH-type domain-containing protein	1	41-68	TPPSSGPTPTQRQRHRHYKPRTCRICLE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZT3	Uncharacterized protein	1	1-20	MADRIPRNRRDLKRERHAIA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q015	Uncharacterized protein	1	188-212	HPSRADDPAAKRHRRRKRKEKCAIL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Y9	Uncharacterized protein	3	318-339, 1476-1498, 1526-1548	SLNPHRRYKIFRHPRLQYRHSD, IAVDIRTKSRRRVQRQRELEGVR, MATLQNKKGKKRFLLPFTKQYNH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2I6	Uncharacterized protein (Fragment)	2	16-37, 213-235	STRNRPQRTYSHKGRSNRTFSL, FVPAPKKKVRRVLGPKDPNQQAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2W9	SPT3-like protein	1	282-303	QEAFRRLQQRPKKSRAMLNGTR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4D5	Uncharacterized protein	1	197-219	SEFRVRSRGLKRKMWWKNVKLMG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4Q0	SRR1 domain-containing protein	1	1-23	METEWNQVKRRRGRLRNIPASIH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N4	SAP30_Sin3_bdg domain-containing protein	1	158-179	LHKVRSQGVKKGRPPRREYIHL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N9	SET domain-containing protein	3	116-146, 486-506, 586-606	VEAAADRKTKRPPSKSHKKKQKSSELQINGV, ARANASKSKKRKPKAQQHAIS, QQQQQQQQPHRKRKRASDGTH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7C7	Uncharacterized protein	1	274-296	LHTLRRFWRKPASRKAPERRSGQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB73	MMtag domain-containing protein	1	141-253	KDSDRHRDSDRRHRRRHRSRERDHDRHRDRSRSRHRRRDSLDRDEKDSYRRRRSRSPEYGRHREERRHGSRSRSRDRHHRRRDSRSHGRSRSRDRAERSRHHDRRRSRTRYQD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBD1	Enhancer of mRNA-decapping protein 3	1	191-214	YGEVTAQKKKRRQRKPGSAKTATQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE93	CRIB domain-containing protein	1	310-329	TSLTRKPSVVKKRSSRRVLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEL1	MFS domain-containing protein	1	457-479	AGLMWRENRKRDRGERDHRLALP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG75	Uncharacterized protein	1	84-106	AAAQTERPRRRRGKRRQGCCIEG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHA3	Uncharacterized protein	3	77-110, 1108-1133, 1146-1171	RANIQKNQKKRAAEQRQKEAQKREAEKENRKNLV, SAPPRTTTKSQQRKQRKEALKKESAS, EIGPIVGRKKKQKKDKEKPSNKTATP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHL3	Uncharacterized protein	2	630-678, 830-867	ADAEEEKKKKKQKQKSNSNDEAEKKDEGAEQPKKKRRYKKDEEYGVSRG, GFVPLKKLDGKDRRHRKGKPKGRSFKVGGKKDPLKTFK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKW8	Non-structural maintenance of chromosomes element 1 homolog	1	321-345	VTSRSGFQRGRGRRRRQTEAAEVAH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN66	Uncharacterized protein	2	56-97, 902-931	SPSPLRPSPPQQPQREQQQQQPQQPQQQQSRQQQQQQQQEQE, WVLVRDRMLERKKGRRERRARLHRPGCVIG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPC4	Vesicular-fusion protein SEC18	2	739-759, 783-827	GAARHHYRVRPPDPRARRPGH, EPPPRVLQLGPRRRRHQDHPDHGRNGPPERRARRVVCRADRHADC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPD0	Nucleolar protein 58	2	477-514, 571-608	VEMKDAPSKKDKKDKKDKKDKKEKKDKSQKSKESEAPA, QAETPVKSKSSKRKHEPEEETPAKEEKPKKKKKKSSKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0L1	Uncharacterized protein	1	141-160	RERRYPVSGARQKRKTERGL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2F2	Uncharacterized protein	2	11-33, 333-358	VPQVVFRHGKKGKTYRQRAEGSS, AMAQRSRRRRMAHSSKPRARKQEEIL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2T5	Uncharacterized protein	1	101-124	ASRVLEKTKKRQTHFPQRKFAVKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2U3	Uncharacterized protein	1	579-598	SSNLSKHKRTHEVRGRFTCA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2W5	DUF4187 domain-containing protein	2	1-21, 44-64	MSPLTKNKPPRPEEEKKKEDE, ETSLQRRQRLRREAEARARPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3E7	Uncharacterized protein	2	228-257, 796-817	PELARGHFPPKKRKKCRDWEKKGYCPRGTN, QYNNHHRQHPHRQEGSRDHQNM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3X2	Uncharacterized protein	1	27-50	ILKNREGRPSKRADRKHAEEQPYV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q401	Uncharacterized protein	4	8-45, 67-90, 324-344, 373-402	VSSFPSLKSPRQRLLKNPKSNSPRQQQQQQQRQRGPLS, RTTPTARRQTRQTHQQQQQQFPEE, EESPLPKRRRRREADSPAQQQ, EPETQAQPKPRRQPKAKKQPRKPRAAEDGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4Y3	Uncharacterized protein	2	113-139, 514-537	DPVTSIPYPHPRRQRPPPPPPPPPQDS, QLLRRLDSSRPSRRVKRELCCDVQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6H2	Uncharacterized protein	1	724-745	HYETRVGKRKFNDRMRAEREAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6I3	IPPc domain-containing protein	1	465-486	EVENREQPKKQQQQQQQQQQTG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6J9	Phosphomevalonate kinase	1	185-206	TTTATAKPPRTRPRPRFRHFGT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q868	Uncharacterized protein	1	535-556	FLPSRWQGDKKKKKEGGNEGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8E1	Ribosomal_L18_c domain-containing protein	2	10-37, 270-294	SAYYSRFQTKYKRRRQGKTDYYARKRLI, WKQESLKYKQKKLTNAERKARVQAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8K1	Uncharacterized protein	1	558-578	EEEWRRRVEARREEREREERI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA58	GTP cyclohydrolase 1	2	15-42, 68-97	PVVNGDKSRRSKSKNNNNNNGKKRSREG, KPARDFRDKPEPPPKKKKRKTPAPAAPAPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBM9	SCA7 domain-containing protein	3	25-54, 117-143, 199-221	PSRSQAFGKIKLRKPPPKQVKPGNWKEAAV, HVARCLRIKKEKAQRKKEAREARERLK, LDKGKAKKKKDEPKPKTAKPKGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBY3	60S ribosomal protein L2-like protein	1	180-201	LKASRAKHKFAVKRNRWPKTRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCI2	Uncharacterized protein	1	651-678	MSSDSLRNSRRPKCSKRQHTPNDPGPSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDH4	Uncharacterized protein	1	351-370	QKVIFKPWQRFERENRNTRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG82	DNA-directed RNA polymerase subunit beta	1	1225-1248	LTKQSFECRPCKNKTKIAQVHMPY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHC8	CHY-type domain-containing protein	1	660-687	GKGTRDPRLMRRGDKRKYKRLGAQKKET
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL36	DNA topoisomerase 2	3	47-87, 420-441, 1632-1651	LTGAKAPAKKRPKPDSDAEDDMPKKKKAPAKKANAKPLAEI, GKELNKKKKGHSLKPSHFRNHI, AGAKKRGRPVGSKNKPKGDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLY4	Uncharacterized protein	2	6-34, 674-701	TIRAGGPPGKAKPKRKPNSVRRIMEQEQR, EAKVSQNNPPKPKRSRARKPRIGEGQAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN41	Uncharacterized protein	1	20-41	IPPPPVRRPQGRLKLRPNFYNT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN64	Uncharacterized protein	1	58-82	LSDEESTRTRRRKHQEESEVSKPPQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNW5	Cnn_1N domain-containing protein	2	372-391, 797-816	RPPTSHSQPKSKKEKREALE, FKPPPPPPPRSRSRQRAGSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPQ9	Uncharacterized protein	2	19-47, 52-122	ESYRPFNRDRDRSPPPRVRSPLRDRARSP, SDSYVPARSPRRRSRSADRFRRERSRERIGGESWRRSRSRARSPPRRSSPRRSPIRRTPPRFVSPRRDDRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD2	PSP domain-containing protein	3	1-32, 130-155, 611-636	MAAPKMTKNQMRRAKKKEQKKAKAEAQQNGSK, GEEAQPKLSKKKRKKLNKLSIAELKA, LSDMIAQKSRKRQRREEERRGEKGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1R0	tRNA(His) guanylyltransferase	1	238-263	VQQSKTQTENDKKRRAKARIVVQHLD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Q1	60S ribosomal protein L36	2	14-43, 63-87	LNKGHKTTARVNKPRPSRQKGKLSNRTQFV, LLRNGKDKRARKFAKKKLGTFNRAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Q1	Uncharacterized protein	1	1-21	MTARRRPALHKQTPPNSKDRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7B6	Uncharacterized protein	1	785-809	APQARAQPSRSRQPQQRQHQPPSLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Z8	DNA polymerase	1	565-588	GTAFQRDLRRYCRREKQLKFDSSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q872	Palmitoyltransferase	1	106-132	NGELRFCKKCQARKPDRAHHCSTCRRC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9B0	Uncharacterized protein	1	95-116	MFLSKRADEKRPENRRRHCGLG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAM5	Uncharacterized protein	1	559-581	AEELEKRRREWKAPEPRVKRGTL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBD3	Methionyl-tRNA synthetase	1	614-644	AEKAAARKAAREKEKEKKKLKKAAQAAQAAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBZ8	Uncharacterized protein	1	160-188	FVWRYHRSIRIRRRGGHHRRTSKGSRSSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC93	Dihydroxy-acid and 6-phosphogluconate dehydratase-like protein (Fragment)	1	581-606	AAEFDRRRKEWKPPKMKPMRGVLAKY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDU1	FAD-binding PCMH-type domain-containing protein	1	35-55	SPPARCFSNSRRQQFQKTSPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF95	Uncharacterized protein	1	378-400	GYYYPPQQPQQQQQQQQQQQQQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGH4	BHLH domain-containing protein	3	6-31, 61-82, 115-136	ASTKGSTKTRVPERKPRKSSASRGDA, TPSPRLQHARRRQNRVGKRYRD, ISEGRRGKTRARRRPLNKAEVL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ15	Calcium-transporting ATPase	2	163-185, 1127-1146	QFADRKRVFRDNRLPEKKPKSLL, PTPNVWPFNRKKKKEAALAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJC2	AA_permease domain-containing protein	1	652-671	QEEEERRSWPRWKRFYRLIC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK62	FAD-binding FR-type domain-containing protein	1	344-363	YSDGRRGRYASQNNRKRPDL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL80	AAA domain-containing protein	2	13-43, 1003-1025	SSSPAPSSKRPRPADAPKPPKPPKPRVLGGF, ETDANAGKRIKRKQDAGKAGRVW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLL8	Uncharacterized protein	3	1-20, 816-836, 950-982	MPPYVPRKRIRDDTPPTQNE, AKDEAEKKRKEDEKRRKAALS, SVMSTRPKRKAVSKAQATRRRRRPNIPSSSEEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM79	Ubiquitin carboxyl-terminal hydrolase	1	375-398	EEEDVERARKRRKRNPTLDNGQGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMC3	Uncharacterized protein	3	37-57, 204-227, 284-310	CTSTRPTQTRARTRSGRRAED, SDSPPPAHRQRRERRFRTRSPSYT, PAAGRSSRRRTRSRDRHARRNDNNTSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY6	NUC173 domain-containing protein	5	142-165, 981-1006, 1049-1069, 1089-1116, 1152-1181	SFSLDPRPKVRKRAQEALRKILKN, KLITNIRKTKERSKRKKEAAKDGGGD, DAEMRGRKQKKRGAAQKQGGN, ASISTTKPSRSKKDGKRMKAKTDPDGKL, RGKDVPRRGLRGKLKWNRRRKNDESDDDES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP73	Uncharacterized protein	3	148-169, 410-440, 509-529	NILVRRNIKRRWRKLGVWNPQW, AQAAPQQQQQQPRRRPRQRKDEQPVQPVRRS, QAEKPTTARSRGRPKKKTGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD0	Uncharacterized protein	2	124-158, 617-640	EQKAGGHQRRKPPKNSTPKKSSKPARATIRSPRKL, RPPDAEKITKRTPKKSRKLGGVLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZL5	Non-ribosomal peptide synthetase	1	2013-2032	EEVGGEPRRRRERRDCLVIC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZN6	PAS domain-containing protein	1	384-403	VPMDRDQRSGDKKKKLKMAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW4	Protein kinase domain-containing protein	3	118-142, 145-170, 793-812	NGAPIYPKESKPRKKKVIEVNETQI, AKLDSPSGPKIKKKRRSTAEPTMTLH, GAGGRRYRIRENLKRYWQTE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q052	MFS domain-containing protein	1	516-539	IDILFRRKVPARKWKKTVVDAEDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1I5	DNA polymerase	1	275-296	GLWRDETKRRLKRMGKLKPGSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1M7	C2H2-type domain-containing protein	1	172-198	EEEAREREERRRKRKEAEERKRQEREA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1Z1	Uncharacterized protein	1	1008-1037	IDTSRYGWEQKRQYRRRLAKKGLRKPFVER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2R8	Uncharacterized protein	2	29-48, 214-239	GSSCRKRCIGEKRYRSMQEH, GLTRPRKQSISKRAHHRRRSKGGPDW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3F8	Uncharacterized protein	3	21-63, 193-216, 229-250	ADDTRKPKKAKHGFRVGPENLPDGPWRRKVTKIKKDLITKAKV, GRGTGPKGPQQRRRHRHGHPDYFA, AEERRAERERREQERQRRVAER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5Y1	Uncharacterized protein	1	7-32	HQPNERGHAKTNKKRKKTYNTRHSLV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6U7	DNA polymerase lambda	1	142-166	QSPSASTALRKRKRQPSTKSVPEAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q710	Uncharacterized protein	1	156-181	AGKDRESEKERERRRKKEKLEEDLAY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q963	BZIP domain-containing protein	1	136-161	VTPPEHEPPKKRKVRKTRKESNAAEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9C3	Nucleosome assembly protein-like protein	1	264-289	LTVRIEQKKQRNKTTKQTRIVKKTVP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA59	TAFII28 domain-containing protein	1	95-120	VSTAAPLKKKRGRKSKAEKAREQTPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAU6	Mcp5_PH domain-containing protein	4	13-50, 881-903, 1117-1136, 1317-1350	PTLSRAVSRSSRKSKRSITPPGKKGKSRSPPPVPGDKS, AAVMPRSHRNRRRGSRSPPPVSL, YELPKPKRRAIRDSIRLTKA, LDDYRLMARRRSKELRRRTSRSSRQSRTTRATDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBE9	EH domain-containing protein	2	659-681, 697-718	SGSRSPSRRNAPQQQQQQPHKTG, DEDARRHQLHHHHRRRNKVLGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC46	Uncharacterized protein (Fragment)	2	31-54, 131-158	DEEHRRFHWMRRHGRKMALRDDRS, KNCVGREISKHQKKKKRMMMGARSRYSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDK9	Uncharacterized protein	1	152-175	ASSGNTPKRPEKRKASPEPDKGTP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QED5	Uncharacterized protein	1	418-448	SLPLRPRREQEQQQQQQRRRQQQQEKQQGAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEM0	Uncharacterized protein	2	63-94, 527-556	LPYQPPPPRKAGGRKPKPRRTTGPRKAAKLPP, RGPYGPRKPREGKPRPRRPRDPNKKSNYVP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEZ4	ENTH domain-containing protein	1	455-474	QPQIQQQQPKQQQQQPQREL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF26	Uncharacterized protein	3	57-78, 413-432, 527-554	AGPPRPDRRKAISREEKARRLE, APGPRWYRRLLRRYNRPVPT, GEEPVKSLPRRKRKREGRRGGPHRDGDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF54	Uncharacterized protein	1	80-100	LTAKLERARKHHKRVRSDPNP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFA2	Uncharacterized protein	3	38-61, 87-108, 489-518	EEDDRVYVRRRSRPPPHRFPDDGS, DVGRGPRPTRRRRSSLSPPEYW, LEKQLARRERSRHSRSRHRSRSRGDLVRAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFB3	Cytochrome b561 domain-containing protein (Fragment)	1	152-181	WGEWRIWKMTPRPCRRRKLRSPTSWTHQLG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGY4	Non-specific serine/threonine protein kinase (Fragment)	1	9-33	AEGYKLTPTRRRRPLAQPNKPIQGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ77	ANK_REP_REGION domain-containing protein	2	876-900, 930-951	KENFKETSLRVRKQRKPAPSGPVKE, IDSALWRTKKRREPPATIDDPV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ90	Zn(2)-C6 fungal-type domain-containing protein	1	6-35	LGYTKSRTGCLRCKQRRVKCDETRPACKAC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJB7	Amidohydro-rel domain-containing protein	1	10-39	HRESPAPTSGRPRWRRQKPRRSSALRFLAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJF0	Uncharacterized protein	1	149-171	EQIARRCQYERKYRKPHTTATEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJI8	MYND-type zinc finger protein samB	1	1195-1214	YCSAQCQKRDWAKHRMECEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJW1	MFS domain-containing protein	1	82-104	EDGDYNKHKHRNNNTNNHKNDDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKP3	Ribosome biogenesis protein NOP53	4	9-38, 69-91, 281-315, 406-433	GNPDAPQQHKQPSRKGKKAWRKNVDISEVQ, GDPELPKRFPKHIKKGLKADEII, EAVVKAKKPRRKTQAERNRIKRRKEEERRLKHEAA, IRGKVEARRKIPFRKQAKTKVTEKWTYK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLU3	Uncharacterized protein	1	147-171	GTSTCPQARKLKTRAKKWMRLHAVD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM88	Uncharacterized protein	2	87-107, 300-324	ARQQQPQQHPQQQQQQQQPQQ, IYTPTSPARRHKPPQEQQNQQSQQS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP34	C2H2-type domain-containing protein	1	236-258	QQCPSPKTRTRAKKETRCRTVMM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPS3	Uncharacterized protein	3	55-79, 894-913, 1208-1238	RDHLPADQRKPGKNRRTVRDPTTGK, AHHPRSSRRVRLPVRFRYRS, GSSSSKNPIKQYKDYRTRSRDLHRKHRGLMQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW0	RRM domain-containing protein	1	12-39	ILEERKQNNRSSRGGRRRDRSDYPRDGV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZX3	Vacuolar fusion protein MON1	1	23-45	SSRSPSRSPSPPPLPPRRKPSSD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZX7	Uncharacterized protein	1	314-333	MHEVRPKMRREKYTNVKQAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1Y7	HMG box domain-containing protein	1	1-29	MPKAAKGRSGKAEKKRSKKDPNAPKRGLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q440	Vps8 domain-containing protein	1	1511-1535	WEGREREAARARRRKRELNGKGVGH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5W9	Uncharacterized protein	1	12-51	SETCSSRSSRKSRSPGAHRRRRFRSRSRSRSRSESRDRDT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6A7	Rho-GAP domain-containing protein	1	122-149	QQQQQQQQKQHNHYQRQQQQPGHRHPRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9C8	Uncharacterized protein	1	21-40	TTTTAKRKAHPTPNPDPRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA70	Fructose-bisphosphate aldolase	1	318-343	VGNPEGPNKPNKKKYDPRVWIREGEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBY9	Uncharacterized protein	1	538-561	LTKVSRCKASRAVRMERARRAKRN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC47	Sas10 domain-containing protein	2	52-72, 587-633	EDEEPRSKRLKRQQQEDAFLE, TYQIQKNKGLTPHRKKEARNPRVKKRKKYEQKQKKLRSVKAVYKGGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCD9	Uncharacterized protein	2	522-556, 562-585	AAKEKEKKAAEARKKKRKERKRRRAERLAEALRNY, LEELRQRVKVARRRKKTITQDATE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCY0	Uncharacterized protein	1	73-93	ERDLKVVRAKRQQPPPGQKAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKS2	Alpha-1,4 glucan phosphorylase	2	52-78, 360-379	EASIPEPQRKTWRKHQSRGFKDKDGFE, YDIVRRFKRTKRPWNEFPDQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLT3	Galactose-1-phosphate uridylyltransferase	1	23-43	LVSPHRTKRPWQGQQEAPSKN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM54	Uncharacterized protein	2	24-53, 84-103	VEADASQDGKKKKKNKKRSAGAKKRGTGFE, IEECIQRYRARRRLNSDREY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMA7	DUF2439 domain-containing protein	2	29-55, 189-212	FICLFTHDLRKKQKRWEDGRLRYHTFN, NDSPDSRPSKRSRRDITPPSKKGY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNR7	Uncharacterized protein (Fragment)	1	42-68	QQACNRLSQRFRKRRARAKGREPKPTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPH1	Ima1_N domain-containing protein (Fragment)	1	13-32	FYCGRKTSTRYDGKTRRFDC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ02	Uncharacterized protein	1	113-137	WADRFVRKCLARRRPWRPVVIRGRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q056	Uncharacterized protein	1	303-337	ESEFVRLSRKEKKARKREKKEARKAEKEARKADRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0P3	Uncharacterized protein	1	225-244	ESRIVRRPPRFQKPPKGSRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2X1	CCHC-type domain-containing protein	1	347-366	PSRNRSPSPGRKARRHRGND
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2X7	Csm1 domain-containing protein	1	125-144	SPPPAKPKGARGRPKKAALE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q479	SGNH_hydro domain-containing protein	1	214-240	AMEKANSPQRPQKRRRMFKDDDKEFEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4F9	Peptidase A1 domain-containing protein	1	27-56	QWDIRRTQRQEELQRLNRRLRKRANPVLEV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q664	Uncharacterized protein	2	17-44, 654-678	LKNQVKFKGGRWRDRLKAQRNAKQWQGN, EDGKAKAKAKAKQRSKPRDNPLLES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6F8	Uncharacterized protein	1	1-20	MASRLIRSLRRRREDDVKPD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q700	Uncharacterized protein	1	1-23	MEKQNTHKNNNNNNNNNKNKKTG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q723	Uncharacterized protein	2	7-33, 435-466	SSLFPNRPIRPLPKRRLRERLSPEVAE, EEQRRAQWERMKKGKHKGRKNSKLPAKNSHAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8C7	Uncharacterized protein	1	533-556	TAWGYFIWRERRKRRGYQGLAGEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9F0	RFX-type winged-helix domain-containing protein	1	44-66	IDALALAKPRKRPRSRGSTASIH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA33	alpha-1,2-Mannosidase	1	57-78	ALNTKWTKLKTKYPVKDLRPLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAQ1	Uncharacterized protein	1	276-295	RTTGQKRPPKYAKPPRPGAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB51	Uncharacterized protein	2	187-209, 602-631	NEPVKRRSDLKKHEARHTRPCKC, YKCQECQKPFQRRCELKKHLKRHAKPYACT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBT2	Zn(2)-C6 fungal-type domain-containing protein	1	26-64	EAASTAPRPKPKRVQVSRACQRCKRLQKGCSESRPCQRC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC19	Uncharacterized protein	2	1-20, 323-349	MFGKKVRRKQQYHLLRIPGE, KEDKQKMMMKERKKKDKRGFSAKWDVT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDL0	Glycosyltransferase family 90 protein	1	223-242	STPTKPTTKKQQEQQQQQQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEE7	Uncharacterized protein	1	44-72	AYRRSFITPSKGKRKRSKKARGSETPSNA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEP1	Uncharacterized protein	1	384-409	LGIPHYNNLKDKKPKEKRKGGNGKKY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHJ8	Uncharacterized protein	1	577-596	ARFQHTKARVHRRRLRDVER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI04	Uncharacterized protein	1	27-56	DEPEKVKSVVHHHRPKTRKRRNTAIFLLGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIB7	Condensin complex subunit 1	1	201-225	KSSTTVPTRGRGKPKSRKDLGKDGT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLR9	Uncharacterized protein	3	177-196, 346-365, 608-636	APIVSHPKPKKQPSRVQLAP, ITNFSCPYRKRNPLRFNVRD, AAPRSTSARRRPNPQPKRIKRPEILPKAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLV5	Uncharacterized protein	1	192-213	IHPFPPFKKERRPAFNLPQVRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM89	Uncharacterized protein	1	27-52	NLYKVNVNRQKTKKWANFKPQNYDGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNZ2	Uncharacterized protein	1	25-57	HEEPQSGRRQQQQQQQQRQQQRQQQRPGPSPQS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP86	Uncharacterized protein (Fragment)	1	1-24	RGQKYRPLHPLKRVSRHPRVSYLF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPL2	Uncharacterized protein	1	135-157	TKIVKIACSGKHRKRTPPPGGYS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPY1	Rab-GAP TBC domain-containing protein	4	165-186, 282-301, 1124-1148, 1158-1196	AIVHQRQQQQQHHHHHHHHQLA, GSARPPKSPKSPKSPTCNKL, RTEHAKTEKGKDKEKKEKGKGLGMG, ERGSDKEKAKDKDKQHQQQHHHQQRQQQQQQQQPQSQKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZX6	Uncharacterized protein	1	288-313	VAPAEAPPRSKKKERPHRGGPNLMDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3E4	Uncharacterized protein	1	291-312	ASAVVRGRRRRQYKRHGLDLRQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3T5	WD_REPEATS_REGION domain-containing protein	1	309-337	NEAEVKKSLARKKRRKREKLAKEKKADGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4F7	Uncharacterized protein	1	670-690	ASPSRPRSRRHDSVRLRQERE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5C1	Uncharacterized protein	2	1-24, 74-96	MAMTRNKNKNKNKTTRSTKLNTTS, RSSRSEKPSGRRRRRSVPPKGSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5E5	Uncharacterized protein	1	232-255	MVMPEERWKANRKKHPLHDRLAAM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5P2	Uncharacterized protein	1	22-43	EFFSKLRPSKRPERGGTFRPTT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q732	WD_REPEATS_REGION domain-containing protein	1	1462-1482	SGTPRSSTRSRRKSAPADAAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q861	Uncharacterized protein	2	61-81, 324-343	REERARRARERDRGARGSRRS, STRTRSSKGKRTDERGKDRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8T2	Uncharacterized protein	2	128-155, 174-197	AREAEKRKRDEERERKRREKEEADKLKA, EKEQEKRQRAEERERKRREKEEEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q934	Zn(2)-C6 fungal-type domain-containing protein	1	10-58	PPAAKDAASARKRRRRAPAGGAADDCFTCAKRNVKCDRRRPYCSQCLEI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q992	Peptidyl-prolyl cis-trans isomerase	2	429-460, 469-499	THGERYKPSYDNRRRDPKRRSLSPRGGRYRDD, GGSRDDREWPRRDRRDHDRDRRDGKDRDRYH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBX0	Fork-head domain-containing protein	1	646-669	THTGSPAKRSVKKQRAERSQSTSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD70	UDENN domain-containing protein	2	82-104, 166-196	RSDAALRRPRKLRSQYPRGSSEN, EDDAERRAKEERRARRRRKRDREKGIIHESD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFC3	Uncharacterized protein	1	292-311	VTPSLPKKGHTRSKHTLNSW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG56	Uncharacterized protein (Fragment)	1	13-33	TLPALKQSSPKPKRTRLSLLL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI49	Threonyl-tRNA synthetase	1	13-34	IGGGGDKKPKKEKKAPAAAAAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIW6	Uncharacterized protein	3	145-170, 938-960, 1210-1231	TYPEESLKWVPRKRHNSRWPLAPKSE, AEPTDGPRLKKRRKYPESILKTA, ASTRRTRSSKLPPPTPVKKLRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL37	HTH APSES-type domain-containing protein	1	714-734	GAEPRSPRTARHRHHHHLLGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLC9	1-alkyl-2-acetylglycerophosphocholine esterase	1	6-35	DIHEKERQPHPAERRRRRRLTPRVRVIVVF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLY5	CCHC-type domain-containing protein	1	55-79	KKGHYKRECRSPKKGWKPTPGKEIA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM67	alpha-1,2-Mannosidase	1	87-108	VEKDPDARARRRERRAIVRDVF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPW0	Uncharacterized protein	1	153-173	ILLGLLKKIRKKRPDLRIIIS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPZ9	Uncharacterized protein	1	46-73	YIHYATMKPEQKKKKEKKGEKKGPEQKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW2	F-box domain-containing protein	1	1190-1219	TSTGRLSRRLPSLRRRRSRAGRSAAKNVAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q043	Aspartyl-tRNA synthetase	2	57-78, 740-759	EDERKFERRSFHQRRQEEEERA, FRDRCDKKIEEWKANRKGSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q183	Zn(2)-C6 fungal-type domain-containing protein	1	7-44	SPTTSPVKPHFPRPQHNCLECKRLKRACDKKLPCGKCE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q189	Uncharacterized protein	4	1-55, 93-113, 200-228, 640-661	MTAAKKNLKATKKFEKKHLKGVLEKRKAVRKIKQRQQLKEKKKAKRAQDEEFYKG, DTKTKDKTKSAAKLGKRKRGE, SEDEDEQPKKKQKKDKKAAKEQQEKDDRE, ISIKRWLKEGRKPGRGNRNGKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q255	tRNA-dihydrouridine synthase 3	1	96-122	QEATQTSKKDGKRKKQKGQNKDRDFGT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2F0	WD_REPEATS_REGION domain-containing protein	2	53-76, 242-267	EEEAKQGKGSKKEQKEKPSKEDDE, GNAEEDSKKKKKKKKSKRANDEYHVD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q376	CCHC-type domain-containing protein	1	45-73	TCYNCGKKGHYKRECRSPKKEWKPVPGKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q398	Uncharacterized protein	1	407-446	DWLIKRLSDKYKKDKGHWSHDLWKKMKGRDNKGRREKVEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Q0	AMP deaminase	1	305-327	GGGAARKSKAKKRKPGQDIGEDF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Q6	Methyltransf_11 domain-containing protein	1	35-60	EDTRDSFVERRRKRRSVEKIEQWLSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3X7	Uncharacterized protein	1	168-188	AGLRLNQKKERIKKEFERSEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q415	Uncharacterized protein	1	47-68	SPPTHSSRTSPPRPQSRRSAPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4T4	Ribose-phosphate diphosphokinase	1	88-111	VLPYFPYSRQSKKKSHRGAITARM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4T6	Polynucleotide adenylyltransferase	1	74-99	NPGGSSSSKPARKRPNQAQRRQMSAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5V1	Uncharacterized protein	1	131-150	MTRPGERVARRRRAKARIGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7G7	ATPase GET3	1	283-302	CDQCTARRRMQKKYLDQIEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q822	Uncharacterized protein	4	126-174, 342-368, 1337-1356, 1593-1612	VSSRSRDKDGERKHRSSKSRTSSVTKDEKYAERAKSPRRRSKGHSDSLV, LQSPSDDKQRSRRRRRAEMRTRGSDHA, EESGKKKSRSSWFRIPRISR, TPPQNKRISKLQRNNGSPLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8J9	Uncharacterized protein	1	99-122	KASGPEWGKRARRRQREMIKKLLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8N3	Uncharacterized protein	7	21-42, 325-351, 441-466, 537-557, 664-691, 1107-1187, 1208-1235	DEGYRRTTVRRYKVTPDRVERI, RYDDDHRHRHHHHHRHHRHHHRESYSD, DDERERYRSRSRSRSRSRPPHSRLKT, QHYRHKSKSRDGKSRSRSRLR, YESAAEERSRRRRRRHSRRRRSDDDYSA, TGEERRRLSHRERERSRDRDRDRDRSRDDRDESRRRRRRDDDGDSRRRLRRREEEEDERDERGERSRRRWKADERGESSRH, YYYDDYYHEERKRRRRRREEELYERGMG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q955	Uncharacterized protein	1	4-23	LNPRFRRLPRPTALRINPKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAB7	T5orf172 domain-containing protein	1	318-347	RHGVRGSGGRRKKKTKKKKTILLKIGRANN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAF5	Uncharacterized protein	2	1147-1169, 1363-1388	DVDMPMPKRKTRRVRDPYAIDLS, ASGISKVFSRRKKPSVSHPRRMPESE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAX5	RING-type domain-containing protein	1	203-230	VKTQTRQRLEDRRRRVREQRAEILRRRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBA5	Uncharacterized protein	1	14-41	LKLKGGAGVTKKKKKKDKGKTTDLEKNL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDL7	Chloride channel protein	1	80-101	DLSSPLTFKRRQKQSHFLSQPG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEE3	Uncharacterized protein	2	99-121, 701-721	TVGPGMATKRRRRREHMEEDDSS, VATNYKKYTVWRKQPMRLLSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEN7	Uncharacterized protein	3	5-24, 86-138, 892-912	QSIYPASPKHRNTTKQNTST, GSDSDYSDKKKKTCRKYSRRATRRTATSNQSCTPQRNVQRQRRQPSNKGSHDV, AQNWLRSKKPARFRPSPVSDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH64	Uncharacterized protein	1	51-72	GEHQPEDDKKRYRPRTFSYFRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHI8	Zn(2)-C6 fungal-type domain-containing protein	2	49-82, 581-607	TSGEAKKKFDPKDPLRPRRKKARRACFACQRAHL, AFNDSRGHKTRKCRLLKYRPPEKEDGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI21	Ubiquinone biosynthesis protein	1	13-40	ATYPDCPNPQRRQKFSQPRPRGPPPSLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIY6	Uncharacterized protein	1	76-101	SVNGDGTKSKKKKSQRFYCTDYPPCN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ52	Uncharacterized protein	1	26-52	TARTVAFCGRRRRRRKDQSNVGARGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKI8	Zn(2)-C6 fungal-type domain-containing protein	1	36-62	RRQADSCRYTAPRRRRPRPRSDDVAVE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM37	Uncharacterized protein	1	304-325	FWGPLVERSRKRKRAGSGSFEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNE5	Uncharacterized protein	1	33-54	GRLSGSKRNGAKKPQNNPYPQS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNH1	40S ribosomal protein S25	1	4-30	AAAAGAKKQKKKWSKGKVKDKAQHAVI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNK9	APH domain-containing protein	1	33-61	DDFERDSVRRLRRRMRKIARAKGKPFPDS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPD5	Uncharacterized protein	1	150-220	AQLAYQAQPRRRRRRRWRRRRMLRKQRQMRRTPRRLYEEEKKKKKKKKKKKKKKKKKKRNGGDRLNDHDGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD5	Zn(2)-C6 fungal-type domain-containing protein	1	14-54	VTNAAGKPYHAKRPHRKSRTGCRNCKARKVKCDEGRPACRM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q063	Uncharacterized protein	1	439-462	PPVILETKQVKPKKKIRCLVAFLG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q195	Uncharacterized protein	1	379-401	GQQGELSKRQAKKQRKEAAQAKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1S9	Nicotinate phosphoribosyltransferase	1	42-62	QYTNRTPEKKLSRKAFRWLED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1T7	WD_REPEATS_REGION domain-containing protein	1	14-42	REPKDDPALSQKKHRRKSKLQEVNVNGED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2T1	PH domain-containing protein	2	93-114, 352-376	DNSPSSSPARRSRRSSRPLSMV, IKFFDTKKDAEKKKKHQRPIASITD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3A5	Uncharacterized protein	4	6-26, 58-91, 102-158, 436-459	QMHYKCGHKNQGKVSKCRKFL, CTVSQAKKLMEKKKRREMELRKQEQRRRERAQFT, EEELMRRQRMERERQRKRKERGHAMSREEMEALRRERVERARRERNRRPQETRDLPA, TAAAPPKEEKKSRKSLLKKMMIGL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4T3	XPG_I_2 domain-containing protein	1	558-589	RSVQEPQNDNKSKKRKRRAPPGGTTKPRSGNP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6V6	SAS4 domain-containing protein	3	30-52, 558-577, 591-611	LPNAKDHYPPRPKRQLDPSERDI, ALSKNRRKGRKVLAWGQPLP, CDEETLRAHARKKRRDKRLRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q759	AAA domain-containing protein	3	51-83, 103-141, 371-410	VPSSEKKATSKHSKRRSRRPKKKQSQAASSSDS, EVETPNKKKVFKKHQGPPKAKKTRANKHRKASTAQKTPD, DLRKHLKDLKKKARESKMRNKHDRKKELKRIESKRQHLKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9L2	RNB domain-containing protein	2	463-487, 507-526	DEVWAQKREKEEKKKRKDITDTRSG, GGIRRRGSLRQRPTQKKNDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9M2	BRCT domain-containing protein	1	381-402	HDSILRRRRAKHKKEAALRQLT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAL6	Uncharacterized protein	1	204-229	RDRGRLEQRDQQQHQQRQRLQRRRLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDJ7	J domain-containing protein	2	207-240, 315-335	RRLKEAQQRKAEKKQRKEERRAERKGRKEKQAAA, RLRAAQAKKEEEKRRKAEQAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE62	Uncharacterized protein	2	4-32, 63-88	QTAQLPPKKSTPARRRPMRPVNSPARKTY, APPSQPNQGKSKPRNGNKGRVKQVSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEA3	Maintenance of mitochondrial morphology protein 1	1	384-404	VDRGHESLRYRRRPRPEDMFS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF60	Uncharacterized protein	1	22-45	RAVSASRRSIRRNGKPLRNPPDTL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIC9	Uncharacterized protein	1	404-423	QMKLWHARRKAERTQWWEAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIU5	Uncharacterized protein	1	132-151	SKPTVTSKIKETPRRKRTLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK56	RRM domain-containing protein	1	440-460	EVSRTQKKKDDRDRSPDRRGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKC3	Uncharacterized protein	1	382-414	TNNNNNKPLRERQHRPHHRHHRQHQHHPPHATA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKT6	ECM11 domain-containing protein	1	422-445	TVMQRLREARRTKRRLVQQYEEEI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMB1	Uncharacterized protein	1	130-149	GEKKERYKLPEQWRHRHVRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN89	Required for respiratory growth protein 9, mitochondrial	1	225-249	DPETERKRQERWFRRGKRVWTQWAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNL3	Uncharacterized protein	2	337-359, 472-492	GRPAGLRQRCRQQQQRQRRPGAL, AILPRRTAIRREGRREHKGEP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNL8	Protein kinase domain-containing protein	1	134-153	GRGTCSTHHHPPRTRTRTRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNS7	XPA_C domain-containing protein	1	304-346	AEFERREADKKRRKEAKFKEKLLDLKRKTRTEAFRRNNTKSGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0A6	Uncharacterized protein	1	1372-1391	QLRDGKSKQVGKTKHRKSSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0F2	Ribosome production factor 2 homolog	4	1-25, 51-70, 254-273, 292-311	MLRQIKPRNARSKRALEKRAPKIVE, ALRKDNAKRFQKKNAIHPFE, KEAMRRPKTNEERTKKNIST, GLQTRKMKGLKRSRDQHDDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0T3	PCI domain-containing protein	1	455-474	TGKALRKVHKGQFRARVRQM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2C4	EF-hand domain-containing protein	2	455-474, 1531-1553	FQPQRQKSVRQPPKEQQFVP, YDDKKNKWKMWCHKRAIEKRGKW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3I9	WD_REPEATS_REGION domain-containing protein	2	202-221, 255-276	DATAGPKRRRRRSSAGSDSL, PTSSRDGSSRKRRKLRPETIDI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3J8	Eukaryotic translation initiation factor 3 subunit M	1	537-558	ISGGHGGDRRRQQQKPRTDEDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3S5	Small nuclear ribonucleoprotein Sm D1	1	82-103	DDAPKPKNKARKEAERGRGRGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q452	TOG domain-containing protein	1	210-232	STEAAAGRKRKKRWDVSSTETTG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4Z6	WD_REPEATS_REGION domain-containing protein	1	1-26	MATIAPPPSKRQRREELERTQKQQDV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7D6	Uncharacterized protein	1	114-143	AYYSGRYGSCRRRRRRRRRRCQTTTATPLV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q979	Uncharacterized protein	1	324-346	RASLGGKSKPRGKRRFHELEGSD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9R8	Uncharacterized protein	2	100-125, 1305-1324	AHLVRLSKYQERKRANTRIRLQRSLV, AIQRRARKAQAKEKRKSAKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC8	Uncharacterized protein	2	17-44, 49-73	KTRSVCSQAQAQHNRRRRPRDGECLNVC, EHLQLKCRDCHRKWRKAQAANFESR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB32	Uncharacterized protein	1	1-56	MNGTTVKANDKKKRAYKQDQKKTTKDKSNVTCYNYRKKGHYKRECRSPKKGWKLTP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB53	Uncharacterized protein	1	457-489	QSPLPTQPRSHRRHPANHSRNRHHHQPHSSKTS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC90	Uncharacterized protein	1	91-110	HAKRLCTDDRERRLRRFYRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCW0	Uncharacterized protein (Fragment)	2	6-31, 300-323	ATGGPSQAQPRPRKRARTARASEAGN, GVKYSSTAKKRNPSTRKVDCPWRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV9	Ribonuclease H2 subunit B	1	431-450	QDARAEKRRKQEAEEKARKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF39	Zn(2)-C6 fungal-type domain-containing protein	2	225-248, 853-877	ATPPRKRSKVSRACDECRRKKIKC, QEPQQSEPKQQQQQQQRQRQSPEEQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF80	Uncharacterized protein	1	10-31	QGEVRLSRQRSERNRKKGSGQL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFP9	Aldehyde dehydrogenase	1	24-45	AFRTHKTKTLQWRQTQLRKLYW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ75	Uncharacterized protein	1	29-57	KAEKLASKAKPKPVPLKLKPTKADRKGVA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJT1	Uncharacterized protein	1	345-374	TLVARLPRELERRRRRRRRQGSRSGLDQHP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM33	Protein kinase domain-containing protein	1	208-234	LWQGIKAPKKEKNDRIKQKKQEITIED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM62	DNA-directed RNA polymerase	3	48-67, 495-516, 1349-1374	GSDARPWKKKSYRALVGFER, IAKNLPKSKPRKQKSARQLMRL, NYFVMEMNKPKRKKERSGSKPSQVEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMA9	Uncharacterized protein	1	190-216	RIIKACDSCKRKKVRCDPSHRKRNASQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMH0	Amine oxidase	1	582-603	EGIASWIRKRRERRRGEEVGGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNU1	Uncharacterized protein	2	745-769, 880-911	LANLPAKKTSKPKPAKSKKAGGAGG, ASEQPAKSRQLSKSKKNKPMSKSEQERRIQQL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZI8	Uncharacterized protein	1	495-515	IVNSRNKPEPRRSAWQTCVFP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q126	tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase	1	304-336	WEDAQSRRERKRQEGLRRREQLRKDKKTEVVDE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q201	CUE domain-containing protein	1	109-130	QWGEVSKPKKDRARLKAKADTS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q215	FAM192A_Fyv6_N domain-containing protein	1	56-77	QLEEDRRRRREQQQQQQQSSQE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Y0	Uncharacterized protein	2	27-54, 517-546	PKAVTRASYESKKPKPKPNGPLVSFNRH, ITDQQQQQQKEERQRRRRREWEPRNRDSSI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q336	Uncharacterized protein	1	58-83	TLDKAQRRRAQVRRAQTQHRQRKADY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q340	COX assembly mitochondrial protein	1	58-80	NRNSVQDKRSKIRQKWKEIDENS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4M1	C2H2-type domain-containing protein	2	851-876, 946-965	EAEKPHPCTQCKKRFKSPTEAERHLN, DCDRNKKFYRADNFRQHLKN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4W8	Uncharacterized protein	2	14-38, 154-176	VRTSASGIRPRPRRRMPSRPLAPAP, VRSSTLVLRGKKRSRRWLVSSWA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q502	Uncharacterized protein	1	688-715	SPARHRPSPSATRRPSRRHRPSGGEIHS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8B0	ABC1 domain-containing protein	1	44-68	GTSTRPWLASQPRPKPRRRAAVLLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAH2	Uncharacterized protein	2	1-21, 208-229	MPRTRHHRSSRRVPPLKDSDF, WNSFVRRRAWIRKRVKKNEGYS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB01	Aspartokinase	1	349-368	SDPALRKKPKRPTAVTVKDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBD8	Histone-lysine N-methyltransferase, H3 lysine-79 specific	2	1-23, 118-144	MSILNKKSKFKVKTEVRKVQQAV, DDWRERLDPSKRRKRAHTEDPGRRLRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEY8	ERF-3	1	644-668	LLHKLQKGTNRKSKLPPSHAKKGDS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF82	Uncharacterized protein	3	1-29, 638-672, 754-788	MSPTTWRNNFARRRKRRVSTALPEKPSKE, APGYRSVKKPRGKKGSKKEKRQPKHRTPAETARPS, DGKPAPTQPRTTKQRRRMLRRQRQEQEQREQQQKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFM9	Uncharacterized protein	2	24-46, 274-295	HKTQQTKAGKRMPRRAQTQHEYF, SKPGDPRRCGRHYVRKNTVQLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFQ5	Uncharacterized protein	2	8-47, 77-102	EGGPAKGTRSSRRRQRTSEPSSQQQPKAKRQRVPPAETSS, VAPPRKELSVRSKKPKPGERSTKGDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK26	Uncharacterized protein	3	69-91, 285-305, 600-620	PPETSFRKPKVVKKVRVQSPPSS, QTTPPHPKKKPPPPSSRHGKL, GKEPPPPPTRHRDRGNSRGSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLT4	Transcriptional adapter 2	1	151-172	REEFQARKKRRIEERREAAKNA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMM5	Uncharacterized protein	1	1063-1100	AVTGESMKFKAKKKKKLTKRELKEREVRRRLRHIEWLN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPJ3	Uncharacterized protein	1	233-257	VCFAFVWLRRRKQRKESFDRALRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPK4	acidPPc domain-containing protein	1	38-61	LKSLHHYRRALPKWRYNLRQRLLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPM9	Uncharacterized protein	1	444-463	DEVGRERRVREDERKEKQGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q080	Uncharacterized protein	1	195-223	DERDKRFPGCDWRRKREIRKDIKEPQIHP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0A7	Uncharacterized protein	2	92-113, 129-153	EYPVRPRDPAKRAKKDVAVHFT, VPTIEVSKRKKLRPKPSPSAAPSQP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q110	Uncharacterized protein	2	145-167, 205-231	DEFSKSKKQRRLALKRQRQQEAR, VDKREELRKAMRKERRAKIKESNYLKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1K3	Uncharacterized protein	1	414-433	QMKLWHARRKAERTQWWEAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1S8	WD_REPEATS_REGION domain-containing protein	1	26-45	LPPVSGQKKHTQKHIQVRLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1X1	Uncharacterized protein	3	241-278, 357-381, 578-598	QLDNPPPVKRKRGRPKGSKATKARKDKGVKKGPKPSTS, TGGTPTTRKRGRPKGSKNRPKSLSA, APEPPPKRQRKGKDARPPSGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1X5	CBF domain-containing protein	3	1-22, 30-73, 949-975	MGVKRTKQKKKSVKPSFDETAL, NQNLADSKKERPPKRKRQRDNDDEHDPKRRHTLHEKHNSQKETG, EDKPATASPRRGRRGRLSRKEMRSLPT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2C8	Ribosomal_L2_C domain-containing protein	2	63-82, 345-382	KMRTYKPRTPGLRHLKRPIN, WGQPAKGGFKTRKKSNVNKWVVTPRARNMGKRRNKNTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6I5	Uncharacterized protein	3	156-183, 188-220, 478-500	KDGRPDPSRSPQRRQERRPRRNSDSSII, TEEERRQRDLRRRERERRHRENRDKKPVSRKLD, GILGRMKSLKGRRQRPNPAAGSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q827	Uncharacterized protein	2	465-502, 569-591	AWHARKQKEIRARGNRKANFGRAAQSLRRQRREREKAG, DGVTEKRGKKKHPGVTGRRVGNS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q874	B-block_TFIIIC domain-containing protein	3	544-568, 1660-1685, 1945-1966	MSRIARKSKPSAKRKLLPRIRPEYV, ARDGEPSSKKRRPQKAPGQVRRMQGR, ISKSSSKWSNGRRWRFNTRVID
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8A0	Uncharacterized protein	1	14-34	AHDPHEKPDRYRNPREQSLIM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8E5	Autophagy-related protein 2	1	1622-1645	AGQHRRSKSLKLNRSKRHKITFEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8T5	Uncharacterized protein	1	16-36	RLLFRPPPARRAPRAPRAQPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q959	Uncharacterized protein	4	210-243, 459-505, 562-667, 754-850	AREERRKKEREEDERREKERRERREKERELERER, RSKSVDRRRRDARSRSRSRTPRPRDRSRSRRRSRSRFRDRRAERKDD, RIDDRRDRSRSRRRDPRDRSRSPRPRTERRDRSRSRLRFGRRDRSRSRSRDRDYRDRRERSRSRARSDRDRSRDRNREKDRIKEEDRERRRRSRSRSARPPSRMSH, RYDGDRDRPRDRNRDRDRDRDRDRRDRSRDRDGDRARDDRRGTRRHSRSRSRERDRDRSRDRSRDRDRDRDRDRDSHYRRSRRERSVSSRRDRDWDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBA3	Uncharacterized protein	1	30-49	YCWARCQEAKRVRTRCKYSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDX6	Uncharacterized protein	2	278-300, 1204-1230	ALEKRIPKPNPKPPQTHRPRSSS, PSPQLPQPPPQPQPKPPPPPRSQPAGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ32	Uncharacterized protein	1	3038-3066	TNPTNKQALKASRRQKKTKAASTPRYGMH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJJ9	Uncharacterized protein	1	636-658	EEQEKEGKKKWARMGKGKGKGEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKF8	Uncharacterized protein	2	434-458, 512-536	GGGSAQGNNKKRKKPNRVAFRAFGG, QDIPVELRPRDPRRKWRVVYSGSDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKQ8	RNA exonuclease 4	2	32-60, 308-332	DSVPDQAKEGPKKRRKQQQDRGRKPAQLS, ANRYPDEAKSKPKKGNKGKKTKKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMQ7	Non-ribosomal peptide synthetase	1	7770-7791	INGLVKRKFTTKKKGEQPVTVS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN17	Uncharacterized protein	1	376-398	SDSSTRWEPGRRRQQHHHLYPAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPD1	Ubiquitin-like modifier HUB1	4	1-33, 43-66, 70-99, 119-142	MPDSPRRRSRSRSRSPPRRPKVSGGFKWKDKRS, RGLQRGYRDRSPRRDRERDRGFGR, RDRDRDRDTRDRSPRRDRSRDRDRERERDR, RPSDRDRDAKPKPKKERPAAAPTN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPK5	[Histone H3]-trimethyl-L-lysine(9) demethylase	2	252-278, 620-657	TRTTSTSTRGRKRKGGRATRRSARAAK, HTVRVKAPGRKRKRDTDEKEPRAKTKKVRLRLKPHVEP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q231	UBD domain-containing protein	1	43-68	VDEPLPSGSRHRRRHSHQPLDQHINK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2S8	Uncharacterized protein	2	927-949, 1014-1034	GGAFSFFRRKKPPQKQEWEVYED, SGPSPPPKTAPRQSRRESKSV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5T5	DRIM domain-containing protein	3	7-32, 2146-2168, 2563-2618	GRIVKTSRGSKKTPHQKNHRWESFSA, FQFLREYPQKRNRWEKQLKFIVA, GEDIRVKREQRSSKRKIEALTAPEKYGREKRKKLEKKKEKRKARGQEQREHRRNFL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6J3	Zn(2)-C6 fungal-type domain-containing protein	2	48-74, 849-871	AHTLTACCRCRQRKTRCDPALPRCLPC, TPPPPPQSHSRHQPQQRPPPSHA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7C5	Phosphatidylserine decarboxylase proenzyme 2	2	139-164, 257-288	DGKTEQKPKWYPLKSKRPGKKTSVVS, QSKPEAVEKRRRRLRIKGLKRKKRENPYEFIN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q945	Fungal_trans domain-containing protein	1	600-625	IEKAEKEHASRRKRKNQDQSLNKSAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAZ5	Enhancer of polycomb-like protein	1	218-240	DPYVCFRRREVRQTRKTRARDVQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB25	Uncharacterized protein	1	26-48	LQDRANPRKHRVQPDGKNKPAAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBV7	Brix domain-containing protein	2	12-59, 408-427	LSLKTSNKLKRQQLYIQQKKATGKARHEERHRRRKEEAKNPELRRQRL, DALKWEWKAKMEKKRTRFNL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE20	tRNA-dihydrouridine synthase 3	1	349-368	GPEARPKKRRSEVGKENPAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE89	Uncharacterized protein	1	126-151	IPCADRDRDRQRRTTKQQARLRRGST
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QED0	Patatin-like phospholipase domain-containing protein	1	165-202	VHERVRRDRKDAPPSTRKKKKKTRRKARTKDETREGYF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEF5	Nucleolar complex-associated protein 3	3	1-20, 42-67, 347-376	MSSRPSKRRRVTPPLEDGQE, EQEYELKSRKAKKKEAKKNGSEAGGR, DQPSVKKPKAKKEFRTKRERKLLKQQKEVD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QET3	Uncharacterized protein	2	270-289, 610-634	SPTKGPKKERNKPSNLNLSR, TPSVVTRADRKRMKKLEPRTPTVEM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QET5	Glucosamine-6-phosphate deaminase	1	376-398	DPSLLRRSTPNPERQRPRSPGLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF23	Uncharacterized protein	1	33-61	AGTNSDKEQHSRRRRHRGCCCCTRRCCTP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG29	Non-ribosomal peptide synthetase	1	2514-2534	GAWTAKPPSHQSHKRKPSGSI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK80	Uncharacterized protein	1	161-182	DDEKEERRKKEQQRQLVEKLKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLX1	Uncharacterized protein	1	287-307	GDFYHRPPKPQQDRQSPPQTF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPF5	Uncharacterized protein	2	1-20, 80-111	MASRQLRKIRKQQELLSLQN, VEEAEPAKKTKKKQKKKKKKGKQAGQPAPAQD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZS6	Uncharacterized protein	1	8-27	RGSHASSKPKHISRLRKEML
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZX9	Zn(2)-C6 fungal-type domain-containing protein	1	88-109	TSVACGHCRRRKIRCVPSQNDV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Y6	Zn(2)-C6 fungal-type domain-containing protein	1	72-95	TTAACGACRKRKSKCDGERPACSI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E8	Uncharacterized protein	6	358-379, 566-586, 647-670, 675-706, 722-746, 835-856	SLQEEKNKRLRRDRKARDDFIA, DEAERERQRRRDRPDSYRDRG, RDRDRDRERERERNRDRERDRDRD, RDRDRDRDRDRDRRDYRDRDYRDRDRDRDRER, RERERDRERDRDRDHRDHRDYDRRP, RPPSRGQRTPLPSKEKERPSPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2C1	HMG box domain-containing protein	1	101-129	GPRSTRIEKSTPKRKKERARPLKNMPVLD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Y6	DNA helicase	1	667-690	KEVVEDESRRKRRKTRPLEDEDDS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q345	tRNA-dihydrouridine synthase 3	1	419-466	LGEFEPKRGPKQKNKQQQKGQQGEQPSGQQQESKKRKRGQDEEEEREG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q476	Uncharacterized protein	2	94-115, 748-768	QQYPWQRPAPLKQRRKAQPGEL, VVDKKDKERWWHQERGRWREL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4X8	Uncharacterized protein	1	17-44	RHDEPATHHHHHHRRRRRASVHYPLPME
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5M7	Uncharacterized protein	1	74-98	LSQVVNGKKKEKKIRFPLTNRSHAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N7	Zn(2)-C6 fungal-type domain-containing protein	1	69-97	VECRVVPPQPPRRRKKKPHERDLIERLRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Z5	Uncharacterized protein	1	1612-1631	ASKLRLKNRKEKLKQWHTES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q728	Uncharacterized protein	1	13-40	LSRQLGRQCARPRSLRPRNRNPVLPGAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7R2	Telo_bind domain-containing protein	1	214-237	DGGVKGRGRKRARFGRNSNTWRYS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7S1	PINc domain-containing protein	1	162-182	ATNDRDLKRRIRKVPGVPIMS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q869	Uncharacterized protein	1	21-44	LQQARMNKDRRPGRRQPRFTSCCE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8C0	UBC core domain-containing protein	1	4-23	CQNRLQEERKQWRKDHPFGF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB86	Protein-serine/threonine kinase	1	259-278	AERHQRRKDKDHPDPSRPPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCW7	Vacuolar import and degradation protein 21	1	722-741	IPRRRPTTSFRVERRRNQKH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDZ4	Zn(2)-C6 fungal-type domain-containing protein	1	11-41	RYHTKVRSGCLTCKKRKVKCDEAKPHYRCCT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF20	HECT domain-containing protein	1	62-90	RAAQRIQRTWRGYRSRRNLRASRRQAVDL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIJ4	Uncharacterized protein	3	246-266, 1107-1131, 1236-1259	PAPARLSSSRRRNPSKKLSAD, DAAPEPIKKRGPKKKEPAAQAPPPP, NGTSTNTKPKRARGKKGKAGADTP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJG5	Cytochrome c oxidase assembly protein COX20, mitochondrial	2	127-146, 151-172	QYEYCQFRRHQEREKVKRVV, AKQAREKKEKEEQERREREKAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLJ8	Adaptin_N domain-containing protein	1	179-204	MTVYARKCFPRRTRTVKNKERPAELQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMA8	Uncharacterized protein	3	96-121, 123-143, 611-636	DMDARDPSRPDKPKRGRQGPLTGPKK, KTNLMRKLKACKECRERRVEC, FWHVRDRWCGRRRPSRWWGPPPPGEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN63	Stc1 domain-containing protein	1	54-74	EEKCRGPCGRWREKRLFSKST
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNG0	Uncharacterized protein	2	46-66, 145-166	QLRFEKKYKRRLKLATARPRW, VLQFLRRLYRRREKAHHEEPAF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPJ6	Uncharacterized protein	3	76-101, 172-193, 472-493	AAAAAAARRRRRQSRRPERTVRLLLG, REERERREKREEREKREEREKR, VERLRAWWREKQRENWGRGRGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPT1	Uncharacterized protein	2	595-615, 624-644	TAEREREKRERERAAKEAREK, SRQWAEKQRLKKEAERRKGGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2A9	TRP_N domain-containing protein	2	729-748, 984-1012	TPDPYYRPPRQRRQTMETSS, DLRVPEVPRKSSKRNSWTRSQSRESHPKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3C0	Uncharacterized protein	1	317-338	LPSCTWRKSKTRSAPKDGIPTV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5G2	Uncharacterized protein	1	7-33	VAKGSSSKAKSKDKRKEKSVKKESSSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X1	Uncharacterized protein	1	229-250	LERALKDKEKYRKKLKEVLGGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6J8	Uncharacterized protein	1	38-58	LNSQNRPSFARRRNATRVGRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q971	Uncharacterized protein	3	136-156, 248-272, 737-759	FSNPAPPRKKSSRMNFGRLGR, HATTTFFRLPRRKPKQPTPLFPIAH, VGLLWRKDAKKKKTRSPWQEWGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9K2	Uncharacterized protein	2	1-20, 205-234	MAPKKKLGKQPKQDENDSFP, QEELRRQRSRAKESRKKNRTQRLSPDRLAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9M9	TP6A_N domain-containing protein	1	353-375	ISDSRREKPMKRARHSKEQESSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9V7	Uncharacterized protein	1	95-117	GKDHWKRKAKAAKKQRTSCNCLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA50	Uncharacterized protein	2	355-375, 436-466	IAATWTRKRIKQKMHYSEPCP, REDEPRPAPKVPKRKQKPAASLKRKRAPDED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA61	Uncharacterized protein	2	65-86, 293-345	GAYKLKSKKTIPKKMGAKKTGD, TDQPESRKAKFRLRRRKRVVHFKGIKKRKMAKAARRREYRKMVREKRAARMAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAD2	Uncharacterized protein	2	63-82, 101-120	AAISKKKQRKLEKALRHALR, AETEKQQKQQQQQQKKGEAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAF2	Uncharacterized protein	2	27-58, 231-255	SHSSSSSSSNRRRRSKSSQRHRRRPANVFDAV, DEPPVSHTSPKPKRRKVANTEISVE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAP5	Branchpoint-bridging protein	1	51-78	RSPERSEHDGPRRRKKRNRWGEATENKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE82	Uncharacterized protein (Fragment)	1	592-613	AYKCHTHPKIKDAPKRKREGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEH1	Fungal_trans domain-containing protein	1	578-602	QQLAQGRRQQQQQQQHQQQQQQQSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEJ2	Uncharacterized protein	5	12-32, 44-95, 212-237, 247-267, 622-641	GQNLPRKKKAKPSGREVVKIE, ITVTYPRNSKSSRRRNKHRKPSSVPSTSEEKKKVTFEKKPLKSALKKRQDAS, ATASEPEPPKRKKKTKQQTVAVSSKT, SEPPKKGKQSGKKTENEKKEK, TTRRRAGWTGPLRRRRIPGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV3	Protein kinase domain-containing protein	1	28-48	AGPWKIYPAKNKKTGKECSVF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN6	Phospholipase D	3	210-238, 480-499, 1722-1751	DETTAGLSKGKQKRRRRMRRPRTESYSVP, PSKSSDHSARRPKQPRFPLS, PDGNNAKPSGSQKRRRRATTRSSRPRFSAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHC1	Uncharacterized protein	2	176-197, 860-882	ASPPPRSKPVVHPKPKNLHGNA, VCETCNKPGRTRKAKFARLPDRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI43	NmrA domain-containing protein	1	272-292	VDREIYKKRRHINVPKWLLKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIM1	Uncharacterized protein	1	70-94	PSPPSAPVKKAPRRKPSKWILFQLW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ03	Kinesin motor domain-containing protein	1	648-669	GKSPLRGKGGKKKGSRSRAFEH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKP1	Ribosome biogenesis protein RLP24	1	26-64	GKSFRFCRSKCHKNFKMKRNPRKLKWTKAYRKNAGKEMV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY0	Uncharacterized protein	2	16-47, 807-827	QTEPEPRRSRFDRRSRSPPARKPDSGRDRERS, GEKGGRGRPRLRRRWVLEAQL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP78	HMG box domain-containing protein (Fragment)	1	46-72	LAEEEKQRHQRQHPDYRYQPRRGNKVG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q276	PX domain-containing protein	2	789-810, 860-886	IAWQEARKKWHHDKTRQKMAAE, MDPIDAERKRRARRQARLRRNAGEPEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2J8	Peptidase A1 domain-containing protein	2	495-520, 539-567	VLWFCLSRKRKERRKEKQKEAPVQEE, QSPIKRMLTKIIRKKRSRRPVSQQTNETN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q306	SEC7 domain-containing protein	1	1344-1369	EQQNDRKQGRKSGRPGKPEKPRWVVL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3K0	Uncharacterized protein	1	302-323	IFYRYWSKRKLRKSMDMRDKAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3M5	Uncharacterized protein	1	66-88	LLSLVYKRWRERPQRPVKIWFFD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Y6	Uncharacterized protein	1	794-814	IELNNRNWRWHKKMQMWLTKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4D7	Uncharacterized protein	2	357-384, 392-418	RVEKQQALKRAKEKREEKRREEEAKRAA, LIGAIKKGKAKENQKKGAKKGKAAGNN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4V9	Uncharacterized protein (Fragment)	2	24-48, 161-188	LETTPPPSKSRTKPRKKDSPVADSW, RAYDRAVREKEKKRREEEKEKQRLREEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5P1	Uncharacterized protein	1	1-20	MPPRPQRLVRRQPLGQRLRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6I9	Uncharacterized protein	1	1026-1058	GTKKKAKLTSSELRKKKKERMARRKRGEEVFSD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q783	Uncharacterized protein	1	32-67	ASEMVVHKTRRPHRKSRYGCTRCKVRRIKLEQILPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7I4	Uncharacterized protein	1	16-37	LEAASKVPAKRRQTNIKSTVEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q866	Uncharacterized protein	1	46-68	LGLRVYCKLSRRRRLWWDDNFLI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8S3	Uncharacterized protein	1	98-118	QLEAEKRKKEEERRRQAQAQY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAD9	CENP-V/GFA domain-containing protein	1	430-454	MEEWRIERKYPKSWRRVAQEQQEGM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCR8	Uncharacterized protein	2	26-47, 242-262	RDGRRCSHPEVRRYDRKFPFTR, DDDERRRQRREAKRRNSTSGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDE5	Uncharacterized protein	2	387-411, 537-556	PTAVGLRPWWRRRKGDKKRSVEDGP, FAAAVLRNRRRKNSVRGEEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDZ5	Uncharacterized protein	2	3-22, 35-60	QMNGGSRSRQRIRKPAPALD, RILNVLAQRRYRQRKREARLAARAES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEM4	Calpain catalytic domain-containing protein	1	35-58	AGKASYPADRKRFRRKCAELIALG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFD4	Peroxin/Ferlin domain-containing protein	1	510-531	GQDGWGRWTRRRKWYRDAELVE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG57	1,3-beta-glucanosyltransferase	2	185-207, 297-330	GGGGQHRRRRRRDADARGRVRRV, RPPWRQQLLQCRQQRQQRQQHASNKLRTPKERRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI11	Protein transport protein SEC24	1	38-60	ASTHHAPEHGKKKKRTYAAGAFE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ51	Zn(2)-C6 fungal-type domain-containing protein	1	3-30	GVPGRSKACITCRKRRKGCDLERPACSQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMF6	F-box domain-containing protein	1	198-222	QLRSPRVDWKRQYKIRHNWARGKCV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0C6	Uncharacterized protein	1	169-189	LELQKRKQKLIAENKKRRDDL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0M0	Pre-rRNA-processing protein IPI1	1	1-36	MGSSNKKKKEKKKDFQKPKLKVGKPKPKASNFTDTS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1A5	Rif1_N domain-containing protein	2	59-79, 1510-1537	DATTSTSRRARKKVGFSAQAE, MTSSQPRARVGRPKRKRATSKAQETGAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1F1	Deacetylase sirtuin-type domain-containing protein	2	9-34, 446-483	RVRTDEPPPPKRRRIAAPPKPRTTAY, LPSKPTQPSKKAPAKRKSRQPRREPTKPKNRLDQTFRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1S2	Uncharacterized protein	1	1152-1177	NWDWAAVPRPGRRRNNRRHQFWSLDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2H1	Uncharacterized protein	1	295-325	RADFERNRRGRAKKGRRRKRGGTWWTKGKGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2V2	Uncharacterized protein	1	425-445	SPEDRRVYNRRLRRSVQQSME
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2W0	Nuclear protein localization protein 4	1	143-168	DRLDKKDGKIPRKRDKMCRHGPKGMC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2W8	Uncharacterized protein	2	358-378, 446-469	DDSDSHRDKRQKKTGKPTMST, VCDICHRRFRRQEHLKRHYRSLHT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Z7	DNA polymerase delta subunit 3	1	360-385	AVSANGRRRGKRRVMRKKQIMDDQGY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3N5	Uncharacterized protein	1	35-56	QIPSAPRPRLKLRRRVVSQLSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3V3	Uncharacterized protein	1	702-726	GVDAGGKKKDKDKEKKKRNIFGLKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q644	Uncharacterized protein	1	245-273	ADAPPAPPAKKRGRPKKQATKPAAPVGRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Y8	Uncharacterized protein	2	2-31, 61-81	PGGKERAEERRENKRRPKEVQMRRTKEDPR, EAHRYRCRCRRTRAAPPHQAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8E9	SAE2 domain-containing protein	1	605-627	QDLADRYGRHRHRFARRPSPPGY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q933	Nucleolar protein 16	1	1-33	MGRELQKRKRRSSRPKIKMPNRRKKALNPLGND
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBP3	Uncharacterized protein	1	420-447	EDLGVEEDRRRRRRRRRLRRSSGDEGGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCZ2	Uncharacterized protein	1	350-369	QPAPKPRKEVAPPRKKLARV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE87	Iwr1 domain-containing protein	1	68-93	QTSRAGDENRRPKRPRQQGEPPVKDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEA2	Uncharacterized protein	1	22-61	PQSPTPSSSSQRHKKRRSSPSSTGQRRDKRRREVKAVIDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEJ3	W2 domain-containing protein	1	139-165	GFMLKHVPKKTKKDKAERRAARKAKQN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFY6	Uncharacterized protein	1	71-96	DLTCPVPRQRTARRRRRPTPDEYPDS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHG8	Uncharacterized protein	2	2-26, 298-326	PQDPNLYGQRPPKRQKKEMAISGSV, RTEALRREREEKARKRKQEIEERRKEILE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHX6	DNA polymerase kappa	1	589-615	RGMPGVQKAKGKKRGRPLALADPRQKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ1	FHA domain-containing protein	1	36-106	DESGKRVDRSRSRERDHRRRSRTPESRDRRSRSRDRERRRERDRDRHRDSRRQRSEERRDRRNREHDDDWK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKB9	Zn(2)-C6 fungal-type domain-containing protein	2	152-178, 182-213	EEALEHSKQKRPRGRPRKHPFVPNVVT, ITKGRSKTGCLTCRKRKKKCDEAKPRCMNCEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNX1	Uncharacterized protein	1	124-145	QSDSRHYQRSRSKSPRGRDSYR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQG9	Uncharacterized protein	1	245-265	HDPRRQFRVARPKRAPRRLTT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q077	Uncharacterized protein	2	250-276, 349-382	QVSRARSDRSRRSHRSHRTSASRRYRE, SSSVAGKPKEKKRDMIKQLFKMKKDKEDRGKAVS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0T6	Uncharacterized protein	3	296-317, 458-493, 702-729	LVPDREPHRRRHSQPRRYSSTS, LEEERRRRSRRQSSELKDYHRREKERERERDRDRDR, REGERLPRERNRDRDRDRDRDRERERER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1L3	Uncharacterized protein	1	310-339	ATVETLRRRLQQRKLQQQQQQQQQQRNVRI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q294	Uncharacterized protein	1	460-494	KAVEKDKAKKEKEKAKKKEKKKKKSRGKEDDEDDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2D3	Zn(2)-C6 fungal-type domain-containing protein	1	38-67	SSVPKPKRLACMICRKRKLKCDGIKPSCST
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q301	Carn_acyltransf domain-containing protein	1	117-139	VSYFYSHRDDRRRRDPAKRAAAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q368	MBOAT_2 domain-containing protein	1	386-410	RQHGRVHHHHHHHHHHHRHHNQSHT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5G3	Uncharacterized protein	2	135-154, 192-211	GACVWRRRYLRKKDRAYALN, SAAVYGEKPKKKKWTLKKRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q930	Uncharacterized protein	1	21-40	QLQKQKEAYKTKKRALHEDV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9D6	p-aminobenzoic acid synthase	1	593-613	NPLPSSPRKLQQKQRFQSQHN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAP8	Uncharacterized protein	1	268-287	EEAKRRMLEKQEKKKQELTN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAQ6	eIF2B_5 domain-containing protein	2	89-112, 121-144	GLDLSLMKKKKKKVKKDDDEAADG, AIDLSMKKKKKKKVPKEEDEFAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBV3	PHD-type domain-containing protein	3	295-319, 400-427, 886-907	LEDFARRIRAKKRQGRKDGKAFDYF, EPEPEPQLPPRKKRKSGRQQQQQQQQPE, EVTTTVKPPTRRKKNDEDQVPD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBX1	Autophagy-related protein 101	1	215-249	QSSSHQQRSQQQQQQQQQHQQQLQHRQQQQKKGAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBZ7	Zn(2)-C6 fungal-type domain-containing protein	1	9-38	GAAPSPACHNCRRRRLRCDRSLPSCRKCLG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC24	Uncharacterized protein	1	30-53	VASPDRCDRCRKARPNRPSMQCTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEW7	Uncharacterized protein	2	184-212, 389-415	DAAEKLERRRQKFERRRRRQKERSGEGAN, FSAFRDKDSQPSRRKKSRKSNGTAAST
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFZ6	Uncharacterized protein	2	188-211, 238-259	TFDSREKLKRHARWHTKNYQCPYD, ERCPRCDKAFTRKYNMQRHYRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG52	CUE domain-containing protein	2	301-320, 670-702	GGLTKPKRLIKRKIDKGKGI, SDLARRRKEANKGSRANHNRRDQRARKMARAGF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHV2	J domain-containing protein	2	232-254, 470-505	SAHEGKRKDKKHKSGLTKEQREQ, VAEAAMKKEKESKKKGKDKKDEKKEKGDRPGSKAWE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI70	Uncharacterized protein	2	41-66, 736-762	ATRTVATDRPARKRRKVDYRGADGEE, TRSDTHDTFKCKRCRPDGKQHIKAQAM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIK4	Uncharacterized protein	1	707-732	DTALAKARARARKKGREPPRREDVYY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKS5	CULLIN_2 domain-containing protein	1	673-694	SAIVRIMKARKRMKHQQLVSET
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0R7	Cation_ATPase_N domain-containing protein	1	1047-1067	WVDEARKWWRYRNGRRGFVGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q281	Glycosyltransferase family 62 protein	1	55-77	PPTSPFRKPTGDKQKQKPPPVAH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E6	BHLH domain-containing protein	1	274-293	TQEARRKRRRESHNLVERRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q578	Spindle pole body component	1	777-815	ANYNLSYHRHRHRHRRRSQSQSRSRSESRSRTRRDHARV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q601	Non-specific serine/threonine protein kinase	1	2411-2434	TLDLQNSKKRPQKGPPLNPTRVVE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q674	RNA_ligase domain-containing protein	1	575-601	GNGNNSNGNNNKKRKKNRRADAASALA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q771	Biotin carboxylase	1	2147-2167	WRNARRFFYWRVRRRLNEEYI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7N4	Zn(2)-C6 fungal-type domain-containing protein	1	2-41	ESARRVPRPRLYHTKSRTGCTRCRSRRVKCNEARPVCNNC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9E5	SNRNP27 domain-containing protein	2	27-46, 201-223	RGEFDRPDRDRQQRDRDGRS, VGAARKEKPTKYRQYMNRIGGFN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBM8	Uncharacterized protein	2	1-29, 41-79	MIGPEANAPKQRRRQQQLRSRQAGKQQPQ, AATQEPKKRAASQRQRRVTYQRPEQQQQKEQRQARPQGT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBZ9	Uncharacterized protein	4	44-68, 100-121, 256-275, 304-336	AQSETRSRRAHPRSSRTRTRDPSSE, GIRALVRRRKEAKKKKAAAAAA, RDWVRERQRKPRTEEAREVS, GRSHEQPEERPRHHRSRRRNESMQRARRPEPMC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC50	Smr domain-containing protein	2	203-224, 226-247	GVGHDRHHRQQKQQQHQQHYGE, TTGYHHQRPTQQHQQRPPQPEQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCD7	Uncharacterized protein	1	86-112	VPHHKEPPRYIRTRSSNKRTREFNRVF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEQ1	Pyr_redox_2 domain-containing protein	1	61-88	TSDAAPVPPPKKRRFRKLRWAWRFTYLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFL5	Uncharacterized protein	1	292-318	RQDVLPLRLRRHRRRRGARTDKRIVSL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFL9	RING-type domain-containing protein	4	45-70, 221-240, 473-497, 634-657	HPQAAPRKSQGARKQHRNQRRAGTKG, SDEPGKKQTRWRKCPICEDS, SFSEEIERRRKRNREKATQEERERL, AGSGGGGKKKKKQKITLMSTGGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHF2	Uncharacterized protein	3	32-54, 825-851, 928-947	IEEQKAKYHKYIKRLKRELVEES, TPENKEALSRHPKKRRRSRTAGSEDWA, LSATNPKRLSQRQTNVRTYG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHF6	mRNA cap guanine-N7 methyltransferase	1	10-57	PQPFDAKKLAPAKKRQRSQSPNRSGSAGTSGEPPRKLKRPGQRARITE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHF8	WD_REPEATS_REGION domain-containing protein	1	166-190	APAAQKDAGKRRKPKNNMTKSNSSF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIT7	Uncharacterized protein (Fragment)	1	137-158	GAPARQRSPKQLHVRRLWNRAY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL93	SUN domain-containing protein	1	193-222	DRNGTQPERRSPRKPQPRDVRKRARDDEDE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMA6	Uncharacterized protein	3	82-107, 337-371, 379-403	RDCIAPIRKTIKKRENKRLDYEKAQD, SLHHHHQQQQQRRQQQQPQKEKQQRQRQQQFLPTP, ATAVLGKKKPPPPPPPPKRAATNKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMH7	Septin-type G domain-containing protein	1	1-24	MFTAQKMIRRKKNVKKGIQFCLMV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN52	Uncharacterized protein	1	175-194	ATRAALLKKTGKKKSKCLIA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN76	Uncharacterized protein	1	114-136	ICAVCLFRFRKRKRAAIPYTPRI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ58	HSF_DOMAIN domain-containing protein	1	231-251	WLINKPKSGNSKKKGKKDEVD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ65	Uncharacterized protein	1	63-87	AAVIDAGRKDRRRRELDRKIAEAKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ74	UNC45-central domain-containing protein	1	155-176	PSLAPLMRRKWKSKKVETACLE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0D6	Tim44 domain-containing protein	1	131-152	EEEAGRKKKEKKDDLPPPPPHG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0S2	ATP pyrophosphate-lyase	1	429-450	TSPGHHHKRRFLGRLRGKRDKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0V6	Importin N-terminal domain-containing protein	1	82-101	DKYWRQTAKHAIKPENKQAI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1Y9	Autophagy-related protein 11	1	442-461	QEEEAKRRRKWYKSIGNTYG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q249	E3 ubiquitin-protein ligase	1	97-122	PTMSILRQPKRKPKTTAPKTAKPAGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2T2	Uncharacterized protein	1	468-492	AEYDNHGRRHPRNRRLRPATGQRYD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q377	Uncharacterized protein	1	2-21	SRVAKRSTKRSVKTEERIAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4N9	Uncharacterized protein	1	32-55	LLDGKPLPAKYRKNPPPPYTPEHR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5A4	Uncharacterized protein	1	824-847	KSGLKEFAKRETQRKRPARLTFYD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6A4	DNA replication licensing factor MCM7	2	58-86, 646-666	DDDAQQERRRQRVQKQQPRHKYREMLQQL, MVKTYVRLRNNQRRAEKRAAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6C6	Uncharacterized protein	1	313-337	ADEPRARARARRRSRSRANENHADT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Y5	RING-type domain-containing protein	1	188-209	ITRSITARLRRRKPSPDQPMPC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q966	Uncharacterized protein	4	274-309, 524-547, 876-907, 1120-1145	TEPALKPRPSRSRSKQPTGRPRGRPRKRPLETGNTS, TKAVVPRKKGRSQRQQQEQKQQLS, KDAARLNQPRRKREPKGKSKKSRTKSDNAPAN, RSASASKRRTPRSSSKIKNDNNSSHN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9D5	Uncharacterized protein	1	1482-1501	ALGKKERRMWHARRGCRLVV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBE5	Uncharacterized protein	1	76-99	SSLETPPTPPRRRRVQPTRRSLEP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEE0	BZIP domain-containing protein (Fragment)	2	60-84, 431-451	SVIERSCRSQCQRHQDQKREREKAA, GASARFRQRKKEREREQQEEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEL4	Uncharacterized protein	1	192-212	AVDWVRSRVKWNKESRPPLMR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH59	Uncharacterized protein	1	459-479	SSEGRRKRVPKPEQGRNSPAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJE2	Protein kinase domain-containing protein	1	83-106	LASLDTRLKRNQRREKHKVLQVLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKM0	Uncharacterized protein	1	29-49	GESTRKQPPPEKPSDVRRRSH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKM1	N-alpha-acetyltransferase 40	1	80-103	DYEKSTFKWQPKKKLKEMKSPGLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLN4	Uncharacterized protein	1	5-33	LSLPKQRDVKYNTHRRRKPFIEKGSRDVA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMM7	RRM domain-containing protein (Fragment)	1	65-88	SLSRTPSRSRTPSRSRTRSRSYSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN75	Uncharacterized protein	1	82-109	DGAEQQQQHHHRRRRRQQQQQQQGSRPD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPB9	Uncharacterized protein	1	7-27	LGTPWRTKRRGPKSRQFLVSH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPM6	tRNA(Ile)-2-lysyl-cytidine synthase (Fragment)	2	433-458, 682-707	NNAGGREKEKQRRPRRWLLARAPHPS, LSKLGGRRIGRREMRHRLRCLYRWVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPW1	Uncharacterized protein	1	81-104	SVLFYLHRRNVRKQRQEDLHDPHK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZK6	Uncharacterized protein	1	173-192	GEFAEPKKARKKPSKLDLSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZR8	Uncharacterized protein	1	309-338	ARLPSGSRPKRAKSKKSRRKPRVAARQSSV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q026	Uncharacterized protein	2	210-235, 343-393	EGEPTNPPKPKRRPMKPRRKWTEEET, PDPDAAPKKRKPRAHRKRLEDLAELGIHGPFEKSHRRKRRPFTKQDDEEIL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q035	Uncharacterized protein	2	30-55, 455-475	DEKVPYDVRRPPYRRRRWQLGMAMFI, LSSPRGNFRRRRKSTGFPGFT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0H6	Uncharacterized protein (Fragment)	1	27-48	AQQLPSKSPRKRKAEAPPENNE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2M4	Uncharacterized protein	1	206-231	ESLRRVSPPKPTRRRLVQGRRPRSAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q413	Uncharacterized protein	1	31-52	PTPQPGEKGRAKKVRKPHAIDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4U6	Uncharacterized protein	2	260-279, 691-711	IPPTIPPKTRRSKTVKPCTA, ADEFRPNRHTWRKQYHEPNDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5F8	J domain-containing protein	2	58-103, 420-439	EEINKAYKKKSRQLHPDKVRQQLTAERAKAQKEKNKQNKGKPGVHV, KSSGTQKPGGKASKRKNKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6T5	Uncharacterized protein	4	80-106, 153-179, 1166-1187, 1217-1244	APALKRATLQARRRRREGRREDAARTA, DELGMSKQERQKNRRFHKQDAYHLPEL, VAPPPAPKGGRKRKAKAVVVAE, EGARSKGKGKRTKSAARKGRGKKSRAEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6V9	Uncharacterized protein	2	230-254, 275-303	TETPPNPRDRDTRRRHRRSSSGGGG, SVPQPCCSSRRPRRYRYHHYHHRLRVLFF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7E7	Protein kinase domain-containing protein	1	57-79	DQHPIFGKKLKRRNDLQDLCRCI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7T3	Uncharacterized protein	2	422-447, 462-481	LGITLNRKGRGRPRKRANDGRADIRA, EGSVRKKDRKASKSLFQKLE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8B9	Asparagine synthase (glutamine-hydrolyzing)	1	77-97	IYNHRLIRKSLKKPYHFKTAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9P4	Uncharacterized protein	1	251-276	LGPLNCPYHKRNKVRFNVREHWKCTK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA21	CYCLIN domain-containing protein	2	338-358, 398-418	QITPLRKKLNKCRDPERWNLI, EPLAASRDNKRRKVQGNGTGL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEA1	Uncharacterized protein	2	205-230, 471-491	ANVDPAKKPPTRRKRKIPRSGTPAML, ASPAKTTLKKKIEQRNAKAGV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGL2	Uncharacterized protein	1	1-24	MESKWDHKNKNTYNHKNKNTYNTG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHU6	Uncharacterized protein	1	7-29	DWSGNAKRRDGPKQAPKQVVRNA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ58	Polyketide synthase	1	2156-2176	LGDYSRRHHHHHHHRQSPSAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKA2	USP domain-containing protein	1	839-863	AETQSSLFKRRKRKWDIKTRLSEMV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL38	TPR_REGION domain-containing protein	1	121-144	AEERRRAKGEKKRVKKAAEKPVSI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLV3	Tubulin-tyrosine ligase-like protein	1	252-277	PLVVDKSKNKNKSKSKRPRYVFKEGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPI0	Uncharacterized protein	1	34-72	AADNAHRTPKKRRKVNHACLYCRRSERPCTRCIKRNIGH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q074	Uncharacterized protein	1	372-393	HYLTRGKERPRKPENHRLRCIP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0N9	ENDO3c domain-containing protein	2	50-74, 504-523	SQVTKGTTKSKRGGKKQPQRVKGGW, GQVCFKCRKATKPGTRDWNE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q166	RING-type domain-containing protein	1	164-183	WDAVSRKRPRAQPKTPDDGT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E0	Uncharacterized protein	1	50-72	GDDGGDKPRKRGRPMKPRTSGGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3N3	Uncharacterized protein	1	180-199	ICKECSKRFEKKPSCSKRAC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5I9	Uncharacterized protein	3	156-177, 281-303, 366-386	APGPGRGKKKKDQKLDPNDPSS, DSDQNNPKKKKIKPNSLTKKVIL, AAKPRLPSPAGKKVKKDRDLE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5Q7	Uncharacterized protein	1	65-91	AEQVPGTSRRQQQRRRRQPPWPLFTPE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M2	Protection of telomeres protein 1	2	347-372, 388-410	LKEAIRRCRDYHKKKRQQIKAIKAAE, DLPPNSKERRKQKRTAKEQSESE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8H7	Uncharacterized protein	1	48-69	PENEKAPKRPGLRRNHPSVPPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8X8	Fe2OG dioxygenase domain-containing protein	1	54-76	RDSKSEAKAAKRRRVSRHFGYHF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAF8	Uncharacterized protein	1	470-490	CPTRLRCTKCKQLGHQKKDCS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBI0	Carboxypeptidase	1	81-106	AFKNPSWFSKPKPHRRRDDWDHVVKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD01	Rho-GAP domain-containing protein	3	16-41, 702-729, 788-816	SQQQQQPPPQQQQQQQQQQQQQQQQQ, VPDTPNEKEKKRRWRLSRKKEDASPPSY, ESNKISSWIKNKYREHKENVEQRRNKSPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE77	DUF2040 domain-containing protein	1	60-88	PSAPSDTPDRRKKPTSKPLKPPQPPVTAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH68	CYCLIN domain-containing protein	2	212-237, 376-398	HIEMQKEQRRRRQKREQEMRERKLEE, QQQQSRGRMHHHHHHHHHHQPQV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHD7	Uncharacterized protein (Fragment)	1	26-56	VSPRHFTRIEREREKRHRKFRFRRYESDTQI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK23	HUN domain-containing protein	4	71-94, 97-129, 524-547, 627-649	AAGLPRKKPGRKPGSTVKPKPPAD, SNTTNGDAPKQRRPRKPKDPNAPPVQRKRKAAA, TGTGAPAKPAKKKRNFKEDEYDKD, GTVRKPRITKLEKEQRDREKAER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK86	BAH domain-containing protein	1	2035-2057	ANINTIRKRRLSQRQQAAPEARS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK89	RING-type domain-containing protein	1	367-393	RGAHASPVGKRKRRASGKPREGRVSRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMB8	Uncharacterized protein	3	31-64, 104-123, 190-219	ERCPGERRTKGASPKRKRSPRPRPRGAARCTCGA, TAPGCHSKERHRVDKPKATG, RPSRRFSKESPPRPRHHKRHTDVHRTHQSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN19	RING-type domain-containing protein	1	516-535	QPQPQPQQQQQQQQQQQQQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN60	Uncharacterized protein	1	4-31	SLPLHPSSSQRNRDSRNHFKNNNQGTSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNA8	Zn(2)-C6 fungal-type domain-containing protein	1	19-56	NNQGQPPSKRRRINAACLTCRKRKTRCAGEKPDCSTCK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ17	PseudoU_synth_1 domain-containing protein	2	17-37, 56-87	ERQPQQQQQQQQQQQQQQQQQ, APPAGPNPYPPKEKKKKAKKASKIDPSKYSTR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQH1	DNA-directed RNA polymerase subunit	3	325-345, 1357-1380, 1482-1503	AVKTRRSKSKAAKPAQRYLST, LLSALTRKEIKKKQKQNSAATPEI, EGRSRSREARIKNKNEHVARFR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q114	Uncharacterized protein	1	33-52	RPPFYTRPRTPPRPNPPPTN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q165	Valyl-tRNA synthetase	1	19-60	AVDPGTVKKNEKKEKAKADKAAKFAAKQEKLKQQQPKKDAAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2T4	Dolichyl-diphosphooligosaccharide--protein glycotransferase	1	725-750	AAFDRGHKKKSKGITKKKGPRQLRID
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q366	Uncharacterized protein	2	2-21, 702-721	TPPASQCRRALQRQIVPSKD, AWSCRLALRRWRARLMQKLV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3G3	Uncharacterized protein	1	119-147	TAVPAPETEKPKKKKKKERTFFKHLTPKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q539	Polynucleotide adenylyltransferase	2	875-894, 927-950	GPPARQQQQQQQQQQQQQQS, ESFGGWQKSKSRKKGVSDLKHAAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q585	RRN7-type domain-containing protein	1	54-76	KTGSVARKKKEARHADRKHLTGN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5C3	Uncharacterized protein	1	229-281	VLDNRKKKAKSGKGEIKKGSKAWIIKKKEQMERKGKIVKATSKYTGRKRRPQF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Q9	Uncharacterized protein	1	1185-1211	VGDAMDKMLRRRRRRFRWVRRAGWLVV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q867	60S ribosomal protein L36	1	65-88	ELLRNSKDKRARKLAKKKLGTFGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8J7	Uncharacterized protein	1	152-174	DEEEEEKKKKKKEEKEGLRTGED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8R9	Splicing factor YJU2	1	277-304	VAQPPPPPSFKRQVKKKKDHAALLGIKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB08	Uncharacterized protein	2	117-142, 1319-1347	FVQSDIVKTRRRRLRKGTATVRRSAP, NNKALAQKPPGKRGRPRKHPEPAGQHQAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC35	DUF4604 domain-containing protein	1	184-209	GSAATVKAKAKKKAKKIKLSFGDDEG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC44	Uncharacterized protein	1	120-142	LSIKKLRTKTYANQRRRNRESFA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCH1	Protein kinase domain-containing protein	4	14-39, 118-146, 256-276, 689-711	YNPHHFRYSHHQHQHQHQHQHQHQPQ, PAAQPRAEQQPPRKRRRSREPDWKAFYKN, PASQRRKRTTRQQIANEARRR, RIRAEKLKLREQREREQRERELS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT0	SRP40_C domain-containing protein	2	47-71, 447-476	SDAHRAFTKQRAKKGWKSEKSDVAG, LSVTRGKGFTKEKNKKKKGSYRGGRIDTNA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI71	Glycosyltransferase family 24 protein	3	194-214, 1241-1264, 1418-1437	EGTYRVRYKRNPAQRREALSV, MVTYKWPHWLRQQKEKQREIWGYK, CNNPQTKEPKLDRARRQVPE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIJ6	HET domain-containing protein	1	39-62	VEAFARYRRSRREHARHMQKAGFS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL57	Uncharacterized protein	4	25-46, 386-411, 605-630, 816-839	LAGTRRCPGARRRRARTASTLV, EEEENNKKKQKTKTKRRLRREAAAAA, ACLGVCWFRRRRQRRRSRDETLRGLS, SGSPTPPAAQRKKQQQQPAEETKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLC7	Uncharacterized protein	1	295-315	AARKRALAYRMKQKRAREFRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLX2	GPN-loop GTPase	1	299-324	LDRLRAEKEENKRKQREKELEKMMKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPU6	Uncharacterized protein	1	570-598	AEEIRRRNRAARRAQKRQRGQAGNKNNNS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZZ8	Uncharacterized protein	1	163-185	PDERQKPMSRAERRRRIRAEIMR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q158	Uncharacterized protein	4	100-122, 139-162, 172-193, 289-308	EQSRDRSRDRDHRRGRHGTRQDD, PDGGGRRRRRDRSCSPQQRAHKQR, EDDRPRHSRSRRKESTRDRDII, EAYRDRQKWKQQGAERLRAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2L7	Uncharacterized protein	1	449-471	KFTHIKTPCKYRPCTNRNCPFMH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Z5	Zn(2)-C6 fungal-type domain-containing protein	2	79-103, 262-283	AFQIECRIPQPKRKKAQGAVVPTRD, PVINKTKFMRRYKDPKNPPSLL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q343	TRP_N domain-containing protein	1	611-637	AFIACFKMNPHRKRRKELEKLQQRDTL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q460	Uncharacterized protein	1	243-267	TYTPRMAPAPKGKRRKLDPDTAVKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4D8	G-patch domain-containing protein	1	198-225	PPPPGEKQREEEKKKKKAQLLDAKKVRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4U4	Polynucleotide adenylyltransferase	3	12-42, 1145-1169, 1234-1253	PSPASPSSSVPQRRRQQRQQQPQQQPQPALP, GHEELAKKEKKKKGSASKKQIAAVD, LYFRRKSDGRLVWDRRRRLD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q635	Ubiquitin-like domain-containing protein (Fragment)	3	9-41, 73-94, 398-417	EIPAQPKKKALPFKRTVARKQQSQKPQQPSEEA, QENHDRKRRKLSSPPDDPQRSH, PAPAQQRKKKGIRIVLKAKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q696	DNA helicase	1	13-35	ATPSRATRSSQQQQQQQQQQQQS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Z7	Uncharacterized protein	1	569-589	PPPIPPRSKLRPEPLRIWRPN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q811	Rab-GAP TBC domain-containing protein	1	84-106	PSLSNMKRRSQKKAELSRAQTED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8J1	Uncharacterized protein	1	127-155	GFLARKRSRTGRNILKRRMAKGRKKLSHG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q931	Flavin_Reduct domain-containing protein	1	1-22	MGLKKRRRTSNAKSKSLPKATK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9C6	Protein kinase domain-containing protein	2	471-500, 507-550	SYDRDGPRRDDRRPPPPPRRDDRDVRRHDW, YDDRSRNSRTRSRSRSPIRDWDRDRDRERDRDRDRDRDRDRDRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBC9	Usp domain-containing protein	1	176-201	VVVRPDDKRLKKKEKRSQDPTRQSYA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBE2	Uncharacterized protein	1	1-22	MLRSCRPTRLLTRPRQPWNTLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBV2	Peptidase_M24 domain-containing protein	1	378-411	LEQPLARNTGKNKNKKKKKKKPAKKEAKEEESEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC57	Uncharacterized protein	1	16-72	TPATRKTSLAPERKYKCQFCNRAFSRSEHRSRHERSHTKERPFKCMKCRSTFVRRDL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEG2	Phospholipid-transporting ATPase	1	1298-1323	MEQFQKAIRKVRQVQRMRKQRGYAFS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFC5	Uncharacterized protein	1	236-257	VLKSAVKKARQQQQQQQQQPEQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFX6	Tyrosine--tRNA ligase	1	341-370	EIAEKAYPPPPKKEKKVKNKGTRYPGAGKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG35	Uncharacterized protein (Fragment)	1	11-41	GPMPKVPKLLKGSKKRPKKRHPPPVATDAAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM74	Zn(2)-C6 fungal-type domain-containing protein	1	223-245	QRTSIACRYCRKRKIRCSGYAHT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q019	Uncharacterized protein	1	6-28	STDGPRRTTQRLSKPRTGNHATP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q187	RING-type domain-containing protein	1	478-500	KPETRGSQRSQPQPRPDNRPDTD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3N2	Uncharacterized protein	1	206-230	GSPPAAPDKRKRKSWFPGVRLRANS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3V8	Uncharacterized protein	1	1168-1187	RTAAQYRKDRRQRDLEAQRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q451	Uncharacterized protein	2	315-340, 365-386	RVSSSAQKKHKCKVCDKRFTRPSSLQ, VVSNLRRHKKVHKRGGETPSDT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4E2	Methylsterol monooxygenase	1	284-306	AGEEASKRRREKKLAELRAKKVQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q553	Uncharacterized protein	1	5-36	GPTARRRNHAWLQMRNRLRRSEQLARRQQQDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5P7	Uncharacterized protein	1	773-801	REEARKVKEKLREEKRAARRRLRDEAGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6L0	Ribonuclease P protein subunit	1	45-78	PPPSDARAARRRAREKKKQQRKKALKPKPLSATQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7W4	Uncharacterized protein	1	1183-1203	RLYREQQKEVRRRQQEEKEKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8K2	WD_REPEATS_REGION domain-containing protein	1	169-191	EGTSERKSKKGSRKGQNDQSEAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA65	Zn(2)-C6 fungal-type domain-containing protein	1	57-83	IRESNKYQFKFGKRQRWVKTPRRLVFI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAH7	Transcription elongation factor Spt6	2	71-100, 110-141	EEEADDSERERRKKKKRRRIEREEEEQLDE, NPEWERKTQTQTKFKRLKRGHRDEDRGNERPD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD93	Glycoside hydrolase family 1 protein	1	448-472	VDYANDQKRYPKKSAKSLKPLFDSL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE26	ING domain-containing protein	1	440-462	NAPATKAKAQRKRKRDSAPETET
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEP6	Uncharacterized protein	2	411-430, 599-623	KTRNPIRSAMKRRKTKNVQF, DGVFGKDDKKKRKEKDKDKKSGGLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV7	Uncharacterized protein	3	35-57, 236-255, 403-426	YEPYSPRKSKRIAQRAANRTPSP, QKPPAPPEPPRRRSKRNTVT, AELTPKPPKPPAKRSPFDSWRRVK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF17	Usp domain-containing protein	1	650-679	SSVPVMVARKRLRKQSKYKHLPSTNQINNI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF63	S5A_REDUCTASE domain-containing protein	3	59-79, 335-357, 429-452	TTYLDDKKKPAKKAHLAVRIV, WQLTKWRLDKYRKRHDEVFCRRG, DKMYMERKDYRDWRRNRTFRLWLD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHY7	Histone H2B	1	27-52	AGKKTAPSGDKKKRSKARKETYSSYI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIF5	Uncharacterized protein (Fragment)	1	278-299	FATATGKKSHKSHKDNNTWIEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ48	Uncharacterized protein	1	67-89	GQTTNFRRWRVRRQFGKGKGKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKB1	PIPK domain-containing protein	1	305-330	RWAEAYRQKRASKRRRRELEDDDRVL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKB5	Uncharacterized protein	1	245-268	DEDATLRRRHKDVRKRRSSCNTSD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL63	Uncharacterized protein	1	383-403	ASDKKRKKLTAGAKSRPPRVE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QML5	Uncharacterized protein	1	140-161	YDVVYVRPRRPKPIRRPPEYDP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN33	SPX domain-containing protein	1	136-161	YTGFLKIVKKHDRKRGDRYKIRPMMM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNE0	Uncharacterized protein	1	122-148	IEGANGEKRKRKDRTRGSPTNGWRERP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNQ2	Uncharacterized protein (Fragment)	1	40-61	TLEKSQPETRRQKQKGRDSSYC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQE9	ULP_PROTEASE domain-containing protein	3	35-55, 140-165, 249-268	GDSARVARRRRSSRTPVDTDL, VTAIRSRPTRSPRRTAPPKTPARYTR, GSENKKLRVLQKKDDHRWHC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J5	Uncharacterized protein	1	388-410	ARRPEPEREDRDRDRDRNRHHRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2S9	Uncharacterized protein	2	210-255, 262-289	GGAGRDDEPKKKKKKRYGPKGPNPLSVKKPKKKTPAVPPPKPKATA, GTIEAPTEKKAKRKRRKKSKGGMGSGES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q321	Uncharacterized protein	1	147-166	SSDRSRSRSRSRSRSRSSSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q370	Cell division control protein	2	18-44, 579-601	PPLSLDYSSKRPRRTPRKLSGKEDTSI, GATTPGTPKRTRRKKDVFFGGFG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q392	Uncharacterized protein	1	153-178	ITNAAMLKKKPKRGLNPKHERRSSIE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4I7	Uncharacterized protein	1	71-90	VLAHGPGRRRWRRRIRGGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4V1	Uncharacterized protein	1	6-32	NRKGEKAQGEGRRKKKEKKTYNTEDSL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5L1	Nicotinate-nucleotide pyrophosphorylase [carboxylating]	1	237-256	KATSRSLKEKWKGKKQFLLE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Q6	MICOS complex subunit MIC60	1	111-133	MPPPPVPPRKKGFFRRLRNFVLT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6S2	Uncharacterized protein	2	92-119, 166-186	TDQYPPELIEKRRRRRSRAQEQDAEYAS, RQDSQKENEGRRNQKNQPSDH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7F5	Protein FYV4, mitochondrial	1	217-236	RAEIRFKRRVAERKALREAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q803	Uncharacterized protein	2	51-75, 911-941	GEIRMPQKGTKRRAVSKGKRSAGKG, PTTTGGNKSNNNKKKRRSNPWRMHYRFNPPE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8L8	Thioredoxin domain-containing protein	1	3-23	MELRKRKEAPAPPPPVRRKMT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAA7	Elongator complex protein 3	1	53-75	NLNTLRSKFAKKHKINNVPPLTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAF9	Uncharacterized protein	2	508-538, 571-599	ASEGFSTKLKKRRVRRRPRQHQKEEEAPKHQ, ISDRHSSSRDSHRRHRHHRRHRSDEGAET
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB46	Uncharacterized protein	1	147-168	FPNSAAPRAGRRRKERECSQAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC51	Uncharacterized protein (Fragment)	1	38-60	LPSRQPAPPGRHKHRQQEEDDRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCB4	Uncharacterized protein	1	419-440	FGPGKHHKKTGRRRMRSGREAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCR5	Uncharacterized protein	1	427-448	LALRHKVRKTRCNSGLRCRDVS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDD1	Zn(2)-C6 fungal-type domain-containing protein	1	23-49	PGAACEECRKRKLRCDRQRPQCGTCAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDT4	YL1_C domain-containing protein	1	118-172	LERQARAKRAAERKRKAQDAIPARFRKKVRIEQPAPRPPRPKKKSERLSWLPSPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDV8	SWR1-complex protein 5	1	71-95	EAIIEKGKKRLKKSKKQDDEQADED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEF7	Uncharacterized protein	1	197-223	FSQSSRRHHHHRSPSRSHSRRRPPGPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFI9	Helicase ATP-binding domain-containing protein	1	136-168	VPALDRHLKQQQPKEGKRRATKKQGSGKRTTSD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHC2	AMP-binding domain-containing protein	1	73-97	AIGSRKLIKIHKEKKKVPKIVDGQT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT4	Uncharacterized protein	1	140-159	EKAERKIAAKQKKKTFKTVE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK24	Uncharacterized protein	1	33-55	GFPAHKKRVSAFKQQRQKKPAGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK52	acidPPc domain-containing protein	1	32-55	QLNPIPHKYRSARKLRLHLRVSRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKJ9	Protein kinase domain-containing protein	1	344-374	TLLIEKEERKQRRRERKRKEREMENRSSRRF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN82	Uncharacterized protein	2	46-72, 89-109	LDLKKDKYIRQPKPKAARKTAKKTAKA, KAPKARSKGATKGKGRPKKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNT9	Uncharacterized protein	1	61-80	VKKLVRRQWISNRKRKRGEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP56	BZIP domain-containing protein	1	213-234	AASARFRIKKKQREQALERSAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ76	Acetyl-coenzyme A synthetase	1	17-38	VDTYHPPKKMLEKHPSKPHLSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ91	DDB1- and CUL4-associated factor 13	2	380-407, 412-446	ERYSHMPEIRRIRRHRHLPKVVKKASEI, LAAIKRREENERKHSNKKFEKRKSEREKAIIAKQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQB3	Uncharacterized protein	1	226-246	SEGHKPAPSRRTKRKALEDAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1G9	Chitin synthase	3	12-35, 64-86, 164-183	SYEERHSYRHSQSRRQSRPADLEA, IDPPFQRKRSLVRPERNRIGKDH, AKHGKISKDLKSKRQREVDE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J7	Palmitoyltransferase	1	83-111	PLGPKATEKSTKTKRRRRREQDLETAQRY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1N0	Uncharacterized protein	1	65-88	RTRGTWSSSKRPRTRSSRGPPSFS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E0	Nop domain-containing protein	1	405-428	PAPDDKPSRKRGGRRARKAKEATA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4F3	DUF1713 domain-containing protein	1	315-350	MQAISVKRQRKLKMKKKKYKKLMRKTRNIRRKLDRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4I0	Uncharacterized protein	2	2-21, 72-93	VNIPKTRKTFCKGSQCNKHT, LECSQCKTKKQLPLKRCKHFEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5B1	Uncharacterized protein	1	299-318	EEEKKKKKGGYKPVPFPPRV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5H5	Uncharacterized protein	1	103-128	EQQQEQQSTKKKKRPPRQARGRLFLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5Q8	Uncharacterized protein	2	20-43, 686-711	VEETPKPKYYFPRHVKRQFTNDTI, VVMFVVARRYKRKKQAHRRASSISNP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5Z2	Uncharacterized protein	1	13-38	DDSEPSQSSSKRRREQQSLRPKQVEG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Q9	Uncharacterized protein	1	349-375	LGDYSMHGKKRVKKGKWKNGLEQFDEI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7R9	Uncharacterized protein	2	305-327, 834-857	AAEQRKKDMARQAKKSRKGPAGK, QVPGDKGPAKKKKQKKGGLMQAEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8F1	Glycosyltransferase family 8 protein	1	345-372	VHYILTPKPWEKKQKKKEEETKVKAKAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8W2	Uncharacterized protein	1	55-81	QDPPALQSKGRKRKQRIEPGAARERRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q993	Zn(2)-C6 fungal-type domain-containing protein	1	10-39	APQRKRIAVACGRCRKRKIRCSGDPGQGQP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAX1	Cytochrome-b5 reductase	1	42-64	LEEPRQPEPRRRRASTRLIAQSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBI5	CCHC-type domain-containing protein	1	246-266	AQQLAGKRRKKEIKLNQLTSI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD00	MFS domain-containing protein	1	466-485	AITWENKKRSKQVHDLNLTE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDN8	Rho-GAP domain-containing protein	1	585-611	GVILDNKGKDQKKKPVRRNVQPTLALA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH92	Uncharacterized protein	1	177-203	NNEAAKRSIERPKKRWRRDYEGRYAFG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIW4	Uncharacterized protein	1	477-496	VVPGKTKDKKDKTRSTGPKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKC1	Uncharacterized protein	1	424-443	DEKESKMKRLKKVLSFSKLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZS2	Trehalase	1	670-693	AWTKMFGRSKLRRREAEDVRKRWS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q220	PHD-type domain-containing protein	2	214-250, 377-403	KVPPSERKTKKTKLPPSSRGPGVKRKRTKSQANQDDD, CAPCMEKREREKHHHHHHHNNNKRQKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H3	J domain-containing protein	1	217-236	GGGSGDGPEKKKKKKLKPIG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3M0	C2H2-type domain-containing protein	3	29-58, 128-153, 459-480	GDSFYRNGRSPDRSRRRSRSPPAVDRYEPR, KEEKERLKSGRRREPERPRGPREAQE, VPVTSVKRPKKQRERTITLDQS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3N4	Ppx-GppA domain-containing protein	1	574-594	HETFRGLKKHRRSGREVSVTV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Q8	Uncharacterized protein	1	147-175	ALLPQHHRLRRPRRPRRRHLVRRRSGTPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3X4	Zn(2)-C6 fungal-type domain-containing protein	2	5-25, 78-104	ESREPRSPDLQPSKRPRQSSP, FRNVSACNRCRLRKNRCDQKLPSCASC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4S9	Sister chromatid cohesion protein	2	38-58, 1697-1748	QSAPAVQKPAQPKKQPNSISS, QLPSSSGRGRKRKAQHGGAAGPKKKMARSGSQQPRKRGRPRKQSADAQLQAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X4	Uncharacterized protein	3	540-565, 665-684, 700-724	EKEEEKEKKEKEKKKEKEEERETQET, RPTSGSKKRRRNAEEEEERE, QPGEPATPPRWRRPQRREDETDDRM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X8	Zn(2)-C6 fungal-type domain-containing protein	2	48-77, 674-702	SKRECIFKTGPRTRRPRQLNKRLNNQPAAP, KSKYRERVARLERKQQQQQQQQQQQQKEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7E6	Glycoside hydrolase family 28 protein	1	349-370	LPQTCNCNNNNNNNNNNRKRGN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9F4	Chromo domain-containing protein	1	1-28	MTKRSPAKSTKQKRRGRAAPRSATREQT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBU3	Calponin-homology (CH) domain-containing protein	1	417-436	GDEKKKARSRSRSRPAQPVS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCD1	Oxidored_q6 domain-containing protein	1	102-121	IFQLQRKMRRTKITRMWYRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCG8	HABP4_PAI-RBP1 domain-containing protein	1	211-232	VPSTGGKTKRERERKAKQYIEI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV5	Calcium-transporting ATPase	2	273-293, 364-383	NEPFSSRKRVFRDNRLPVKKG, QKERQFARLNKKKQDRLVKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG60	Uncharacterized protein	1	63-86	WERSLDRLRAKRCRRLNIRATSGV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ93	Uncharacterized protein	1	108-127	DDNPSPKKRARTNKSSKSAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK70	Component of oligomeric Golgi complex 3	1	82-109	VRAQLAVHAPKKKRKRRRSDRSWEALAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPY6	MFS domain-containing protein	1	103-122	GSLKKRHHGGRSSKRVRYSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQF7	Uncharacterized protein	1	241-266	IGLFFFLRWRRKKRLKKAPSDIPPPV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW3	AP_endonuc_2 domain-containing protein	2	74-98, 448-477	SRESQETKKKPAAKKRKTANTTTAN, AEKDARKGAKRGPKAKGKGKGNKKDEDSYT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Q5	Uncharacterized protein	1	214-243	AQQATPVRRRPPPPKRKAKGPGRGRRKGKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0S7	Ubiquitin carboxyl-terminal hydrolase	1	850-876	VSQLRRTPDKHDREKDRDGKENQNQKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1F0	CDH1-like protein	6	128-149, 156-184, 197-221, 1360-1401, 1411-1435, 1589-1656	ELYGLRRSSRPSQRRKVVESDG, SDVTPARRKSSNKRRRLERSQPTSKRGTP, TYGGAKARSFRKKVRRQQELQPTLA, SPAPPMSKKPSQHRDRDHHRSYSNANDRSTPRPDKRKYNDDY, LEAEGRQEKKPKDKERPKMDPETME, ASDREERRPRDPYRDDRREERREERRDERRDDRREEPRRRNYYEDGDRLNFYRHRRPENNRNVPLRHP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1P1	Palmitoyltransferase PFA4	1	109-130	LRPTRFCKKCDAPKPLRAHHCR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1V3	Nuclear pore complex protein	1	79-105	DSYYTYTRRRADRLRERQPRERSVRGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4F2	Uncharacterized protein	1	29-52	PIPIRRTPVRRTRRTCPCPGPRPE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4U8	Phosphatidylinositol 4-kinase	3	66-90, 100-123, 312-339	IHDPSRSGGRHRRRGRRNSGVDLKA, DEIASKFKRSRGKKKGEEEHLEIH, YLSGFRTTDPHRKRKRRWADSCRPSSAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X3	Uncharacterized protein	1	255-276	APPAQPSRPRAPQKPDPFQERI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q658	Uncharacterized protein	1	672-691	FATHQHRKKKWSQAAACMIA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6V8	Transcription initiation factor TFIID subunit 2	4	700-720, 1222-1241, 1358-1387, 1504-1523	IAYNTKYKRMKRTKKATAAAA, KRCVVRFTTHYRTKPRHKLL, QLNGTARPAEKRPKPPKKRKSDDGDGVDRP, VETGEPKKKIIKLKFKPASH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6W2	Uncharacterized protein	1	61-87	VRAVPPPYYYRRRPRRRPSPGDEPEEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9C0	Uncharacterized protein	1	887-908	IQRNWRSRRQLRSWRDYRRKVI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9Q3	Structure-specific endonuclease subunit SLX1	1	295-319	GQKEVEKLLKHRSRRRRAAATATKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAR0	DUF1279 domain-containing protein	1	21-40	APLPKPRRPFHSTRPRRADS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEF3	STE like transcription factor	1	417-436	EGSPTYKQRRRRSSIPPSLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEZ6	Cytoplasmic tRNA 2-thiolation protein 1	1	5-32	LCANCKTERALIKRPKNHAKLCKACFIR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHN2	Drf_GBD domain-containing protein	3	156-180, 279-298, 428-449	RDSSKPPKSRDTSPTKPKKAKSATN, LDNKKPRPKSFQPHIGRRDD, ENSMGSRAKKDKKRHSRGLSLT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI76	Uncharacterized protein	1	193-212	LKTARRPKYLRSRMGSQRSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJT3	Protein kinase domain-containing protein	1	257-277	KAQMRRRSRGRAERPQVQRRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLQ0	Zn(2)-C6 fungal-type domain-containing protein	2	8-32, 396-415	RSGCQICKLRRLRCDETKPGCRNCA, GKALALCRRSRNRWRLSGAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLQ8	R3H-assoc domain-containing protein	3	129-149, 204-232, 398-421	ITPPRRPPSRRDSMRRRDALL, LRERAEAEKQRRRQKQKRNTEQQQQQQPE, YVGVKQKQKQAALRQKPPNRPLLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLW2	CYCLIN domain-containing protein	1	418-443	WPGHHHRSNRHGHPSDRHRSRRGHGY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN47	Protein GET1	1	182-207	LIAASRQSQRHKQKPMQKDRQPVPAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNV3	Uncharacterized protein	1	598-620	ADPSARRQQQQQQQQQQQQQQST
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP90	Uncharacterized protein	1	128-147	FSSHNPTRPTKRGQNRPGEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZK0	Uncharacterized protein	1	43-68	AAAPDTHHHRRRHHHHHRHRHHLLGN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW1	Uncharacterized protein	2	559-586, 654-683	KKEEEKKEEKEKEKEKEEKKEERKEEED, QRVTAHKSPRRTSTPRPRSQNRQQVGKANG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0V4	Uncharacterized protein	1	846-871	NTYEGKRSRPWSQRITREKRDKGEVP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q124	FAD-binding FR-type domain-containing protein	1	62-81	LLYAPLWRKRHNREIRLSSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2C2	PHD domain-containing protein	2	186-218, 747-766	RLTDAPPPPPKPKKNTKKFRAAQRSSKRRRVAT, LSPTKHSPPAPRRPQQHVNG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3S3	Uncharacterized protein	1	92-113	STSPLKSRTRAGTQKKRKAAAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4J9	Zn(2)-C6 fungal-type domain-containing protein	2	9-35, 53-85	RSAGGCWTCRLRRKKCDEARPICKGCV, GGEKQKQKADWLKREVKRKAAHRRERRYLQGLE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5F4	Uncharacterized protein	1	156-177	GGKEGHKTRRRRRPTTTIIRIQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6E9	Choline_kin_N domain-containing protein	2	133-162, 203-228	WLEREKVKQASRRSRRSRLRGKTPHNDVSI, LTQPLPRLGRRHRKRSSRNLARAASS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q757	Zn(2)-C6 fungal-type domain-containing protein	1	13-37	GGACVRCRKGKTKCVYENGRSPCKN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7S6	Uncharacterized protein	2	44-73, 283-306	QERALRERESRYQKHRRSKAKQAIRVKMGH, GEQGEQPPTKKRKKTNEGRAEPMM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9C4	Cation-transporting ATPase	1	1317-1343	IGKLKVSVFKRTKVRKQYKVIQEQMLF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAN4	Protein kinase domain-containing protein	1	291-310	ARGRYDQKRRRWRALRVLGQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAZ2	Uncharacterized protein	1	293-324	RRAGCVTRDPRRVERKKHGRVKARKRPTWVKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBB2	3'-5' exonuclease domain-containing protein	1	121-142	TDTVEKPKPKPKPKHSSTPDAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBQ4	E3 ubiquitin protein ligase	1	624-644	KEISKECHKWKVKSQSNSSEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC32	Uncharacterized protein	1	133-152	PEPARVPKPCLKRRRPVTDV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE22	MI domain-containing protein	7	18-46, 68-136, 701-725, 759-786, 847-871, 884-911, 989-1014	DDRSPSPVDRRRSPSPRRGRSLSRDSRAS, RSPSARSPSPPPPRRRSPSPRDRSRPRSHDRSPARSPPRRRYPPPARRDADRYRPPKKERTPPPAAPAK, RSRSPSRSPSRSRSRTPRRAIDRGR, SRSPSLSRSRSRSRSRSRSPVRRRAAAR, YSRSVSRSRSPSRSRSPPRSPSPVA, GSYSPSPPPARRQRRYSRSRSRSVERGG, NGGYRDRGRGRGRSRSPRSPARSPAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHG3	SP-RING-type domain-containing protein	1	389-413	VGKSVNVKKEKDRSRRRMEEIDADD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJH1	Uncharacterized protein	1	51-95	TVSASRQKQSKRDEAIRRKMENDLSKKKHLTTRARQSRKAPPGTV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJU6	Methionine aminopeptidase	1	40-59	QECFKKNWATHKNIHKQENK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJW5	DNA mismatch repair protein	3	142-166, 190-217, 267-291	EIFATLKARRSRQRRPRATVADEDD, SDDSDAPSRTKKRKRGAVKPTGPRKKAN, VPPTQKPSGPKPKPKAHTKEPEERY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKJ8	C2 domain-containing protein	2	23-54, 634-658	KPPQPRAINRIRDKLKTKKGKLADRKEQLKEM, LTGPEGIWKRRMKRIKNSGGGRGGQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKV7	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase	2	908-928, 1074-1095	QIKPMFRKKTGSKNAKSSREQ, MDKVKKKLKGLLRKGNERPPQF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKX7	Uncharacterized protein	1	198-224	PAPSPVHAARKRKRRRRQGKSELSVPN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMH5	RRM domain-containing protein	2	191-226, 273-347	EEALRREKRRLEKEDRKHRDKERHRHRAHHSRRHDS, EGEGRRGERDRERRDDRRRREDRGDDNHRKHRDDHRRRHRDESRDPGERRHRDLEDRRRRDRERSRSRSPRSRRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY4	Uncharacterized protein	1	162-185	EEEVVGRCRRPRRRRTGTATTSGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNU5	Uncharacterized protein	2	617-640, 954-974	GGRAKKPKAHHHHHHHHHHHHHNL, ASQSRLRGKARRERIRKALEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP51	Uncharacterized protein	3	607-626, 647-675, 1746-1765	VVNRRRKSTNSRPSRRSARA, TEIKRPRTSPSKNPTPKRRRTLHRSDISY, YETMVKKKCARVKKLDGLVL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR6	Bms1-type G domain-containing protein	2	9-38, 55-80	HHHSHRPTTKVTHKPFKSRHATKGQLRDAA, QVMSKLDRRNQAKQRQLEKAREHQKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ48	Uncharacterized protein	1	673-703	GDGRVKRWDPNCYRRRRRRHHDHHDHHDHHD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0X8	HMG box domain-containing protein	2	109-134, 312-336	PQPPAEEKKERKKRSHDPNAPKRPLT, AATPASPETKKRKRTSKAAEQVVEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Z6	Uncharacterized protein	1	127-157	SSATPPPTAKRSKKQRKRGKSKNKANSGGEP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E2	CP-type G domain-containing protein	2	1-60, 68-89	MAGSINKPKKPKSKRTPVRLRHKIEKASAAKQRKARKLAKKNPQWRSKLKKDPGIPNLFP, QIEETRIRKKEEQQRRRELAKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1W8	VPS37 C-terminal domain-containing protein	1	219-242	VKRYREAKKLYYLRQERKERWDEG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3M3	Uncharacterized protein	1	6-29	QESPTVQSSKKRRRDDNDHQMHPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Z7	Uncharacterized protein	1	659-691	NSWIHKPKYNDDNDKQPRSKSKSRKSIFSRKKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4N7	Uncharacterized protein	1	32-58	KTEPEEHTKPPSPKRAKKEEDKDEGGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5E2	Uncharacterized protein	1	106-127	VSREITRRARGRKDVRLPTPNP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5S3	Ribosome biogenesis protein SLX9	2	16-40, 77-103	LAPTAPRPSKRPTARQKARARLADP, AKSSEKSTGTKKKRRRPSKKLVTTLES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q670	ANK_REP_REGION domain-containing protein	1	2-41	ASSQRKTGTLKKPAAKAKTKKPDGKACKGKTKKALSAPIL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8Q0	WD_REPEATS_REGION domain-containing protein	2	21-40, 406-430	TPEQRYWRSFKNQKSHTSTA, AQGGRGRRPKLKPWQRYFRQGRYAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9M1	DUF4048 domain-containing protein	1	57-101	LATLARPGRRRRILPKTSHSFDTINTATKRAKTARRDPREFKDMD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB87	Septin-type G domain-containing protein	1	52-76	FSTTIKNYADHKRRHQKQIDKTVEI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCZ8	Autophagy-related protein 1	1	936-957	AASKSQQQQQQQQQQQQQQQQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD17	MFS domain-containing protein	1	327-350	ATDRLWRHLKEKKKKARGDGDAVP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDB2	Zn(2)-C6 fungal-type domain-containing protein	1	41-61	TIPPPRPMGRPPRQYRSQSSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDP3	Zn(2)-C6 fungal-type domain-containing protein	1	11-38	ELAPQACQSCRSRKRRCDKALPKCSSCA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDU2	Zn(2)-C6 fungal-type domain-containing protein	2	7-34, 134-156	KYKGCETCRLRRVKCDNQRPHCRKCLDG, DLVQLDCRRPRQRRGRYSTQLAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QET4	BHLH domain-containing protein	1	88-109	QQQQQQQQQQQQQRQQQQHPGF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEW1	DNA replication ATP-dependent helicase/nuclease	3	7-33, 126-148, 225-244	FSEPNRGLKRPQWQRSKSNPASRTNGP, AISPLLPRKGRKRARSSSPISSP, ISCGAHWPKRRKFERADSGT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGE2	Uncharacterized protein	1	309-338	STRRRPPGGLPSRPQRKRKRDEPESNSGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI68	Uncharacterized protein	3	205-227, 466-485, 591-616	GDSSIGKRSTRRKRVKGVALNTS, VPKYWTTKRGKERYLRHKIG, LERVPKPASSPVRKRKPKAGPRDADA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJG6	DNA polymerase epsilon catalytic subunit	1	1-20	MPNTSLRRPQKGYRRGGKVA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL10	DAGKc domain-containing protein	1	375-400	AYDARVEVRRRRRRQQQQQQQRDAVH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP13	Non-specific serine/threonine protein kinase	1	786-808	EEVNVKRNRFSKRQSKNGLGAAF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPJ4	Rab-GAP TBC domain-containing protein (Fragment)	1	512-532	GFIYDQRRKKRQREAAQMARH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ13	Uncharacterized protein	1	148-175	EADAQRRRPGPKRRTSSSRKATKSKLSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0J8	Uncharacterized protein	1	373-401	LNRPEARRSWDRQRKRRRKQHGLGPPNGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2I7	WD_REPEATS_REGION domain-containing protein	1	130-152	PDFTEEGKKHRRRVSRGRRLLDE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2P1	Uncharacterized protein	2	20-57, 243-262	ASHPPPPSAPAPRRRKNHRGGRRKKQRRKSFAAPADEI, RDSASRQRTRRRCGKWPDLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4E1	Uncharacterized protein	1	581-606	GSRKGMRQGRRIRRSVRVLRRIDRIL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4P0	AAA domain-containing protein	1	54-90	EEGQEEKKDDKKKNDKKKVKKKKDKKKEDEDSKEDGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5J9	EST1_DNA_bind domain-containing protein	1	7-33	WNEHLRREAQKKLKPRIRCPDCGHGFL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5Y6	Uncharacterized protein	2	7-36, 81-111	LPPLPPLQAGDRKKRSRRPDSPPPPPHSSS, DETQPRYPPPRGTKPPKPQKREFRRQLDSGV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q846	Uncharacterized protein	3	1-26, 556-581, 595-618	MSKDTKDSKHKPDSLRQPQKRDSLSS, IRTSTKEKEKEKEKERERARDKPRTL, GGDRDRDRDKDRTQKQHSSKSSTG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8T9	DNA_LIGASE_A3 domain-containing protein	2	985-1006, 1040-1062	STPNTRRKTKIVLVDRRRREAT, RDEERKLYNNKWKPERQFELNHH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q926	Methyltranfer_dom domain-containing protein	1	214-235	GLAEREKRVRNKKLYHRVRETV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9R3	Uncharacterized protein	2	34-56, 493-523	GSFSKPASTLRSRKRSNHSAGMP, QGANWHRRPQPPPQQQQQQRGRNLRRKVQGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBI8	Uncharacterized protein	2	249-275, 951-971	PPPPPPPQAQPPKPKQSTRKLIKNILN, KDRRGDKRSAHPPPKDPGKVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC07	Uncharacterized protein	1	1211-1232	MAEFKRDRTKRRFLTFLRRDKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC38	Uncharacterized protein	1	26-50	QSPYQQPQPQPPQPQQQQPPPPPPQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDG1	Uncharacterized protein	2	1-28, 360-384	MGSPDEGRYRRRRRRRRRPSGILSGFGI, TTAINGRRPRPRRCRLQSRRTASSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFH9	Replication termination factor 2 (Fragment)	1	199-224	GLTHSLKKDKSNGKKKRKAEGLNGGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI31	Uncharacterized protein	1	56-77	SGHDRRGQSRRGKDKKGGEVGC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIS1	WD_REPEATS_REGION domain-containing protein	2	290-309, 471-494	IWDMSKQDKRQKPKWTISTP, GSFIGPKRRGSRRRRPSTRSTATL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJM4	C2H2-type domain-containing protein	1	721-744	DQEKQLKSRKHTARRQTDEEKWRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK72	Uncharacterized protein	2	1-21, 35-54	MTNLPRFHRRKKDVAPPTLIT, LPPSSPKRSFQKLSRFRVFH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKU2	RING-type domain-containing protein	1	473-499	MTEMRAAIVRRRRRRRGLRFNCMNPEC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLU1	Mannosyltransferase	2	5-31, 592-613	QAAPQVPAPKKQKKEFVHPSAKHARKK, WEIVPERLRRKWGRHCLLKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMU8	Uncharacterized protein	1	172-198	LPKFACPYFKRNPRKYRKWTSCPGPGW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMW5	TauD domain-containing protein	1	28-47	DKYLARAKRRQETEKLAKTL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN80	Ribosomal_L16 domain-containing protein	1	64-83	EPSLSRKKKMMKGRPRVPTG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNP1	Uncharacterized protein	1	542-566	LTGEVMKKMRKKKEKEAVKEGAKRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR7	WD_REPEATS_REGION domain-containing protein	3	31-54, 57-76, 494-545	RSKAELDRIRRQRQAQKAYGRGRQ, VKTVRDKKLRRTLSNLENKY, RARGKNGALKKYLRKQRKKNIIDEKRLKVEEIYKELQQKKDEKHKERQAELG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ81	Uncharacterized protein	2	13-42, 111-141	SLAYLPRKRAARHRGKVKSFPKDDPKKPVH, SDEVKRRFYKNWYKSKKKAFTKYAKKHSENN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZN8	Clr5 domain-containing protein	1	197-221	AEAHERWVTKKRRRHTRPYGGLPAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0F1	MYND-type zinc finger protein samB	1	520-540	TFEAARPQQQQHQQRRREFQY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1C4	Uncharacterized protein	1	1-20	MANRIRKKSKSKPATSTLYT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1D4	Rhomboid domain-containing protein	1	39-61	RCFSHCPVSSQKHQRPPPRGGHD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E6	SLD3 domain-containing protein	2	429-454, 656-676	ESETGASKPKKRKNKKPKLGKDGLYP, APVKRPTTSKRDKDKDKTLER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1H6	Uncharacterized protein	1	252-274	EAAPARRRLSRRKQHESSRKAAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1M2	zf-TFIIIC domain-containing protein	1	141-166	RSSVLFGYKPRRKRQPRRGPCSGQHD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2J2	SAP domain-containing protein	2	152-171, 560-587	DAVNRKRRSRSPPPETESSR, GPPPPPPPPPPPRRRTPSPRWGSRNDDS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3B0	Ribosome biogenesis protein NSA2 homolog	1	136-156	VKTGKKTQKKGWKRIVTKPTF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N6	MFS domain-containing protein	1	540-559	MEWRSIKKDRWLKWLNRAAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q895	AdoMet-dependent rRNA methyltransferase SPB1	6	362-390, 609-630, 640-663, 740-765, 781-806, 822-841	LQRIKDKELAKKKKERRKENERKHKEIVR, EEQKKMRKEKAARKEKEKEDDF, DDDWEEKEKKKKTKDGKPNIDIIT, VAEARARKKLKQAQKLEKLKKKADLL, AKLMSAAARKKRKPPVKVIKATGVNR, VDPRMKKEMRALKRIAKKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9D1	Uncharacterized protein	3	16-35, 1600-1627, 1747-1782	SSFFHRSKNKADKRSAGEDG, AAAPQARDQRDRRRRARLKDRHQVRIAS, SAEKRETLRRSRRQTADEERRMRRRRREMAQSSASN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAJ3	Uncharacterized protein	2	608-629, 851-935	EKAKNTSKPPAKPRPSRPPITR, VKAPQPGRSQAQKQHERRRQPQPQQQQQQQQQQQEQQQDREREQQQRQHQQQKQVVDTDPKKSPVRKRERRTSRVASRRRSTLNP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBU5	Uncharacterized protein	2	107-132, 358-379	FRSTTSTTHHHRRYRHRHHHDYGGNS, IPTPPASKRKNSKPGRKPKGEG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC27	Uncharacterized protein	2	9-40, 93-125	GAVSPPAPRRGRREKPWPPGKQKKLLRLYVCT, RVRFLRSVRAERRIRNRRVRRRLEAQSRNPIAH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDY5	STAS domain-containing protein	1	122-148	GVLSASSKKKNWRRRWAAKIRSQKMST
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE53	F-box domain-containing protein	2	38-57, 691-712	RPEPQLKKRDRLLRGLQRMS, GGAGGWRRRRRAREAQMAHDEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEN0	TLC domain-containing protein	1	67-94	AASPATTTKRFSKRRKARSALRRAKSIA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF45	Uncharacterized protein (Fragment)	2	9-37, 54-99	GCRPGPCGSSCRRRRPRYHRGSGRRGEEG, SHRRGCCPRAHARRRGRPCRPCRPCGRDNSRHRRSCRPCRSSCCCS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGV0	Uncharacterized protein	1	101-122	SYNNWKQRRDAREQRHRHRPEI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHE0	Arf-GAP domain-containing protein	1	26-49	LEPNKVCADCKRNKHPRWASWNLG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHI2	Transcription initiation factor IIE subunit beta	1	261-292	PRLKAAQAPKAEKKKKKTQRRTGKSTNVHMEH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIB3	Uncharacterized protein	1	562-583	AAKLSTPQKKLARPNTPAKRSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK05	Uncharacterized protein	1	1-23	MARTLEKTRKQIAKKRHGKIEAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKI9	Uncharacterized protein	1	26-59	LQESPTARRAKRVRKNRKRRSKRSEDKRLELEKW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q186	Histone acetyltransferase subunit 3-like protein	3	16-37, 142-166, 628-652	AGAIRQQQHQQQHQQRSRNTTP, AEDGERERKSNKKKRKGTDTLTPHG, AAYLKRTRTMGKKLKKARPGQSAAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E4	Homeobox domain-containing protein	1	107-128	RINNWFQNRRAKEKQIRKTAEF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1F6	Uncharacterized protein	1	344-370	LPEHVTPCRDMRRKNPRKHVTISKGLT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1I7	S4 RNA-binding domain-containing protein	1	159-184	NSPFGGGRPGRVRRKKAKAAEKGDEG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1M6	UBC core domain-containing protein	1	154-178	REEREGKSKEFRRQCRKCVRESLGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1T4	Uncharacterized protein	1	643-663	IPDRPQPQPHHHHHHHHHPSD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q260	WD_REPEATS_REGION domain-containing protein	1	117-137	SPSSKDKKPVAVKKQTSKSRI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3I4	Arrestin_C domain-containing protein	1	222-246	TIYLEPISKRSKRKRQPVVGEKCSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q464	Uncharacterized protein	1	26-49	FSTTKTAGSKPKTKVKPNHSILSF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5R5	Bms1-type G domain-containing protein	5	1-32, 174-198, 811-832, 1027-1048, 1094-1150	MEAQTHKPHRASKKSKEKKAKHQAGQNPKAFA, DLFRKPQALKDAKKRLKHRLWTELY, FVQVRIKRHRWHKKILKTGDPL, PVQKNSQYRKIERPERHFNPLR, QKLTTIRKEQVAKRRAKKEEKREEYRKKIAEIEERLERKEKREKQAYWEREGRKRKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q712	Uncharacterized protein	1	68-104	SGAESRRGRIRHKDPNRSRSRRRKRFQKLLWVKQSYP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7W0	Uncharacterized protein	2	74-97, 784-812	RALPRSHSPRPLRGQPRNHRIPVG, PALAPLPPSKHKPKNKARPSSQKHYPSYI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8S8	Uncharacterized protein	2	69-95, 326-351	QAPPQSRPEPAKPRKQAKPKRAGLKSV, AKVKSEKELKVDPKKRVRTWLKGVEV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9Q4	Uncharacterized protein	3	55-79, 398-419, 1475-1498	GQPTACPEPVKKKNRPHGLQEAPTY, DGESGSRRSKRLKKNTVPTVAG, VLEVSKSTRKPRPTKLQKLLAQYG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB52	Uncharacterized protein	1	291-310	DLQYRPSKRRRTTSRIPEQH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBP9	Histone-lysine N-methyltransferase, H3 lysine-36 specific	1	344-365	WDTTVAKKPRKKKAHEGDEEYV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBU0	Carboxylic ester hydrolase	1	626-648	QQQQQQQGRKRDRWEPSTKRGGL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCH4	Uncharacterized protein	6	49-81, 151-180, 736-759, 770-795, 1220-1242, 1274-1304	TNTADAGSKNKKDKTKKKKKNKKGEKGAQDGEE, VDLDEIIRRRREKKKKTKGKEKGEDSKEDQ, AVLNLKKIRKPKAKKGPRLLRFHL, QSRIYRFLVERQRKRRHRKSIGGAGA, SSDVARRKPPPPRPVKPAALRST, GTPPPNTSKPTPPPPPPRRRRGTAPAMQQPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDW1	SNF2-family ATP dependent chromatin remodeling factor like protein	3	358-379, 1161-1185, 1201-1247	MTTNRAAYRRMKKQNVREARVT, AAAARKAARREKRELNKLRRKGLLT, DAETPVKKRGRKPGSKNQDKRKAEEGDDEPPAKKRRGPQGRPRAVGL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGY8	Cysteinyl-tRNA synthetase	1	773-797	GTELPKSQAKKLRKEWERQAKLHEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH75	EngB-type G domain-containing protein	1	33-54	PSKYYPPSSKTNPQKKRATLAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHP4	Uncharacterized protein	1	653-677	LGLALWWRRRKRAQQQQREQYPSQY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIE2	Uncharacterized protein	6	2-23, 299-326, 2014-2035, 2481-2506, 2554-2594, 2626-2647	GQPTGLKRPSPRRATRFVIRNA, HTKDDCYGTRKNGRRRRENPCVKRHFAA, AAQGLRRNKGHKKDRYRWLLPV, ASGQNRAERRAKTRKRGFFSRLFGRK, NDGFEDVPDKKRRKRDKEDRKKRSQKERNKKQKMGLFHRAS, VAQPRGTRKSRAKVRYAPTPPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIJ2	MYND-type zinc finger protein samB (Fragment)	1	12-32	PYCSRDCQKADWKAHKKVCGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMG1	Uncharacterized protein	1	301-324	SGFKLTTISRRNQKRNFKHPLSLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNA0	TRAM domain-containing protein	1	18-54	QASGQKQHGKRPFQGPQRKGAKHRRKQKTVQEGSHEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPQ4	DUF4050 domain-containing protein	1	173-192	IEMKRARRRRAVREEMKWNP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPY8	Uncharacterized protein	1	11-45	DGQQQQKQQQQQQQEPQKRDRNLREQRHTNRNLDE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ51	HECT-type E3 ubiquitin transferase	3	2858-2883, 3030-3054, 3208-3232	ARARQEEKRKREEERKKREEEERKER, EIVQQERQERRRREREEQRRHATAT, QLSLKAKQPKDKDPKTPQSLKRTYT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZU6	Uncharacterized protein	1	186-215	VAWYMRDRVLRRRRRRRRAFRRALRARSVA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Q9	Zn(2)-C6 fungal-type domain-containing protein	1	1-43	MTVTKRRTHHKSRLGCKNCKTRKIKCDEKKPSCSNCIRRKVDC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1D2	Uncharacterized protein	2	21-47, 352-377	NQLHTEHELRQRQKKEKQMRERIVLDQ, ESEDESERRSRRKRRVSHRPPDLDSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1G8	WD_REPEATS_REGION domain-containing protein	1	689-710	VFTEERQSRKSRYRMRGKAAAH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q332	DH domain-containing protein (Fragment)	1	36-56	AKPFQKWMKTLHKRVLRQQEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q337	Uncharacterized protein	1	98-121	NLKEIFSPTPKKRRRVDDDDEDED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3U8	Uncharacterized protein	1	193-225	MERRHSGKSSRRDHSRHHSHSSRHHKDEQKTVG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6M8	Acetolactate synthase	1	672-694	ITWDSEKDKERRARMRERTGGLH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q762	Uncharacterized protein	1	92-112	WSAWDSKPSRRLRRRLELELF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Y4	Uncharacterized protein	3	83-116, 1207-1234, 1284-1303	QTAEQAKTPKRSKPSKRQRKRKARRSRASSASAS, SGRLEKYSARGRKFRRREDERLRGQPVH, SPEKEKEKKEVEKAERNEED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAA2	F-box domain-containing protein	1	22-44	HAEPKIATGRRPKRDSRTSSSSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAN3	O-acyltransferase	3	13-33, 73-92, 534-555	SDPFARPRARRPPHSQLSQTS, LSTARKQVRAEQQRRRLFPT, VMLQRTKWVRGRKTFNNVCFWC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBE4	Uncharacterized protein	3	100-127, 1483-1507, 1750-1774	EQSESKKGDKAAKKKRRKSQVDATVAKA, AGPADEPIKKTKKRREPQGIVDKTA, ERGSKVKGLKPRQAKAWFRRWAKWE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBQ8	RRM domain-containing protein	1	56-82	YHPTESWLERRDRKKREKQEQVERLLT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDK6	Uncharacterized protein	1	309-337	ELSRKITEAYRRRQRERRRDGGRRSNASA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFP7	UDP-N-acetylglucosamine transferase subunit ALG13	1	266-287	ADFANQRRQQQQQQQQQQQQDS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGV5	Uncharacterized protein	1	133-154	PPAAVRKRHHVAKGKSKGNRAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHF0	WD_REPEATS_REGION domain-containing protein	3	19-46, 544-564, 599-636	TARPLPDWLARRRKRSSKYDPENLNNFE, SDSEAERKPKKPKNDVVMQVS, EQQITFVPEPKKKNKPQPAPEPSKRQDRRSASNNTFRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHV0	Squalene synthase	1	347-367	GVFRRYVRRIHQKNDPRDPNY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QII9	Uncharacterized protein	1	144-166	LIQEYPKRRTPRRYKSRAEEIRV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK17	Nucleolar protein 9	3	1-32, 804-825, 829-856	MGKNRKSKRQLIRDEKRAKKRGRELAEEEERS, GKEKRGKKEGEGKEKRDKKEGK, GENADEDVKKEKKKKKKKGLGKEGVEGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN59	Elongator complex protein 1	1	1183-1213	GSNVSRATSKNRRREEKKRARGRKGTVYEEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPH4	Uncharacterized protein	1	151-170	QPQSPPAKLKRRPSYTQKEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQG6	Uncharacterized protein	3	403-423, 485-514, 534-560	REPPSSARRAKKRKVVREIED, KQGPTPKPAAKGKKGKKRKGSRTQAAAPEP, ETAEPPAKRKRGRPRKSDASKPQPEPE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0A5	ELMO domain-containing protein	1	311-332	GDASRKGSRKHNPEKWRRLGFE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1Z7	Uncharacterized protein	1	345-364	TPEHPTTKSEHPKPPKPTSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2N6	Alpha-1,3-glucosyltransferase	1	1-26	MAKPSPSSHKPRRKAKHAVDSPSSFR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5M9	Metallophos domain-containing protein	1	49-75	LRGRPFHPPSSRWRRRRPIRVVCLSDT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N3	Fungal_trans domain-containing protein	1	76-105	QHSSNSDGPARKRRRSRKGLDKKFECPEKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6G4	Uncharacterized protein	1	135-154	GSGGRRRRRGWRIAWKQRHG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7S7	Pol_alpha_B_N domain-containing protein	1	160-182	YAQACGGKKKSRRPPPPSLDEVF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7T8	Glycoside hydrolase family 10 protein	1	91-115	KTFEKLIREKPKPGFKRKRKTVAAN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8K8	Uncharacterized protein	1	125-148	TSQRSAVRAPRRRSQRRLNSSGGQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8U8	Mechanosensitive ion channel protein	1	806-830	MDSASSTQRRSWRPRSRSTNRGSMS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q970	Peptidase_M14 domain-containing protein	2	60-79, 304-326	VFGRPPTKTKDQRPGPQLQS, TWKVDRLWRKSRQPTKMRFCRGL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB92	CID domain-containing protein (Fragment)	1	315-335	YGWSRAFCERMKRRRRGGSGQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBT8	Glycosyltransferase family 1 protein	1	23-56	ALRPHVLKNPPTRKMRKQARKRGKDEDDRFRRFR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCB9	Carboxylic ester hydrolase	1	52-71	TSGANRFKPPRRHVPLPGTE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF19	Polyadenylate-binding protein	1	423-444	KEGEKKTEKKPERKLGKSKGFG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHP8	GFO_IDH_MocA domain-containing protein	1	73-93	CDNRRTCQEWRRRYGIRRAYT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHS0	Methionine aminopeptidase 2	1	75-111	DPAAADGRANKKKRRKRSKKKSKKKSKANAPIEQSWP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJE8	Uncharacterized protein	1	120-144	NHSSRRSGSRHHSRRRSSNPRPVVI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLM6	Uncharacterized protein	1	250-274	KKGHYKQECRSPKKGWKPTPGKEIT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLZ2	Uncharacterized protein	1	138-160	LSLPPWRWKWRWRLPTLRRPAAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMG0	Uncharacterized protein (Fragment)	1	49-69	AGRVRDRRRSRPSSPPPPPSC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN16	Methyltransf_11 domain-containing protein	1	235-262	LVPWVLKSQQKKQPKPQKSPRGDKAQAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNB2	Kynurenine formamidase	1	249-270	GASGRRRSRRSDARPRRQRWIL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNG8	Cytochrome b5 heme-binding domain-containing protein	1	249-268	TEPRRKLCDQAAKGRKKRVV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNK2	Uncharacterized protein	2	1-25, 243-262	MTSKRLRRCPYKKASKTPPKGDVDG, LNVFHMKKRSNTRRWMMEHK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q011	CENP-T_C domain-containing protein	2	76-96, 478-504	LTPHRARRKSLREVRDSPRDF, LQELRMPPPVVPRKRRKDKGGAEDDIT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q069	CCHC-type domain-containing protein	1	8-39	VTCYNCGKKGHYKQECRSPKKEWKPTPGKEIT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0A0	Serine/threonine-protein phosphatase 2A activator	1	32-54	IPNLRDRIPKLEPRRRKAEPANP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Q4	Palmitoyltransferase	2	614-634, 638-658	GDQRLGSHRRAHRPARREIDL, VEMHNVKPQPRQQQQQPQTGF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Y3	Uncharacterized protein	2	681-700, 805-855	TTPLEKRQRRGKEHQSQETP, SGGPRTPIKATARRRRRRRSSEPHRGAAATSTTTAKKKKKKRAGVLSLLAI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J8	Uncharacterized protein	3	335-354, 650-673, 722-741	GAPDPAKKPRQKKWLEKGLY, GPKPKEVKTPKPAKEEKKSVKTTR, AKTVKKRKIKTSTGVKRTVS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2N1	Ribosome biogenesis protein ERB1	1	1-22	MGSKAADKKRKSRESDSESDDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q384	Uncharacterized protein	2	208-230, 295-316	NFACWAKRQHHTHKQDRHKEEQG, DDISNFKRRNPRRDRSPSEDVV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B9	Uncharacterized protein	1	3-36	SSSPPATQDRRNRDRVRDNQRRSRARKREYIQEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q569	Ribosomal RNA-processing protein 8	4	23-48, 94-122, 150-179, 521-540	AAAASAPKPARKRKRPSHSENVAAEN, EQQGPNDRSEKKQKKKKNKKEKGGSLGAA, SLKGDADKTKKNKKKKKEKQKGGVDNKEEA, GTRERKWTDGKGRVVQKKKF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q607	Uncharacterized protein	1	1042-1069	AKSSGKPATKGRQRRKAKEKATGKRTAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q673	Uncharacterized protein	1	471-499	EEEQRMGRGERNKKKKRFRSLSPAAWRSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6C3	Metallophos domain-containing protein	1	729-750	YGGGKWKARLKKGGRWQPRSVV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q832	Uncharacterized protein	4	34-62, 69-97, 357-387, 427-473	LSLPEPPSKKARRLLKKGKTLPAKPKSED, DEVKDAKDTDKTKKKKKKERSPYGVWIGN, EEKMAMKKKDEEKKKEKEKEETKTKTKTKKA, TRYHKRFGKAAAKRQQQQQQQQQQQHQDSSKSKKKSGQGGKRANGEQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8D6	MRC1 domain-containing protein	4	99-124, 244-264, 957-982, 1074-1095	DVVMTRPRKLKSRRERTPTPDPPPQE, AATSRRPRKASKKALEEMNRE, MKEAALKEKKRKKVFDKKKSQAREMV, DGGEARRRMKRRQFAKMQRALL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8H6	Uncharacterized protein	1	508-534	GGRSRSNSNSPPRSPPRRRDTGNTTSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9C7	Uncharacterized protein	1	190-213	FPFLRPRRQHMRANRRQEDRPRRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAG0	Uncharacterized protein	1	477-498	MLANIRRKIRKHQRAKLRQAVT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBC4	Uncharacterized protein	1	27-47	AETQPARKTRPRQEQSPPPEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE24	Uncharacterized protein	1	900-924	DETPQESTPRRKKGSRQAQAQDTPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE44	Uncharacterized protein	1	145-167	KCDFCGKSFKRPQDLKKHVKTHA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEF2	Uncharacterized protein	1	258-283	ILEREVKKTKTTKKKGRGERPVDLPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN9	U3 small nucleolar ribonucleoprotein protein MPP10	3	59-81, 351-374, 650-677	QQQRLRDAGKKRKRDGTQDKSTV, DDFFAPPKKKKKPGNVTKRRDSPK, AKQEMTREEKLRRRRREKERIRKAGGID
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGP1	Uncharacterized protein	3	23-50, 57-82, 85-109	GNRLGPRKDSSRKRVSRHAERNRLHPTT, PKEQPAPVQSRCRKRKHSIEHVLETS, PNPDPDPDPKRQCRSPQRRTEDAFV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHZ0	Uncharacterized protein	1	470-493	LEGGKKMGKAKLKREKKAARLAAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI38	C2H2-type domain-containing protein	2	1-24, 63-88	MGIFAKRTKTKTRRRVRDLDQIKA, TSLVAHRKGKPHKRRLKQLKEGPYTH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIC2	Mtf2 domain-containing protein	1	33-53	HSSNRTNHPRERPRSVKPARG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJU4	WD_REPEATS_REGION domain-containing protein	2	93-114, 446-470	TLTNREQKEVNKRLRREREDKG, AYSSGPEKFRQHRRKAWRGHNTAGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKJ1	CHCH domain-containing protein	1	58-83	QAYRDCKKAWIEKRKMEKKKAGGFFS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL04	VASt domain-containing protein	2	8-33, 959-979	LTKLLPKSIAAKRRRKKSTSPGEVVS, AAGARGKKRSRKSKSALASSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN49	Peptidase A1 domain-containing protein	1	91-112	PSLFPVPRSNEKRKNNYSVSKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ32	Uncharacterized protein	1	234-260	IALFRRPVPLRRRRPVRDHHHHHHPHS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW8	WLM domain-containing protein	2	118-147, 364-385	HLCGGTYRSRGRKRKAKKSLTYKEQKERRI, DSWACHSKTCKGSKYRNAGDCG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q066	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	1	71-91	RLPVNPRRKKVAPDERKRVAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0C1	Protein-tyrosine-phosphatase	1	45-65	RSPSKRSQRALETQSRRKQPF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1H8	ATP-dependent DNA helicase	2	926-954, 1078-1102	AVNGETTPQRRRRRGGRTARKSHGRLKSV, YSLSELSPRRPQAKRRRQVLADSDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2B7	Uncharacterized protein	1	1-25	MAPTKPKKKSQSDRARDRARVKPAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q367	Zn(2)-C6 fungal-type domain-containing protein	1	121-150	ITSCLECRRRKLKCAKTHPCLNCKKFQREC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4C6	Uncharacterized protein	2	114-133, 487-508	RAPDMRTQRRAERRKTQTAI, GCGRSGKRYQNQHQHHHHRDHD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6C0	RRF domain-containing protein	1	81-111	SHTPACQKKKTAKQVLKRQKKNKRDDDDDAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7X4	Uncharacterized protein	1	380-408	RGRGRGRGNGNGKKKHGRKKSDRGSGGYG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q880	MYND-type zinc finger protein samB	1	580-610	WEEFTRQFAKCRRCRRTKYCSKECQKSAWAF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8B6	Methionine aminopeptidase 2	1	52-85	PGAAAEGAKKKKKKKPKKKKKKPTQQSDPPRVLI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q916	N-acetyltransferase domain-containing protein	1	237-263	LLVFEVSRRRSRRRAFRRGVSPCQEFR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAI0	Protein kinase domain-containing protein	2	11-34, 540-559	SISLSPSQIRRRRRPGEGQDQSTD, LTPVNPPKKNKPIRWQFGIR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAN5	HATPase_c domain-containing protein	1	241-265	DDEEEKKEKKPKTKKVKETKIEEEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAT3	CDT1_C domain-containing protein	1	111-131	PNCAAPTPSSRRKRRFESDET
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB80	Uncharacterized protein	1	223-242	SIPLRHSKKRTYEWRTSNNH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBC2	Uncharacterized protein	3	111-167, 481-503, 708-727	APERAPRPTTPKTPRTPRAVPRDADPGERSKTWKRLTRVKERIKKLHRKVNWLRMVD, LLAMLQRKPKPQRAPQQERHMLI, RLNGLHRRPSRRRASSRGMM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBX4	Protein kinase domain-containing protein	2	74-96, 147-169	VQSFPSPMRHHRRTPSAHREIKE, IKAFSKARLRKRAQSNILRQGPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC04	Arrestin_C domain-containing protein	1	74-137	RSPKTSRGTAARQEKRKRRKREKEEAKQRKKGEKERERQEKERRRADKENSEKQQKRRSLRSLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC65	Uncharacterized protein	5	1064-1091, 1100-1130, 1157-1183, 1188-1212, 1252-1276	DSRSREPRSSTKGRRGRRKKSAGETDGE, GGGGEKGSRRPPKKRQRLSSKKDNSKYKSAE, ERAIERSARRSRSRSRSRSPRSGSGDL, GEESEGERRQRQRRRRLSGAGDDEE, EEETVTRRPQAKRSRRGRILDESDE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCZ6	Mannosyltransferase	1	19-41	VGEPPRPKSKREEKHETTRRYEV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDS9	Uncharacterized protein	2	320-341, 374-399	GDEGTKKKPKPKPADPLRWFGI, GVELEVRRARKRRAKAEKAEEKRLAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV4	Deacetylase sirtuin-type domain-containing protein (Fragment)	1	338-363	SSGGSRKRKVQRDGTDKKPRRRPGDY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEX0	UPF0029 domain-containing protein	1	448-471	AANTTGKSTKKPKTQRELEAEKEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGN9	Zn(2)-C6 fungal-type domain-containing protein	2	28-56, 79-103	VRYGTACWPCRQRKVKCDNKSPCENCVKR, SSEHPTSGRKRSRSPDRQESRSQSN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH67	Tyrosinase-like protein	1	49-68	SSCGKPKVRVEWKKLKESEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH74	Palmitoyltransferase	2	87-106, 335-360	ATCRRLKPARSKHCSVCRRC, RDPYVPVAENRLRRKKKRRARKIYLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJS9	Transcription elongation factor SPT5	2	59-81, 115-140	EDDDRPTKAGKKRPREDDDEEEN, EEEDEDVHRHRRKRRKDHRAAFFDIE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK38	Uncharacterized protein	1	76-101	QGLIKLYQRQRGKKLKQYQHAALKLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK51	Uncharacterized protein	2	580-604, 641-670	TAKSDTPKAAKKRKHGDVDKGANKE, STKTTEQTSPSKKKSKGKDKAKKDGPASSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZV1	Uncharacterized protein	4	844-864, 1103-1126, 1395-1419, 1709-1734	VCKFCGTKKSRKWRRAPVAAV, QPKISNSHKKKTEKERERERMERE, VEQRSFQCHKCKKAGRQPTIRSVPA, HPPQHPTSQHPPPQQQQQQQHSQHSQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0I3	Uncharacterized protein	1	83-102	EECGIPQRRWHRQHGPIIRY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2L3	Uncharacterized protein (Fragment)	1	3-24	QARPLGSQKARRQKLRHAIKIM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3P8	TLC domain-containing protein	1	298-317	AVRKRFEPPKPGKKEPLPAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q603	Uncharacterized protein	1	480-508	EREWRDDWDHRNHHHHRRRRYSVDYEDDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Q1	Uncharacterized protein	1	302-326	DDVGVGGRRRRRGRRTGQGLREWEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M3	SCD domain-containing protein	4	30-50, 96-118, 1013-1032, 1144-1164	KYTPEAPTATKRKRNAEPDDE, LSSQTAKSRKPAAKKPKTNGDAP, EPAPDERRRHQNQNQQDPDQ, AAGGARKKKTKAKAKAEAASA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q977	Transcription elongation factor 1 homolog	1	1-23	MGKRKSSRKPQAPKKREPLPTTF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB26	Fork-head domain-containing protein	2	600-642, 644-664	GDPPVKRKVGRPRKHPLPENAPDRPEKRKYKPRKSKNGEEGEG, DVEKSVKERRREKPKTPPLEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBK2	Cyclic pyranopterin monophosphate synthase	1	72-93	QSPVHPARSRRDRIRDAKPFSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC23	Glycosyltransferase family 55 protein	1	483-506	GNNNSRSHPHPHPRKPLSRPVRVL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCP0	Eukaryotic translation initiation factor 3 subunit C	1	149-171	NETLAKQKVTPKNKKLNATNARG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD18	Uncharacterized protein	1	121-143	NNPNTKYCYRHRPDSKCRRAADE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF49	Uncharacterized protein	2	21-54, 120-143	ETRQQKPKVLPCKYCSKRFRRVEHVQRHERTHTK, MPQQQHQQQRQQQQQQQQQKPRLV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHZ9	Autophagy-related protein 9	2	66-89, 108-132	GGVTGPSTKRRPHKDDRPTWMPQE, DAAGSPSQPRKKKVKQPSAIPGPSN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKX0	Protein SSH4	1	56-79	QVTGREKRAKKDSLKKRESKGTSD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLN0	Uncharacterized protein	1	219-239	ELPKSSKFNRADKRQKRQEGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNH5	GlcNAc-PI synthesis protein	1	466-486	KIDICPDWPRKERKADGKDAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPY2	Uncharacterized protein	1	496-520	EPLEKRLRPPSPKRRAKPSPRNVTS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZP4	GPI-anchored wall transfer protein	1	114-133	DSPSARRKKPQLPPNAQSKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZU4	Uncharacterized protein	3	15-43, 134-154, 842-861	EQGIIGPQQSKKQRRKNAEEQKARPDKRL, EKMIERFTREQQRKHKKISAF, KLKAEHKRERKGALRELRKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1I0	C2H2-type domain-containing protein (Fragment)	2	120-143, 484-507	KGQPAERRVLRPRIRRPSRFHESD, ECLYKPCPYKSKRESNCKQHMEKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q328	Protein kinase domain-containing protein	1	27-46	QLKTSKDKEHPPPPPNNVVE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q513	Brr6_like_C_C domain-containing protein	2	165-189, 452-471	GEIPRVSRDKVRKRKRLNGDRDVGS, TPSGRRSPSKGDRGRSPSKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5P3	Uncharacterized protein	1	1-23	MLTDPKRIKRRSDQPFKSQRSEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q602	PARP-type domain-containing protein	4	117-140, 157-178, 300-325, 357-380	MNVPGQKGIHRRQKKTKTEPEAEP, EQKGAKKSKKAGSKRHRGKTEV, EPEPEPAKKKASRSKKVKKEASASPE, EENTAAKTKKGRKGSEKKSVPMLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6M0	Stress response protein NST1	5	28-55, 103-133, 521-540, 637-664, 684-703	AGTEPAPPVNRKKQKRRAKAAAKAAAEQ, GVAQKPASGKSKKSKKKKKKNATGQAHEGSN, DAQRKAKKAKEAQKRKDRAA, KEAREQKERKERERKERQERERREKEAK, GKDTKEKRKKDEKTAQKPAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7E5	Uncharacterized protein	4	13-35, 146-189, 200-219, 847-867	TGSWRTSRSRSPRPYDSQSREYD, NGESEKRDSQRQRRPKEESPGSEEEPGRQKARPDIPKRKSHQDL, EPPLRRSSSRRDRDRPLVHQ, EVPRNFYKYKQPKPVASCQLY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9U9	tRNA dimethylallyltransferase	1	439-458	ITSRKHQKAVRGARKRQLIP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA54	Uncharacterized protein	1	913-939	GSQPCSAQVRQRSWKRRFLSLRYPVLF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAZ8	Carbohydrate-binding module family 48 protein	1	17-38	SQTHSQHDRPVRRENKNPIPVQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCP9	C2H2-type domain-containing protein	1	222-241	KDIRREWKAKKKEEEARKAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD61	BRCT domain-containing protein	1	183-202	VAKYYKKKGDAQPKIHRPSH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEU5	Uncharacterized protein	2	1242-1265, 1937-1959	GSASRKPPRPVTQRPPRRNKRVTL, AASQRAQRRRTLQKKQRTQEVLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGK9	Uncharacterized protein	2	243-271, 291-314	QTEPAKRGPKRASRSGKRARKPEHQTDQD, REQNGTRARKRSRKNIQDKPDGDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGQ5	Uncharacterized protein	1	48-73	VWLAPGKVKSRTRRRKEATTVSAKPN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH01	Transcription factor BYE1	2	25-50, 127-157	QAIETPKRRGGNKKTKKTAPEPEEPE, RKAYEEQKAEKKKKGPKKGKKRTSDLKEDAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH47	Phytase-like domain-containing protein	1	303-328	LLKYALRRTDKKKTKNKKKGGDVEVT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI03	DUF2013 domain-containing protein	2	425-446, 468-494	EGSPSRPKPPPPPRALRPKTSL, VNGNGQKKPPPKIPPPRRKAKVLAATG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIE3	Uncharacterized protein	5	21-40, 143-164, 207-230, 608-661, 673-693	YDFLTRSKSHWPRRYGHQPW, LRGLLAGRRKRMRKKIGYVALS, ITRSLFPPCSRSRRNRCCSRSFAS, PTSTTTTARRAKKTKEKPKKPAVLLDKRGLPLDKKARRAELRRRERERPRTAAE, ASSSWRATPRRDKRKAWMVEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ31	G_PROTEIN_RECEP_F2_4 domain-containing protein	1	471-493	GEGVSRTRSRRMRSGRRVSAVKI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK03	Uncharacterized protein	5	31-56, 155-184, 342-362, 479-510, 512-557	GEDTSDQWRKKKQTKDQARAAKRGKL, ESTLSKRQKAKEEKKVAKKQKQEEAKRVKE, LIEARRQKQAQRKAHKQEMRR, DNESLLKKALKRKEKAKKKSEREWKERTESVK, AIQERQRKREENIRKRREEKLARKAGKKNKGVQTRKKNRPGFEGGF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLF4	Uncharacterized protein	1	16-40	SSSSSSSKGNTKRKPVKPPNDALLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLN6	Uncharacterized protein	2	82-105, 275-300	ENNGSPPWKQPRHRSKCPEDFRSF, LAVPWRRQGTSKHRDKPWKTRKNWRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN44	RRM domain-containing protein	3	17-40, 58-78, 358-380	PEPAAKKTKATKDTPKAEKRKALE, PKRDVAPKKSALKKEKQSTET, ATKPSEDATPQKKKSKKGKKTKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR3	Chromo domain-containing protein	4	106-140, 163-186, 308-337, 403-423	EEAQKQARKEKLERHHRRNRKRKRLGLPLTSPFNT, KEALRQSQQRARKRAPSPKPASVS, MSDPTKDPKLFRKHRQRWQAYKRSRDKEDL, GAEAAHQKKKRKSVRFQVSDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR9	Uncharacterized protein	4	104-131, 280-308, 354-376, 606-628	EDVDVKSWLKNQKKRQKKIEAARKAEEE, LDPSEVKVKKPKKKKSKATRRRREDDDDV, STLARQRKEALKKRKKLRPEDIA, GSGKGKTDKKLKKLAEEKRRMAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q093	Uncharacterized protein	1	558-577	ETRYRMSTFYQQQKRKLKEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0H9	PALP domain-containing protein	1	33-55	YPELEARYQRRRKGSRRGSIFFG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1P8	UDG domain-containing protein (Fragment)	1	54-75	VPPPRRASRSPSKRKADPPDED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1U8	ENDO3c domain-containing protein	1	110-139	RYQRPTSRSAREKRETRTRRSRDSRQGSTS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q379	Carboxylic ester hydrolase	1	394-418	SPSPSSFPSKRTKKKKSRTEAEAAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3E2	Signal recognition particle subunit SRP68	2	31-51, 367-391	LLNSRKKLNIATKHRGKFNPK, DFSGPVSQKKKKRKQQQQQEEEQEG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5Q2	F-box domain-containing protein	3	246-265, 380-406, 911-934	LKQARSRSPRKGFLNREHPT, AAVVETEKKKNKNKNKKGKARTEQELV, KDAAEKNKNKKGKSKHHSSSSSSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q693	Protein kinase domain-containing protein	1	397-421	SEQTSRPAKPKQRRRLPPQLQPLKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6K2	18S rRNA factor 2	2	80-99, 299-329	EKEEAQKRSKDKKTKSTAEL, PTQERRRTFKQIPLAKKRKQEEPPEQVRRVL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8J6	Mevalonate kinase	1	54-77	TINLKINPRRSMKRKQSSPMMPAF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAH5	Uncharacterized protein	1	4-31	SPTPSAGHWPPRRPSKRSKLRNGSVIIP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAI4	Uncharacterized protein	1	419-446	STYPPPNTTSQRKRHTPTQPMLRKRVVP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAU4	Uncharacterized protein	1	156-179	TDSGIQSEKGRHRRERRRGGCVIL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB23	Uncharacterized protein	1	165-207	APTTRRISKRKPSLDKTPPPAEDPVVRKPKSRRKARDSTAEKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD77	Uncharacterized protein	2	160-180, 182-210	NPDPAAIKPKKKKAGKGDEFD, IFGGLDSNSKKPKKKKRKKGDEFDDIFSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDT3	Uncharacterized protein	2	48-72, 343-370	PPASLGFRPSRQRRPPRGPRSAADD, REGGDGKGQKKKKKKSWRRERLEYVETA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF81	Uncharacterized protein	1	89-108	VSRSRKPSFSGPPRPTRERR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFP3	Amidohydro_3 domain-containing protein	1	62-84	LVTSLWPKPSKERRKKFVASAMR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFV6	Vacuolar protein sorting-associated protein	2	369-394, 2975-3000	RDDRRRYIELFKKRKQNQQLTPDEAD, TMDKQFQDRRRITRARNRPKHALFGV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGQ7	Serine/threonine-protein kinase RIO1	1	471-525	DEDESRFEKRRPRGRKFEDKEEKREHKWLVKEERREKRKTKMPKAVKKRLVATTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGR4	Uncharacterized protein	1	566-589	KTTANPKRRFYRWRKLRRIHWGSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIN6	Uncharacterized protein	1	46-75	GGGRTCTRARWRRCGRRRWRWRWRGAGWRW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIZ9	Uncharacterized protein	1	12-35	ELFRLEQRYTRRRHRRSTFVSNAI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJL7	Long-chain-alcohol oxidase	1	620-639	NKPEGRDKDKDKHKDKDEDE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJS4	Glycylpeptide N-tetradecanoyltransferase	1	54-82	GGGEGAVKKKKKKGKKKKVKQTLSDALGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK58	Letm1 RBD domain-containing protein	1	40-65	VATPRQCQRRRNHTSTSPEQHRRQHD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL59	THO complex subunit 2	1	2295-2334	SSRSEHDRSRREHHRSERSSRPSGRSSRDRTPDREREPKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLE9	Uncharacterized protein	1	349-400	PKEEKEEKEERPKKKAKKALPESNDERLDKEIAERKAKLKKQKKAAASKADI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN43	Uncharacterized protein	2	4-23, 42-71	LKELKKKGFWKLFRSKSSAA, RSRRPEDPAEPSPRRRRPRRTDPGVVKGKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNX9	Uncharacterized protein	1	103-125	SEKFEVKARRKWRPNVHQKRLWS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP50	Uncharacterized protein	2	85-108, 884-914	GWTNPWRSKSGTREKYNQRKPSSA, ESTAKAKQPNFKPRRSQKQQQQARPPKRVSW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP96	TBP-associated factor 4	1	471-491	DLEEARLRKRQKRLNPEPAAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPM2	Uncharacterized protein	2	96-121, 252-277	APSPLPSSFPKKRRGRPPGRPNTTVR, ACSLYTGPKPNRKRKAKEQLAPPPAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ52	40S ribosomal protein S6	2	79-99, 180-206	GHSCYRPRRTGERKRKSVRGC, LVTPQRLQHKRHRIALKRRQAEKVKDE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZR3	CCHC-type domain-containing protein (Fragment)	1	171-192	VTYYNCGKKGHYKQECRSPKKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q109	TAFII55_N domain-containing protein	1	301-321	DARNRRFRKRLSKLEIKNKEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q113	Uncharacterized protein	1	88-111	RVGNPSYPPRRRRSQQQHQMPASF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1G2	DUF1752 domain-containing protein	1	397-421	KVTQAKKRRSVLKKLKGNNNNKSGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2J6	Uncharacterized protein	1	209-228	EKEGKPSKGQARPRERRERG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Y4	Adenylyl cyclase-associated protein	1	362-385	APPGTKPKPESMRVKKPPKKELEG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3F1	Exocyst complex component SEC5	1	33-58	SEDEAAKKKANRRKSRYQALERAVGN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H2	ATP-dependent RNA helicase DBP10	5	343-366, 762-783, 807-827, 843-886, 900-926	ETQEPQSKKRKRGSDRPGRNEKPT, FGLPTRPKMRWDKRHSKYVARA, FQSGRFEKWRRANKLGRLPGV, PGAPGGRHYKHKQEKAPKEADKYRDDYHVRKKRVAEAREKRIGK, ATDIRKARLLKEKRKEKNARPSKKAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q557	Uncharacterized protein	1	14-33	STTSSRRRSRTPVPAKPGIE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6K8	PlsC domain-containing protein	1	738-760	ERSLSRSVMEQKRRRRLEGRAHL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6M9	Uncharacterized protein	1	7-49	KAPQPGWMHKQKKPKNNKDQQLERPRRRRRRRNRYTDDEDDDY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6N5	RAD5-like protein	2	96-115, 760-786	VKAMQLKQTRKENEQRRKAM, LVNKAFQEKQGKQKKTKETRMADILKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Y0	Uncharacterized protein	4	53-72, 243-265, 687-710, 712-743	FPFIVRARRRRLTRHDDPGL, RGLIHRRRSSHHRRDSKRSTQAG, TVTHLRRHVNDKHHKTRRFYCTEP, CDYSRQGTKSFPRKDNWKRHMLKKHSVDPQNA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q717	Metallophos domain-containing protein	2	332-356, 429-464	LIYPRVGKGKKNKDKDGRRHARDEP, ISPYSGSPSSSKKKKKKKNKKNKHKDKNGKDHVNDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q980	Uncharacterized protein	2	65-84, 229-255	QSYMRWKDIRKRARIRAEET, VKKKEEEEELRRRRRRMRDAPRGASAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9N8	Proton-translocating NAD(P)(+) transhydrogenase	1	53-77	AVVWCQRARHATRRKEQPKNAGLAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9P9	Uncharacterized protein	1	386-405	QMKLWHARRKAERTQWWEAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9W0	Uncharacterized protein	1	205-226	VKKIPDRPQKKAEKKTEQKPEP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAI7	DNA polymerase II subunit 2	1	1-35	MIPIQSPRKSPRNNQQQSPGKGDKRAKPPPPSFFG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB95	Uncharacterized protein	3	418-444, 623-648, 686-707	QDDDSKEKKSPKKSKNHNKRDWKVSDL, QQQQQHQRGHHHRPNQRRHEEQTKTT, LQGFLLKRKKTPRRALEEVDAW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBK6	Uncharacterized protein	2	212-240, 354-377	ESKLSSRQLNVLKRKRKREAQKAAQGKSG, GAGAGRRKGKSRKENDRLNRQWLD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDL9	Uncharacterized protein	1	328-352	AAVAGKKKPPPPPPKKKDIQIPGFG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE31	Uncharacterized protein	1	29-48	NPSNHSKAKRSARKANHSLF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEN4	Uncharacterized protein	1	549-574	SQFQQYQQQHHHRRHHHHHQQQQYLG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEN6	Clustered mitochondria protein homolog	2	907-930, 1264-1285	QAQAEPAPKKKNKKKSHDGSPASA, GGSAGGKKRAGRSNPKRRGGAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEZ7	60S ribosomal protein L8	1	18-39	KAGSKKAPKNPLIEKRPRNFGI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFL0	Uncharacterized protein	2	13-41, 339-369	RMGDDKPTYRSWKKKYRKMRIVFDQKMHE, DPGYRPKGGSSRPTKKKRKSEGPERMPTAKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFX1	Uncharacterized protein	2	501-525, 594-620	PEPASTKPVEKRPRGRPRTKPLTDS, ATSSAPEKTEPKKKKRKLLGTNTSTLF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG97	A_deaminase domain-containing protein	1	4-33	LFQLIGWKLTSRRRRRRRRLDQRVEAALKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIE7	Uncharacterized protein	1	580-608	GMTMRPKNTPPPPRGRKPRVTRRTGVLPT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIK7	Uncharacterized protein	1	84-103	IPHHRDQHWRRSRPNRTVQA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIT8	Uncharacterized protein	1	130-153	APPLPDYSPQRWRQRQRQRQEGDP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ9	Uncharacterized protein	1	271-295	LEERVRWREERKRAYRNKGAKPGRY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL09	Uncharacterized protein	2	80-108, 665-689	QAASRARAGKHADKKRKRRGEQAQGEQAE, DEQLGRYQDKKKYVRYQMNPRENWG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLF0	FHA domain-containing protein	1	497-524	VTDGLRKPSLRNCRKQHKQYYWKRPKTP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZZ2	Phosphatidylinositol 3-kinase VPS34	2	136-158, 160-180	DNQLHKGRQKCHVYRHRRADGND, SKTPAILPKKKSRKGAPEDKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q130	Uncharacterized protein	2	67-94, 110-137	STVSWPPPAPPPRRPRPHERTYTSRGQI, PGSAIVLREKRTRKKKRQLADLKPDSDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1N2	PAS domain-containing protein	1	301-323	KPISRRQRFFRRFYRKTPRSRAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q593	Uncharacterized protein	1	1107-1129	NRLDPRSNKERGQRVRKLQLSDV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9U4	Phospholipid-transporting ATPase	2	69-91, 157-182	YDETRSPRSRQPQSPLQRRTPEL, LSQLGWVGRQKRRKRGLGRIPWAKIQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA94	Uncharacterized protein	1	1-24	MSRSTPRKARHRHHASNSGPRQVV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAR7	Pex24p domain-containing protein	1	522-550	GEEGMGRRGQWRRRRWVRMVKRKKVAGSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB57	Uncharacterized protein	1	452-477	VSGKDKPNGGKRKPKRRDDSENFESR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBZ5	Uncharacterized protein	1	297-334	RLMWERMHRTIKRNDRKQQREKRQKAKKELEEQRVRDE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCG7	BZIP domain-containing protein	1	33-70	QTENQQPKRKGGRKPIYATSEERKQRNRQAQAAFRERR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCM3	Uncharacterized protein	4	45-66, 72-94, 109-128, 1018-1039	KTPAAFPPPKTDKPRPHVCGTC, RLEHLKRHERSHTKEKPFQCPEC, QKLHQTTTPSSRPRNRRESA, TQTSNKQSISRREKHLRKAAFF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCS7	Zn(2)-C6 fungal-type domain-containing protein	2	10-35, 245-266	AETGQPTQRRKKARLACNPCRARKTG, PMFKSKYRALWKQKPPPRPAFD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD32	Uncharacterized protein	1	708-727	EEQRSRSRIIPRPGSRRART
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG15	Uncharacterized protein	1	641-660	TPSGVKVKPKSRRRSAHADT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGH9	Uncharacterized protein	1	95-114	KYAQKVRKDAQRQKTRLETD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJD3	Uncharacterized protein	1	19-49	SSPPPAPWKNPLKNNQATKRRHPLRGFLKAI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLA4	Uncharacterized protein	1	277-305	TNFVRLPKESKKERAKRLRQEGGSRRMNF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNC3	Uncharacterized protein	2	234-256, 457-490	PVYNVKPWYKSRRVRKLAEESAE, YAKKRELNLKEKLKKQPRRRKKGRGKQRSSALVS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNM2	Uncharacterized protein	1	33-59	PTPSPSPRSPTPPPREKRKFAPQLVES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNN2	Uncharacterized protein	1	709-729	LREGLRKCQKHERRELPGRLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ86	MFS domain-containing protein	1	75-96	GTVGRAKSKEWKKPLPNFGAGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q004	Ubiquinone biosynthesis protein COQ4, mitochondrial	1	262-290	VEPPPDLREIRKREREERKRQKEQAAAAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q136	ABC1 domain-containing protein	2	31-54, 98-117	TPMLTPTPRPRPRLRLRLRPQLSP, QPRAARTFRRTRRWARRLAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Q9	Endopolyphosphatase	3	467-502, 575-603, 691-732	TNDADTAGKKHKKKKKKKKKHGKKPPSKGKDPNLHV, AWDWLRRWRKGKHGGKKPTRPPQPREFAY, DSEVEAEGKKKKKKKKKGKNKKGKKDRKKKGKPNDTWIHFLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4Q3	FAD-binding FR-type domain-containing protein	1	74-95	WAETRSDERKWRRLMRQPPGGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Y7	Uncharacterized protein	2	66-87, 506-530	HGHHSHHHQNQHHQHHHRKSAG, ISSGKSNDLPRKRRQKQSICSESSY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8U4	Uncharacterized protein	2	39-61, 477-496	MATPEPSERQPRGKKRGRDDGGG, LDRGVRRSYHESRKRRRTEG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9T4	Uncharacterized protein	1	106-129	FAIVLPRRRGRRGRRGMGKGGRGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBL1	HMG box domain-containing protein	2	114-138, 300-322	PSPPSQPKDKPLRIKRGHRKPSAFP, QKQSSSSSPRQQQQQEKQQQEQE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBN9	Uncharacterized protein	1	34-63	TASGRGRGRGRWARPKNTKVTKPAQQKAAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFF2	Polynucleotide adenylyltransferase	1	2-30	AYNSRYPPRGSNRPPSRDYRNERDSRHRY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFV5	Uncharacterized protein	1	331-355	EEEDERKRIKEQRKQEEEKKKEEEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ01	Uncharacterized protein	2	25-49, 130-149	FVVRVTAKRRFYRRHDLPQPPHDPI, PPITTRRRSRTPRSFRPERF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ59	Carrier domain-containing protein (Fragment)	1	814-837	AADPARGRRQGRRRQRPVRLVFAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJH6	40S ribosomal protein S26	2	1-23, 81-111	MVKKRKNNGRNKKGRGHVNPIRC, GKIVRVRSREGRRNRAPPPRVRYNKDGKKIT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLI0	Uncharacterized protein	1	148-168	GNRMSSRSKYGTKKPKKASVG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QND9	Uncharacterized protein	1	1468-1501	PVEEQKHQQKHQQQQQQKQKKKVQASKGCRRTGW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNN4	RNA-dependent RNA polymerase	2	68-91, 1119-1144	PTRSQAFQLRKPKHPPTQARLELM, CLCIGCEKRSRDTRPRLRSSARNLES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZT9	RED_N domain-containing protein	1	513-541	GGGGGGKSQRKRGKKKKKGDKNSFADVMK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q048	Uncharacterized protein (Fragment)	1	31-57	TRISWTPRAPVRPRRLRKPECRELLNP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0F0	PWI domain-containing protein	5	217-250, 267-314, 318-348, 365-392, 398-448	RGGGRRDGRRWRSRSRSRSRSRSRSRSRTRSVSS, GSRRSYTRSPTPPRRRRHGRSRSRSRTPLSRRDSHKRYRSPRGRSRSV, RGSPSPKRRRYSRSRSWSRGRSRSRSRDESR, SSSRYSRSPSRTPPRRSRRDSRSSSRGG, GGGGGRRRRSRSRTRSRGRSASPASSYDSRRRSPRRRPRGGRGDSRRRGGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q148	Uncharacterized protein	3	11-60, 86-110, 906-934	VLDDRPREKIHRSKSERKDRGRDRDKDRDREREKERRRDRDRETDRDKDS, PTDSETHSRSHRRHKTKDMDRDELE, DSASQVSSNRLRRPKRRRERATPAPIEEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1H5	BHLH domain-containing protein	1	603-622	TSKRTSHKIAEQGRRNRINS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4W0	Lon protease homolog, mitochondrial	1	1070-1089	REKANRCKACENKKEDGEKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q514	TFIIS N-terminal domain-containing protein	2	85-110, 159-181	DGETVRKPKEGRRPKKRSRAVEDDVG, MDNALKNPTKRRRKKDDIDLEEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q589	MMS1_N domain-containing protein	1	845-870	PSSVRKFCRGRTRPVWEQRLRKPRYG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5I2	Uncharacterized protein	1	58-85	GSLRRPPSAAPPKVKKGEKKREEEKFIE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N2	F-box domain-containing protein	1	221-257	DVSGGGPRPRPRRPRRTRTRFGWRRPRRPREAYQLSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6U2	ERCC4 domain-containing protein	1	105-125	ESERPAKKAKKAKPYVPAYRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Y7	Uncharacterized protein	1	2-26	ADYQRDRMPPPRQPPQQQRVQPYGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q761	Uncharacterized protein	1	76-103	SADSSETERQRKKKKKKHAKALVSFGDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q919	TFIIIC_sub6 domain-containing protein	2	292-324, 331-356	DEEEERRRRKLQQDHARNARWRDKRREEREMGL, YIPRTGGRRGWPKRARRAALIRRDSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB40	Uncharacterized protein	1	61-87	RATTVVRNRPRMRRRSKTRRGSTGSSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBF6	Uncharacterized protein	2	118-144, 232-253	YELKDKREERKQEKLRERKEKEQQREI, NFGPFRPPKRASRKAFKVKSCD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC11	Uncharacterized protein	1	404-423	QMKLWHARRKAERTQWWEAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCX3	DNA polymerase	2	86-113, 156-188	DDAVPVRGKDRKSKKQRDDEQAKRDAND, PMPVSRISKKRDRSAERRKTRPLSPPREARQPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDC4	Uncharacterized protein	1	18-43	QVCHSVLSRREEKRRRNLEAARRGCS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFS4	Uncharacterized protein	2	24-45, 441-464	QSTPATRQPSRRRMTRITRAEP, RPVLSPAAKKRRTARRVNGSSTLE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG06	Translation factor GUF1, mitochondrial	2	11-34, 633-659	SRPGIWSTSARRRTRKTSLAWSHS, ASDITRRKKLLEKQKAGRKRLRAVGNV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGI8	Uncharacterized protein	1	246-267	SVIVFFYQRKRRRQAPVRAETP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH65	Uncharacterized protein	1	19-44	GHDAARQRENQRRHRARVKSRIAELE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI61	Protein SDS23	2	52-71, 486-505	AENQRYPPPSPRNHRHPSLT, PAEQRARRRRSSSSSVRPSL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKN9	Uncharacterized protein	1	1-20	MPSASRRSWRWLPRPKSFLG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP61	Protein kinase domain-containing protein	1	133-155	VAIKIIPRFSKKRRLGKVTAMST
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPX4	60S ribosomal protein L27	1	50-71	SKITRRMSKSRQEKRSKVKPFI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0E1	zf-LYAR domain-containing protein	4	191-214, 254-275, 283-321, 390-409	KDGDRDAKKDKKRKRLHIETDHVM, PASPLKKSKSKHHKSSRTGESL, IAAGSKPKSSSKKRTKSKSSSTPSKKKKGSSKSLEAPKE, KEKELWKSLRMRRNDRGEIV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H1	Uncharacterized protein	6	8-50, 64-93, 98-123, 302-325, 775-794, 998-1022	QGGPGTSRRKKHTGKSKARPANDWPRTDEPRSRASPRWKRPGD, ADDAKASSTSHRKQRRRPRPQIPASTSSDT, TTAPAKTPQRSMRRRLKSTRVPNAAV, LDGTRRSRSRSKSARPSRRHYESD, LPQERRPRSRDRRHTFPSES, NGSPRAPHVRRRPPTHAHREHSKYD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q434	Uncharacterized protein	1	1-28	MVKPLTFKGDKKPKKRKRTDAGEGAGKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4K5	Uncharacterized protein	1	267-301	RGARWRKMLRGEREERRERERKKEMEQFARRRVEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q504	MFS domain-containing protein	1	457-480	NSLLLRRENARRRRGDRDHWVQGL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q684	Telomere_reg-2 domain-containing protein	1	814-837	AANPKIKYKSQPAKAKPRVRAIPN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q775	AA_permease domain-containing protein	1	508-531	INILWWKFVKKTKRVRPEEVDLVT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Q8	CP-type G domain-containing protein	1	621-647	QMASGKKHFKGGRKGRGKRRGNVVDGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9R0	20S-pre-rRNA D-site endonuclease NOB1	1	412-433	AEDQKEYKKKLEEERRMKTRDL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9U5	Homeobox domain-containing protein	1	73-101	GSRRPARKSTLTQQQKNQKRQRATQDQLT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDX2	Eukaryotic translation initiation factor 3 subunit A	1	757-787	EKAVNQRRKEYRERKLREKREREEKERALRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGD8	Uncharacterized protein (Fragment)	1	314-338	NDYVHVRKRARQQPQPQPQHQQEQP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGQ3	MFS domain-containing protein	1	82-108	SVRSRLSRVLSRKRTPQQRIPPTPIPV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH40	Uncharacterized protein	4	52-71, 173-193, 211-230, 400-423	RPGLNKRTLHRQPRLSPPGR, ASYPCPYRKRNPARFNIRDHE, IHYHQRKPALRQCRRCKERF, AEQPSVPKKPSRRSRRSTVLQALQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHD3	Tr-type G domain-containing protein	1	844-863	SGTVVKKKPKIVKPGMVARI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIM5	Protein kinase domain-containing protein	1	333-352	TGKKRRPFSRWYPVDPQFKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ2	DUF676 domain-containing protein	2	1386-1407, 1522-1541	RTGKESRGSRWRPSSRRTRFLP, QYLSRQHQHQHQHQHHPLAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM64	Uncharacterized protein	3	56-89, 511-530, 542-561	EEKARKENLKAEERRRKKWKKRVLSKEEREAKAK, EPSPKQTRRAAKRKSPPEAE, QSTPQSTRGRSRKTRQSYKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMK2	Uncharacterized protein (Fragment)	1	19-38	QVYKMIKKSRRYKAYVRRGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNI6	Uncharacterized protein	1	92-115	RQSFPYYSRNTNNRRRDQRSLSES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPP3	Uncharacterized protein	1	184-209	VPRCCEEIKPEKERTRCRREGWLGRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ08	RRM domain-containing protein	1	10-33	DEILSSQRRNQQGRRRSARRSAGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q086	WW domain-containing protein	2	398-422, 510-558	TPKLYWPEFRRKYKREEPMKNTKLS, QEDEAAKKAREERRRREKALEERERAVAEEKRRQEKKMQYERARLRDEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q099	Uncharacterized protein	1	288-310	SGFSSRDKRKRWSVCGAERRQDL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q213	Uncharacterized protein	1	88-111	PPEPVVRRRRLGRPPKNRPPDWDT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3A9	Uncharacterized protein	1	353-378	QEALERRLKREKEERKRKFLEATKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4Q6	Uncharacterized protein	1	186-207	HHRHHHLQQQQQRQRQRQQQEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q656	Uncharacterized protein	1	321-350	DDPLARLRARRAEQKRRRMNNKAQDDNTKI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8C6	Fe-S cluster assembly protein DRE2	1	249-271	EQPPECRPQPGKKRRACKDCTCG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9J9	Uncharacterized protein	1	34-63	VAPPTEKKVKKIIRRKKRPARPQIDPALVK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAE0	Uncharacterized protein	1	12-33	ASETRRIAKPRSRLRRFQARAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBD6	DNA ligase	2	33-54, 717-739	LDEHFPNRPRNHSKTPPFSHLF, AMEMENRKRKPAKRQKRELVIAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCF9	PUA domain-containing protein	1	379-411	EAVRLCVVERRRKKKKKNKGQRKDGKGKAKGGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCS8	Uncharacterized protein	1	198-218	RITTAKREETRRKKIDQFITL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE08	Fungal_trans domain-containing protein	1	38-59	RQGFLRNPKKTPSRNNMKGLPE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEM2	60S ribosomal protein L29	1	7-31	SSQHNQSRKAHRNGIKKPKTQRYPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF32	Uncharacterized protein	2	267-292, 382-421	NLLSFQQRQRHRKVPKRKSRGPLGLS, GRCSHSHPPASRKRRDLPASVLHLPKRARPSRPKFAAKPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFH4	Uncharacterized protein	3	156-192, 207-230, 515-550	TSIDEPKEKKSKKDKEKVVKEKRKKGTKSKYTDHPEC, DADHSTPTKKKKKIKSREVIIHEF, FWEHRGDLNRSWKRRRKLAGKEKRYRENKARMARAI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGG2	Uncharacterized protein (Fragment)	2	180-203, 343-364	GSTRLTAKDRKERRKDPAYRSQGT, PIPYLLRTKRSKRCPVCRHIIS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGL0	Uncharacterized protein	1	1-24	MPTLSKFLPLRRLRRHKVTTSDAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNB8	Uncharacterized protein	1	397-418	EAATSKLRVRRVRRGSAKVRLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNZ6	Uncharacterized protein	2	251-275, 317-336	DPPAPAPKKRQGRPPKQKQTAAARA, EPTPKPQKPTPGRRGRPPKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ30	PUM-HD domain-containing protein	1	772-809	QQQQQQQQQQQQQQKQQQQQQQQQQQHQQQQQQRPQQF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ96	U6 snRNA-associated Sm-like protein LSm1	1	122-149	VQNLAKQRKQQDKAKEKKKVKMLAREGF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZX8	Uncharacterized protein	1	150-169	GETMRRRSSRSNGQRPRARQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q139	Uncharacterized protein	1	33-64	YNPKSATQLQPPSRRPRTRRCPQPLRSPSGGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2B5	PUM-HD domain-containing protein	4	68-93, 121-146, 473-493, 662-685	QADARRDRVPAKRKENGRNKGHPAER, VYRTKQLWEKLRRKSHVPKQERQQLV, IHEIRKRTSKKDPEVRRKELV, AETSNGKKSKSKAKGQQQDKGKSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2T6	60S ribosomal protein L6	1	30-52	AEDEPKPRKVRKAVRPWTPRSSL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q354	Uncharacterized protein	1	56-77	VGAFKVPKWKRLHKLAHDSLSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q362	DH domain-containing protein	1	36-58	HDQSHHSPRSTRKQQQLQYSDRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q425	Tr-type G domain-containing protein	1	362-381	YFNPRKRNFTRKPIEKEAKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q441	Uncharacterized protein	1	3-26	SIGPQLPPHLQKRKRTPEDEEAES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q512	Zn(2)-C6 fungal-type domain-containing protein	1	72-100	VTPNACTECRKKRAKCDGNKPCSRCKAQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5W1	Uncharacterized protein	2	1-22, 74-118	MVPHSRTSKAKKGKNGRSLYAC, ARTSHSKRSKSHRSSRHSHHHHRSKSRSRSRSRPRHRSSRSAVGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6B3	Uncharacterized protein	1	13-34	LYRQCIRECRKKPEANRKHFQA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7V0	Uncharacterized protein	1	38-59	DERGQKRTISPEERKRQQRVLD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8V4	FAD-binding FR-type domain-containing protein	1	74-98	TSSPSAASPRRRRRHTPDPSHDPNH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAW0	Uncharacterized protein	3	153-199, 383-409, 447-466	VSDISGREKRRKKREQKEREKERRREEKAREKEERRKSRRRVNADGI, NDYADREKRARSRSRRRSAPREVPGSW, AEEKRKKRGGAGARRNRDGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCK8	Uncharacterized protein	2	68-103, 611-653	IKNAKKYWKLVYANQRQRRSRAKKRKDYGGANDQGR, LQPRLVRGKKTNKGGKRRNKSKSGTKRSSQRAKSKRNNEIEQI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCM9	AAA domain-containing protein	3	62-103, 573-596, 1229-1259	ATQNTDSCRSRRRKADQEPKEEDTQKRTRPSKRTKNVTSGGD, GQKTKFSDAGRRKRRKKLDGFIVS, DTTPTKTSKKAGLKSRKRKKVLRDGDYDNDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD02	Uncharacterized protein	1	215-240	ECANKEKGCLRQKRNVKWKVGSNTAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE15	Uncharacterized protein	1	835-858	SEDMKRSRNSLRKRDRSGSRQRAF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFD2	Uncharacterized protein	1	145-167	PAESRGPLRTRRGPRPRRGGLAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFQ3	CAP10 domain-containing protein	1	2-29	GEKTRFQMMMRPRPRHNRRQLRQITLVI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGZ7	Uncharacterized protein	1	207-232	DSCRSIPRKRLGTKRKPKRPLQLFED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHB2	Nicotinamide-nucleotide adenylyltransferase	1	26-50	QQSYTFPTEKLKRRQTQPGKTPLVL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHM9	Uncharacterized protein	1	48-76	ELPSHPRTKAHTRQQQQQQQQQQRRLPEH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI80	Mitochondrial transcription factor 1	1	53-72	TTPKTTTTPRSGTKRRLTKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLX6	Histone transcription regulator 3 homolog	1	438-460	EETADVKRSKRTRRRDTAAEEAM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMI8	Uncharacterized protein	1	135-154	RETIRRSIRRWRYMHVHKSI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNH7	Uncharacterized protein	2	916-943, 986-1006	KRKASEDKGKETKKSKKGKESSSTSTKS, EANQEQKQKQEEKKEEKNVGH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPB7	Uncharacterized protein	1	569-598	KHEHEDAKAARREKKRRKREAQRLAQMTEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPU9	Uncharacterized protein	2	891-916, 1040-1066	EDAINRRRRKIEARRRKAERLSQRIF, RPSFSPFKKSPLKKGKRKSEVRLSGFR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPZ0	Uncharacterized protein	2	36-55, 157-181	SIKRSNSSLARQKKRPLEDS, RQPNGEPRPKKRKSAPKEVDRSPPT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ29	Ribosomal protein L15	2	61-80, 165-203	IYRVRVRRGGRKRPAPKGAT, TSTGKKSRGLNKGHRYNKTRAGRRKTWKRHNTLSLWRYR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0G8	Uncharacterized protein	2	126-151, 645-669	PQFLYQEKWCQRRRVRIKPSEGEKAQ, AENTDRVKWCKDRKINLRNMKQALN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0X2	U3 small nucleolar RNA-associated protein 11	3	1-22, 24-50, 222-243	MSSLRNSIQRRAHRERAQPLER, RLGLLEKKKDYQKRARDYNKKKEVLKS, LEKLGRRLKAARKKLKTLQDAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q239	tRNA ligase	2	47-69, 620-662	GLEECSKKGKNRGARKTRYAVSS, RHNIPDRSKNDSKKKNKEQQQQEQQQANEKPKKKKPLEYMSVD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B4	S4 RNA-binding domain-containing protein	3	1-28, 261-287, 322-346	MRQRRLLRFHGLKRPRVRQTWNKYNLFN, IMLVKDRYHRAKKKKALRKYLKDLKAT, EHAAEAKKQRQQQRQQQQQQREQET
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6H1	Uncharacterized protein	1	582-601	DEGKAKPRRRLRASSFNPND
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q823	IFRD domain-containing protein	1	325-345	RDSSKTVSKKGRRNLRANFSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q879	Uncharacterized protein	3	17-42, 366-398, 420-447	KAQVTDNKPQKQKGDRRKSNEPAVEK, SGNSKKRSADGRPQPNPKRQRKDAKYGFGGKKR, KSNSFGGKPKKAGKAQRPGKSRRQAMKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCN8	Uncharacterized protein	1	21-61	VPETLLKKRKSQEKARAERAAELEKRKKANKEKRGVIFKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD48	Uncharacterized protein	1	414-433	QTKLWHARRKAERTQWWEAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDD7	zf-C2HC5 domain-containing protein	2	71-99, 491-512	DVDAVPKSRRGPKKKKAPIHTPPPRQVAS, LEGRKDRGARWRRVQDDRDDNE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDI9	Kri1_C domain-containing protein	4	428-455, 495-525, 588-627, 678-707	DSEDEGGKKKKKKKKPKKPKWDDDIDIN, DSDGERPAKKRKTSKEIKKERIRAKREARAE, LKKLATFRDEEKKRRDRKKLGKKARLRKWRRETFGKEYEH, PVNGIIEGERKKKRKRSKKKKSSAAMELDE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEE9	PH domain-containing protein	1	856-878	VEPWGSGQRKRSYRKRHPVTGGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFI5	Uncharacterized protein	1	8-27	KEPPKLSKGKGKGARRVSNL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFT1	Uncharacterized protein	1	291-318	DESQNKENNNNKKKNKEKKRIRVVYYEV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGB4	Zn(2)-C6 fungal-type domain-containing protein	1	65-86	VSCELCKQRKVKCDRGQPSCGW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIC1	DNA damage-binding protein CMR1	1	38-59	LPKPAPPKPKRSSTARVKRESV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ8	Eukaryotic translation initiation factor 2A	3	516-542, 568-592, 640-659	DEGNASKTGSKKKKRNKKAKEGDAANA, EGRSPDRRGHHSRSRSRQNNGNRNS, ANPNAKKIRALQKKIRAIED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKL0	Patatin-like phospholipase domain-containing protein	2	22-46, 713-732	ATPPLLDPTKLRRKRKNADHGLFGT, SDVRLPRLRRNAKSHGHFRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL53	Zn(2)-C6 fungal-type domain-containing protein	2	21-47, 728-752	PLRSSIACQRCRKSKIKCNNTGGDQPC, QHNSHHPHPHPHQHQHQHQHQHQHQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM31	Uncharacterized protein	1	483-504	ELQGFMIKRKGKPKKAADDVGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMV7	Uncharacterized protein	1	587-610	LWERRRVWARRAKSSRFRYWRYFA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN90	WD_REPEATS_REGION domain-containing protein	2	17-36, 820-840	PFLSRPSRSPIRPRGPYDPC, NSAPGRRSPPRPSHRRSSRFH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNJ3	Uncharacterized protein	1	427-449	LVRQRAEREEREKREKREREMRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNW2	alpha-1,2-Mannosidase	1	43-65	LLRPSRPHLHHHHHHHHPHPHAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPJ8	Uncharacterized protein	1	73-95	LKAVPKKKTSHMKKRHRQMAGKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPU8	Kinetochore protein SPC25	1	209-230	DYDVRHCRPKLEREKVERVLER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQG8	General transcription and DNA repair factor IIH helicase subunit XPD	1	676-695	LADRRFQRKRAQLPKWISQA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q155	Uncharacterized protein	1	38-65	EEWRRRATTCERRQQTTRKARPQADQAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H4	Uncharacterized protein	1	1-20	MGKSRRNRARGNRSDPIAKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3L7	Uncharacterized protein	1	137-161	EVNQSTFSAKKKRKRTAANKFNFDW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q596	Uncharacterized protein	1	1-26	MMNKPSVAPHRKRKRTPSDPVINPLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5J6	Uncharacterized protein	1	5-25	FMALRFWCKRRYHKVIGLDDY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q703	Glutamate decarboxylase	1	542-563	PAQHVGPRPRVKKREGERLKDV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L7	Uncharacterized protein	1	101-129	AGSSDSTKRRRDSRRSNETRSRRDNRRQS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7R5	Uncharacterized protein	2	96-127, 176-196	EARNKEKKAIEKIKASKKFQKRKRDAESDDED, ELDKKDEAARKKKPKRATGGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q974	40S ribosomal protein S1	1	1-29	MAVGKNKRLSKGKKGLKKKTQDPFSRKDW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAN2	J domain-containing protein	4	170-212, 246-271, 313-335, 510-537	KRDDERRERDREERRRRKEEEEFARQREEKREREREKDRERER, REKERERERKVEKKRLERDREKEREK, GSKSDKKRSSSKKHDETRERDRE, DVESEDDRDRRRRRSRRTRSPSGQAAQR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBF8	Uncharacterized protein	1	9-38	TCYNYGKKGHYKRECRSPKKEWKLVPRKEI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC85	Uncharacterized protein	1	140-183	SVCSVGRAKRRGRKADKSAKASSARRKTKRQGRARSRSPWRSAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD16	Uncharacterized protein	1	106-125	AHNRCRGARHRKFGRYRPRV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD35	Uncharacterized protein	1	83-105	GLLAYLRHRRRRKGKETEVAMKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEZ5	Histone acetyltransferase	1	390-420	LRQILSQRPKGQKKRSSRSRRRTSRSESTRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG13	Uncharacterized protein	1	1332-1356	DALIESLLRRKKKKKAEEDAPVTLD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QII3	Uncharacterized protein	1	50-72	QNYYPPQQQQQQRQYQRPPGPPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKF0	Uncharacterized protein	1	383-415	VPRVLRWQQQQQQRRKQRRKQLGRRQEGTRRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLJ4	zf-C2HE domain-containing protein	1	211-233	SRDMRSEKLKHRKHYNSFNTPFF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMR6	Beta-glucosidase	1	8-28	QGLLRDSKRSPQRPKDDAGHD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN56	AKAP7_NLS domain-containing protein	1	266-285	GSRGKGGRGRRGGKKWERLV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPL5	Zn(2)-C6 fungal-type domain-containing protein	1	1-34	MEPERRRRRPAVTCILCRKRKIRCDRQLPCSNCT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0T5	N-acetyltransferase domain-containing protein	1	24-43	RTFIRVRTTRPRQPFPPHSV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q106	TPT domain-containing protein	1	75-105	DEETGLTGRDRRRKRRKKRRNQLLDQRVVGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2L9	Mediator of RNA polymerase II transcription subunit 14	1	1100-1123	QQQPQQPQQPQQQQQQQQQQQQQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2W2	DUF1746 domain-containing protein	1	38-63	VRSDETSASRRQKRRREGLVKKLELV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q382	Uncharacterized protein	1	20-39	QPHNHGHRHLHAKKHNHLQM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4R0	Uncharacterized protein	1	14-35	NTDADKRLQKKQPSRVYVNEEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4T8	Uncharacterized protein	1	15-41	TVESKSSSSSTKKRKRKQPAASGLLIT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q588	Rab-GAP TBC domain-containing protein	1	353-374	LRWQEKKKAAGKWVWRNRRPAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5A0	zf-C2H2_2 domain-containing protein	2	64-90, 325-349	KPSIISSSSRRPDRRRKSASPSSPRTD, ELDEAKRAERRKQRRLDNVGNKTAI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5W5	Uncharacterized protein	2	1-22, 57-81	MNPTTNKFRQHQQQQQQQQGMP, AVSDSSQSGRKRKRKRGEASLFAYV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6K3	60S ribosomal export protein NMD3	2	406-437, 465-490	PDVVLVKKHYPNRRKNRRRNWKLKRMAKDEGD, LRQALALYKNTKKKKKQDADAMSIAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6P4	Purple acid phosphatase	1	597-618	ELTLIKKKPGRRGGGDSKHRYG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q786	U3 small nucleolar RNA-associated protein 25	1	572-592	TERAHHFRRYRIKGVKRVVMY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7G0	Ribosomal_L28e domain-containing protein	1	219-250	DEEEVKKKKKAGDKRKRGRAVKPAARKRKEIE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8A3	Uncharacterized protein	1	480-500	GSSPGRRTKIKVVQRERPDAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8M5	Uncharacterized protein	1	68-89	ESRPRTGRPRVLTRKAKRNTAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q951	Uncharacterized protein	1	434-477	IEFKHKRVYSLKPPRKARGWEAKRQGPKYRHLWKYTKRIKGIKF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBM2	Cytochrome b561 domain-containing protein	3	519-541, 714-733, 827-853	GYPTPSRRDSKRRSYRPPPSGVT, TGSGGRRYRRRDSSSRGRAE, LTDGAAADRRRRRRLERRDGSRHPASV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC15	Uncharacterized protein	1	24-45	LRSCCLRRWRHRTKSLAPRRGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCX8	Protein kinase domain-containing protein	1	849-870	QTSNRQPRRGSRAQQTGRGNRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDK0	Uncharacterized protein	2	11-30, 495-515	RSYTLDSVSPRKRRRTLSTD, LEEQREVGGKRKRGKQKLRLN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QED2	Uncharacterized protein	1	6-27	NWEYVKSKSRGRRSAAQRKAAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG68	C2H2-type domain-containing protein	1	175-198	AAQAHLRKHARKHRPRFRCPVAGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG69	Uncharacterized protein	1	788-819	PRVTLPHQRKAHSKRRWRRRARDNTPAIKTPM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIA1	Protein kinase domain-containing protein	1	148-172	TAPSHESQPQRRRKPKYVAIKKIYV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLK4	Uncharacterized protein	4	2-22, 237-259, 497-518, 603-654	SRGLQRWQQHKEHGNNERRGS, SLKSHGSKKSHQHREQNRHGHEK, GEPDPKRARRWSLHRRDWSRED, GEWRRRSSDRSYQRRTSPSRGRDRSRSRSRGRSQRRSHSRSHSRGRYRSLSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM71	Uncharacterized protein	1	249-281	VRLTRFHERPALKRKRLKRERWQERFRQGFRAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNQ0	Uncharacterized protein (Fragment)	1	5-35	TYYNYGKKGHYKRECRSPKKEWKIVPRKEIT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPB4	Uncharacterized protein	1	1-23	MSDQRLPVRRRFKRLKIAIASCN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPX9	Uncharacterized protein	1	525-546	ARSPEGPRKRARKPRSDSLSKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD3	TPT domain-containing protein	1	78-97	SYLGRWHPRRDSRVKWGPRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW7	DUF4110 domain-containing protein (Fragment)	2	1-40, 568-593	MAKDKKGKSESKKAKLAEKKLKAEKKAEKKAKMKASKMEG, NEEPKPKLFTESKRKKKQASEEASNA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1C2	Uncharacterized protein (Fragment)	1	147-167	CPLGPRCDKKHVRRRMCPYYL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q274	Uncharacterized protein	2	22-49, 84-104	YKEVPAPRTRKAKPRTPRSPVKERYSDS, APMLSKRRPVAPPRRAPVRRY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q284	5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase	1	474-496	RVLGIKWKKGTKRPDKSNAIDLL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2K1	Uncharacterized protein	3	144-165, 211-232, 294-315	KECPQCKHLRCKQCPRVPPKRT, QDLYYRKPRQRIRRTCCECERL, ACAKCSHTKCHRLAPRKVEPEP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B6	Lysophospholipase	1	794-832	RIRATVRAVYERKRRRREERERKEKTAEWRRQVRKGVAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4G7	ANK_REP_REGION domain-containing protein	1	507-526	PIYRWGPDFVKKQRRERREE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4L3	Uncharacterized protein	1	352-379	GLKDLFRGNYVRKRKKKGDPSAGTRSHG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6B9	BAH domain-containing protein	2	20-50, 414-438	PFTIKIVDPKDKEQKKKKRRRTENGDEEDAA, GSSKSASGRKPGRPRKKGAGEANGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6F0	Uncharacterized protein	1	879-904	ELGVRRVRRFTEKRRVRKSQIRRPFL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8F7	Ribosomal_L7Ae domain-containing protein	1	7-61	VEVVDDKKLKKEKKSKDKSEKKEKKRSESDGIRKEKKDKKKDKARQDKLARALDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8Z1	Uncharacterized protein (Fragment)	1	57-76	KNSESNKKKKLAQNKRAGNI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q946	Zn(2)-C6 fungal-type domain-containing protein	1	74-93	CDMCRKKKIKCDGKLPACTH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q972	Signal recognition particle subunit SRP72	1	582-643	GAGKGKQQAQPAKKRRKRKLPKSYDPDKKPDPERWLPLRDRSSYRPKGKKGKKRAAEATQGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA82	DUF2183 domain-containing protein	1	305-327	TEKYKIDRIKKIQRWLPRRKVIC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBR2	Uncharacterized protein	1	35-61	ANQVRLQQQQQGRRRRQQQRDYAVFLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBY5	WHIM1 domain-containing protein	2	46-66, 295-319	ALEPKEKTPARPKREPSPPHE, EATEEKRRRREYRQMRKEQFRRPEP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC53	Urb2 domain-containing protein (Fragment)	2	127-152, 695-719	DAPSPGSPANPRKRKRPDTVGFHAAS, SIGRCLSKVHKRSNRRSRDKLPVDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC87	Uncharacterized protein	1	539-573	MPDGSERVKYKRVKPKKRKKRKQGQWTRQRRRSVW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDV1	Midasin	2	597-620, 1587-1607	RASFVKQRRTSRVSKSKRPFATTV, SKLDKRFKSRGGNKKHAKPIS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFC6	60S ribosomal protein L13	1	7-33	QTIPNNHFRKHWQRRVRCHFDQPGKKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFS2	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	2	624-653, 786-808	TLASWKPSRRGNFHRKRRRYARIRHIVDST, AEGKVAAKGKFKRRKVDSETATP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJU2	Uncharacterized protein	1	226-248	NGGTTRCGRNRNNKNRNGNNGNN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZY0	ANK_REP_REGION domain-containing protein	2	815-846, 1214-1240	PSELREKRLPLRKRSRSWKRSRKRSSVAQALD, AGLATEEKTGRRRRRRTDEITQRYDSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q278	rRNA-processing protein	1	95-120	QLAAKMHKKRLERLKRKEKRNKLLNS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3F7	Uncharacterized protein	2	79-104, 112-135	AFCATCFRCRNCKRKIENLRYARTSH, HESLMARRRKKSKAAAQAKREKDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q442	RING-type domain-containing protein	1	1-24	MENMPRPYRRRREKKLMPIDEVNE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R4	Pescadillo homolog	3	1-20, 619-642, 644-693	MGKLKKKGKAGQAKNYMTRT, DPKTKAKLEAKKALERKKKQEAEE, ERAKGMLSKKKRKLFEQMQYSNNKKSAEDMKLRQKRRKLEKEKKAAASAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7I0	Uncharacterized protein	1	109-130	LPDPQSDKARKRRSSRTAAFST
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8P4	Ribosomal_L16 domain-containing protein	1	1-31	MARRPARCYRYCKNKPYPKSRFNRGVPDPKI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q947	Uncharacterized protein	1	17-41	GTRHDHDHHHHHHHNHNHNHNHQHL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBV6	Diadenosine tetraphosphate synthetase	1	128-155	GQKVEEKEEDPKKKKKKSKGHEAVKLDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC72	Rhodanese domain-containing protein	2	747-767, 929-954	LIPARKSERRRTVEQRQKELE, DTPREDTLKKASKKRPQLWERLRGAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD66	Zn(2)-C6 fungal-type domain-containing protein	2	2-47, 52-75	VYCGKPSKGCSNCRERKIRCDQKEPGCGQCEKRRQRCPGYRNLVDL, ESSHVIKKAKARARKRANLATSPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDF8	Zn(2)-C6 fungal-type domain-containing protein	2	7-60, 62-84	DTEPTRRRLRRGTSSCHECRRRKVRCDFDPGSAGSCTPCRRRRLECVPQLKQAF, YDVSTTSRYRKVRQRLVRLEALV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEP4	Uncharacterized protein	2	393-413, 569-589	DARSSHRLRRRRKELDDEDKG, LPSSNRWHSPRQKIPLQKARP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF65	Casein kinase II subunit beta	1	297-324	ESMTHSRRPPTARRRRPGGNPALRQRQG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFQ9	Uncharacterized protein	1	535-554	LKNLAEKVRLRNDRPKSKTQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHH0	tRNA (guanine-N(7)-)-methyltransferase	2	1-24, 26-46	MGGDKIKKDRRQKREAYRAAMREE, ISELPRKKFYRQRAHANPFSD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK16	Uncharacterized protein	1	553-578	SGDGAVSPRKTRRKRQEGVRVKVKDV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKS1	Mitogen-activated protein kinase	1	248-269	RFVKSLPRRERQPLKNKFKNAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLP2	Uncharacterized protein	3	126-147, 261-280, 557-582	GRWPYESKKGFKCKTKKLVEGG, AKGRKPVTGKGRKTKAKKEE, TKPVAPPSNEKRRRGRPSKKSTASQA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMZ9	WD_REPEATS_REGION domain-containing protein	1	136-168	LRHLTRRTLRLPKTPRKDPKKDLYKVLRKNPTF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN06	Uncharacterized protein	3	44-68, 290-315, 392-414	QAEEEKRRARLRRDAQKVRRARVET, LTPPPRQGQRHPHRRRRQPCAPDPDA, LYDVRFLRQRRQQHRQQQTLPLF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPQ6	PAPA-1 domain-containing protein	1	470-490	ETINKLLKKQAPKTNRKTAAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQA0	Glyco_hydro_63 domain-containing protein	1	11-39	TEEERRLKEDRERKKYWKKWGSYLSERQW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZN9	Uncharacterized protein	1	340-359	KYDREMIRKRERRDNKEASR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q047	Uncharacterized protein	1	67-93	AVEPRTDRQRRGPKRQRTSPTRPAGNT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0E4	Uncharacterized protein	1	545-569	MDGTLGGGKRRKRKLKSSIRVLGDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0L5	Uncharacterized protein	1	3-65	LTPIKVKGKAGPRKTWKPPTDRTRKAKRRRDEEDEKEGGEDGSDRPPRRRFKARKPAEPIEEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1P4	Uncharacterized protein	1	122-146	LPAQNVLKKKPYRRLARREHPVSSF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3C3	Uncharacterized protein	1	206-226	ATEGRQKQTKHRNSPDHPTQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4T7	Transcription initiation factor IIF subunit alpha	3	22-52, 197-216, 573-592	KPTTANPLVARKKPRPKPQFSRPPSKVPGKG, VLKTNEPKPKSNKKEKPTAF, AGAKLKKKLKVKPGMRPGAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5A6	Uncharacterized protein	1	236-255	CLRNRAVTRRRRRAPPSLPF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6E7	PHD-type domain-containing protein	1	454-477	SDPDFPYMCPKKKCKPHNGWSAIL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6J5	DOMON domain-containing protein	1	388-409	IYFCLWKCSKRGREKEGSIEMP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7E8	Ribos_L4_asso_C domain-containing protein	2	188-213, 304-324	SKKLRAGKGKLRGRRHRQRRGPLVVY, KGEARTKRSAVQKKNPLVNKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7K1	Zn(2)-C6 fungal-type domain-containing protein	1	21-43	AQACDRCRSKKIRCDGIRPTCSQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q871	Phosphoinositide phospholipase C	1	242-261	MTLTKVSKKKSTKRITLYLD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA22	BAR domain-containing protein	1	418-442	TGVKKAPPPPPPSRAKKPSLPVPAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAI5	Uncharacterized protein	2	1632-1651, 1863-1925	KSAATKTKKKEKTVTPSNIR, IEDLPKKSSKAKQEPKQQQHEQAPPRKEARQEPKQESKKETKEEPKQEPKKENKKGPEEESKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBH6	DUF4211 domain-containing protein	4	17-44, 213-242, 286-309, 548-575	GRPPVRPTIKTPRKSKPKQNSSAPASSS, APTPARPTRARRKPLTKKEKARELLRRKRA, PKVDDEKERKAKKKKEKEEEEEET, PSALAERERMRPKKKYKLVDKIMSRWVE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBH8	Uncharacterized protein	1	504-528	GLRPSGRRKSEEERKRVQKKSSSHW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC82	54S ribosomal protein L31, mitochondrial	2	17-42, 77-103	WKIPWRLSPTQKARQRKRLRAVDQVV, KYTMFDRKAKRYRKGIHKLPKWTRVSQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QER0	Uncharacterized protein	2	1-25, 31-51	MPSHKTFRVKQKLAKAQKQNRPIPQ, TGNTIRYNAKRRHWRKTRLGL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHQ8	DRMBL domain-containing protein	1	44-63	ILEARVQKYRHLRNLFKPIP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLG9	Uncharacterized protein	1	276-297	LLVRQQRKKAARRKGSRSTREG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM15	Uncharacterized protein	1	324-353	SESQLLGPKRRRHHARKRKRSAEPESRTLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPT7	HECT domain-containing protein	2	68-89, 673-701	DEDLHPRRHQAPSRPRHTRSVS, LGSRQTQRSKKQQDKKKKKVVYRVDWRIK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ04	C2H2-type domain-containing protein	2	208-227, 367-388	TPRPKPQRPTSEQKARRRPG, VENEEERKKRQARVNRVLLQRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZH9	Heat shock-like protein	1	43-63	APAPRRPSARRSRPQPSTFNP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZT1	PX domain-containing protein YPT35	1	313-333	LPPKSVLKRFHPRFLEKRRAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0A3	Homeobox domain-containing protein	2	68-95, 122-148	PSATREDRPKSQHPKGKRNRTSPADKAV, KQAVRIWFQNRRQNDRRKARPLSPQLI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Z2	Uncharacterized protein	1	78-97	RDGNPKPPPNKARDKLQRLT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2X8	GPI inositol-deacylase	1	33-56	RPAARPASKLDRRRSADRRPSLSI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3D1	Fungal-specific transcription factor-like protein	1	44-80	ITTPHACAECKRRKIRAPKRCFYDKHRQRVIPSRKTL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q558	FHA domain-containing protein	1	49-72	DGWSNPPGRKRPSTKGQWSNGKAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6G8	Uncharacterized protein	1	833-859	STVSQQPQKKQQPLKRGQRGKAKKIAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6T1	Uncharacterized protein	4	328-347, 683-719, 789-811, 953-974	SEPPKPKPVPWYDRKKKQLI, GDEWGEPGPKRRKKRGGRRPGAGRKKKQPQPPVPAEA, ARPGAGRKPKHRPPGAQKPGPKT, DDVVDRSARKRQKPLRYRDDEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Y9	Uncharacterized protein	1	258-286	QMRDREERERNWKRFRKDIEKRTNSRLPF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8D0	Fungal transcriptional regulatory-like protein	1	17-48	SNEPRESMNCKSCRKRKIKCNRLRPACEACQV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8M6	Uncharacterized protein	1	12-78	DDEPAPPSRDDRRERRDRKDRKDRKRDRSRSRDRSTSPRRHKSRRHDGDESPRRRSRSPRGDRDGGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q948	DUF676 domain-containing protein	2	541-563, 581-608	QKALDKRQRKALKEAKKMEKEQA, TKVEERTGKEKPPRRRKFCMLPPKSSDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9S6	Uncharacterized protein	2	200-219, 263-292	KNSNKNHKTRVDRKGKGKTV, QHQQQQRPEQHHRQQQHRPQPRPQQQPYLL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC2	Uncharacterized protein	1	325-345	RDEFIERRKRHGKGRTRVVID
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB56	Uncharacterized protein	2	128-151, 183-213	SPSPAPKRSRTPERRERRRYSPSP, APASRGSRSPSPRRRPSPRRERGGRDSRRHG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBW6	Uncharacterized protein	1	39-60	ALLVLLRRRRRQKQMMDEKLPQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCR2	Palmitoyltransferase	1	447-474	CMIRTPLRSKHCRRCQRCVAKHDHHCPW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD87	Uncharacterized protein	4	26-45, 244-267, 668-688, 776-802	TPDPPSKKARLDSHRQLFVR, EAKAKSPKEKKSEKAKSDKKEEDE, ENAKVVQRRRQQEEKSRMAKE, KLALRTKIIARKRMMRKKKAAMRAGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFU6	Uncharacterized protein	2	81-101, 394-421	GEVTLRPRKNARRSRLDRIIS, LIEPPSRRARGRSRSRRRERDDAGPTRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH94	HECT domain-containing protein	2	40-88, 1571-1591	IPPTPTPAPSGRKRKNHTSPPQVAIESPSSTRRSKRQRVTQALPHPQPS, SKEFCKKKLKLWRDNDPNGHD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJR3	26S proteasome regulatory subunit RPN2	1	917-940	LSTTAQAKRRAQKKERAQRRESMD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL20	Uncharacterized protein	1	83-107	HSRVPTASTLRHQRRRRKKRKRANI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM19	Uncharacterized protein	2	1-22, 30-54	MDLTEKWKRHLRQSSRVPKDTN, RREGSRSRSVSPPKRSKARLAANPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN96	Chromatin modification-related protein EAF3	1	1-23	MPPQKHHHHHHHHQQQQPPFQKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QND6	Protein SDA1	5	251-294, 493-517, 557-578, 693-716, 730-749	IKKVKHQGTINKKTKKRQKAYEKALEKIKKQERKKHAPHPLNFS, IELLERYKEEQKRKKQEERALKNGG, SEDDEPAKKRRRKDDEQDTEEA, DAEGKSTTNREKARKKNFLMTLGK, RTMRAHIARSKRGGRRRNGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP15	Uncharacterized protein	2	78-100, 866-887	FDGPNKPAFKRNKRSSGRGDSVS, NERVLQGKAPRRRAWRQSEVSV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPF1	Uncharacterized protein	1	9-33	PPAPVESKSAKKKAKAERTESPAPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPT3	Uncharacterized protein	1	117-141	LPKSRQSMARSPPQRRRRNTSIDLE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q017	Uncharacterized protein	1	3-37	TVENAKKRKLQDDEKPRKKHKKHKKVREDEADLDV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0N4	Non-specific serine/threonine protein kinase	2	651-670, 1050-1077	FSSIRNRSQHHRRNRRTTLA, PEEVQLHNEKKKRKRRSSKEPRVLSGTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Y5	DUF3395 domain-containing protein	1	641-664	AFAAWECYRRRRWCARKASSTSTT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3A6	Uncharacterized protein	1	193-224	EAEPMRTMIKKKRRCRRAKRVTSKHRYTVLRI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3B8	Zinc finger C2H2-like protein	2	506-527, 531-556	RENLKGYLRKHKNTHKGVRLAC, GCVKTFSRLDNLKKHKKDKHGIEDAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4R2	Uncharacterized protein	1	383-403	VANGKLVKKNRWSHRGAKSTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4V2	Uncharacterized protein	3	45-65, 193-235, 272-303	QTDIQRGRKRHRAIRDIKVTT, DSPQGNWQRQKERKRERERERKTAKRRVVWRRRSQSPSRSRSP, VNSSKSSSSGGRRRRRRQRTTSRSREHRVLAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5R7	Protein-serine/threonine kinase	1	27-52	STSAHQHSPRRHHGDRERRRHDHDVV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5U1	SAM_MT_RSMB_NOP domain-containing protein	3	34-68, 662-684, 707-733	DVPTEDRSSKKRRTSTKSDKPAKKRREEASKDEVT, GLDPRALKKGQEKKPPKETESKE, EKSADAREQNKEKPKEKTKKSKGKERK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q626	Inorganic pyrophosphatase-like protein	1	353-375	DEPWVIRYRKRHMLRKIFDREVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q647	Non-specific serine/threonine protein kinase	3	28-47, 51-83, 148-176	VDRTGRHRGRYPSRTPERDL, ESADGPRRSRSPRGWKRSREDHRDRRDSRQFRV, DDGYPDKRARTRSRSPRGRGDRTDRTDRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7I5	ABC transporter domain-containing protein	1	254-277	RDDLRERGPRSQHKHKRGPEGWTY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L4	Uncharacterized protein	8	84-113, 141-172, 2564-2590, 2684-2710, 2746-2785, 2808-2838, 2909-2937, 2973-3000	VPAAGASASKKKKKKNKKKGEKAAEKAAEP, PEEPTTSGGNKKKKKNKKNKDEKDAKSKSPTE, VAKQLGRMRSLRRQRRKTIKQAEEMVA, IAHSSRRHSHHSSRHRSHRDSRDGSKD, GEHRSSPHSRRHRTPEEQAAHEKRKEERRRARELEKAKDG, RSSEHHRHSHHRDSRRHSQSRHSMEPRPSNV, RSEERGSRENKDRDRERERERERERERES, DVDSQAHRAKRQEKRERAKEKEAKEKGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8E3	DNA replication licensing factor MCM2	2	12-32, 158-179	ANRGIPPSRAGRKRARTNGDD, IDLTAQPRRRRHRYDEDPDEDM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8H8	Uncharacterized protein	1	269-348	GVVEVEGRRKKKKKTRPGKKRRIVLRKREKIRREKEAEAERLRMSKEEHLREKKKRLNREKKLKRRQKEREKKMAARAAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8P9	SP-RING-type domain-containing protein (Fragment)	1	1-23	MNPGAQPRKKISRPSVPRPPAVQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9C9	Serine/threonine-protein phosphatase	2	61-82, 352-371	ELRQGARPPKTRQPPTPPREAD, LDDIRRFDRHKQRQPGQSGL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9R2	Uncharacterized protein	3	1-21, 193-219, 250-276	MSRTHDRWRRSARGRDHADDS, VKTECPDVRRHKFRRWKNPKLQEPLMY, RFDRIEARRREREKRERQRVLHQKRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAH8	PH domain-containing protein	1	15-40	SPYHVGVLLKRRRKKGQGYARRFFSL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAX8	Uncharacterized protein	1	504-525	GGVPLHTRARGRKNRRDYPSSW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB72	Uncharacterized protein	1	351-372	ELERATKKPPPKKTKISILTSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC43	Uncharacterized protein	1	1060-1086	ADSQQREYSYRHRHRHRHQRSGSSGGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCK9	Uncharacterized protein	1	122-151	KSVSSKRGTKSPRRLFRRLRRALRGRPADE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEG7	Uncharacterized protein	3	720-740, 1003-1024, 1035-1056	NDRAAERKRKAEKEQERKEKA, SSSPSEKTTKPKYYRCMNWQNT, SVEPLPARPRKATKKKEAAMAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEH2	Uncharacterized protein	1	1-24	MVRESQKRKQRKRGPWAQVTEHES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHC9	Uncharacterized protein	2	48-67, 195-220	ASRAIRKKLKYGNLHRQLRA, TYTGYDTKKKKDKKTKKSKPFNLLAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHJ5	Protein kinase domain-containing protein	1	522-543	FGFLRGKKGRGNSPKPKERGVL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHK0	Uncharacterized protein	6	69-92, 113-133, 181-206, 470-495, 773-796, 867-903	LEDGPHPAAQKKRQRRDEDGDDGD, GAGSGHPKKRARRDADEDGFD, AFGGSRSKGKQAKKKRSRDGDEDDEQ, VARAKRIKKIKSKTWRRIHRKELARE, AAIASIKTSKPRPKPQPREAAQNG, EGVSNREKKKHQGRFVTKVEGVKKKDRKDFRLKDVII
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI24	MI domain-containing protein	1	27-58	GQKRGARRVSVTSRKERRKAERQQSRAHRTAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIL0	Uncharacterized protein	1	304-323	CALFYCWRRRKNLREEQELD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q031	Zinc finger C2H2-like protein	1	394-415	GDCEKRFSRKDALKRHRLVKGC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0C9	FK506-binding protein	3	102-122, 135-156, 302-325	PSDPSKSKKARRDAAIKKLLE, ADSKPNGVKNKNKNKGKGKASD, MAKDEKKLSKKQQKKLKNNQGEAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2T3	Uncharacterized protein	3	33-54, 77-129, 544-577	VLDFSRRSSKHRKEGKGIDVEP, DQYQQEFPPRRGRKPRPSLCTRCRYYREIRVADRARRSRGRRRTDKLTARIDE, QARRKAQPAPPRRQQQQQQQKKQRQPGSQPRPMG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5I8	N-acetyltransferase domain-containing protein	1	485-508	SSGSRSSSTARKKRERTYPSAAFG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6U0	Glycosyltransferase family 17 protein	1	51-72	ICRPHGWKPFRTKDPGKPRKVY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q708	T5orf172 domain-containing protein (Fragment)	1	241-260	GPRWCRSPGRSPRQGACRGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q747	Uncharacterized protein	1	589-612	DTVERKKAAKKAKKEAQKAEREAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBM3	Uncharacterized protein	1	1-22	MPSSEQHPPRPRQQPQEPADTD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCB8	Protein kinase domain-containing protein	1	1087-1106	EQQRYFKQRKAYHDKNHSLF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE18	Glycoside hydrolase family 16 protein	1	319-341	STDPDETKRSRRRQQQDGDGCNA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHI6	Glycoside hydrolase family 5 protein	2	3-64, 129-167	RDPPSATRRSRSRHPDPDPDPDRDGYREQRRHRRHSSSAADGSQHQRRTKRRPTSTPRAGVA, EAERERERELRRERRREREREQERERARRRERSRGYEIV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJY3	CRAL-TRIO domain-containing protein	1	53-72	EDGKKEKKGRMSFFSRKSKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK20	Ras-GAP domain-containing protein (Fragment)	1	739-770	RSEAGRPPRNAKRQPGRPRPRVRPVQRAQGVG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK91	TFIID_20kDa domain-containing protein	1	48-72	GRMLSQKLQQRRQAQQQQNQQQQQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKR5	INCENP_ARK-bind domain-containing protein	2	66-88, 1318-1337	KTPGKLRGKTPRTARKAPPSSMR, EVFSKTKDRFHKFRARTSSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL71	RNA polymerase II subunit B1 CTD phosphatase RPAP2 homolog	1	2-24	ATSTNDRQSKPKPKGILKQPSTF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM58	Uncharacterized protein	1	604-629	EGPGGGVGRGRRRRRREWWDVYAERD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QND4	ANK_REP_REGION domain-containing protein	2	89-114, 546-570	INSLAMSPRRQRRKSARSRRTTTVLD, SSSSSGSRPNLKRKKHESREPSGSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2N2	Zn(2)-C6 fungal-type domain-containing protein	1	41-68	GIKCVYSPQKRMGRPRKHRPTEVAAPPT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3P2	Uncharacterized protein	4	13-35, 124-157, 417-436, 514-536	HVERHRVRVREHRRDPSPFHRVP, SSSDDSSRSSRRHRRRHRYRSRSRARSRSSSTHS, LKNEKIKRDKKEEEDKQVAR, EYEFVRRKSSRHRSKSPSLLLYL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q408	SUZ domain-containing protein	1	195-219	RDQDNSRQDRRQQNNQRQNNQQQNN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q536	Carbohydrate-binding module family 50 protein	1	113-133	RDEEKEKKKKEEEERKRREEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X2	Zn(2)-C6 fungal-type domain-containing protein	1	1033-1060	TTGPPPPPPPQQQQQQQQHQQHQQPQQG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5Y8	Peptidase_S8 domain-containing protein	1	191-213	ISISWTFKSKKPREQHDDRDLGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q678	Uncharacterized protein	1	215-262	AEEKAKAKRAREKRKAQQKRRDEEREREKDRIRRERRKFWPRVCYTVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6C7	Uncharacterized protein	1	193-223	WEGYGQRKKDKKLEAERRKREKERAEKEAKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R6	Uncharacterized protein	3	51-81, 168-191, 231-253	VLPKLREEQERERSRKKNKKRSIKDVVVQDD, NDVEVTTRRPKRRRRRGGGAGEGT, EDSAADRRPPKRRKEKAAALGGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Y4	Uncharacterized protein	4	7-26, 104-182, 194-230, 623-646	LPPEKGTDMKKRKDAPAQSR, VPRAMRRRTASHNAKRVPKRLRERARREMIEDNTPTVEARKRRPRTTRARIRAETAKKLAKLAERKRKKMRERAAAEGI, DTRAARPKIRRNTLNEPPKPDSKFRKRQINKTWLPTH, LEQRAKQKQEWDRRPKGKRVEWKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7J8	Endonuclease III homolog	2	74-98, 158-179	ITTTVSHTLKRKRKRTDTVTQSASR, ESETKDRPRGRARKPVRKTTDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8B4	Uncharacterized protein	1	155-182	GDSTEDGTRRRGRRRRRRIDDETRRLLG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9F6	Elongation of fatty acids protein	1	287-307	ATYKKDGKRPSGRKAVRRMSQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDN3	Uncharacterized protein	2	25-46, 72-99	RDVAQGRVTKREKKPPGRIGGG, TDRPSRDAPGKKKKKEEKKRNGKKAGVP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEE1	Uncharacterized protein	5	1-21, 68-97, 117-160, 185-215, 326-357	MESPRSPKRRRILASINPPEP, AHLPRPTKLRFKSKASRSRRREEQQQEEDD, RSDHHHRSDHHHHHHRHRHRPRSRTRSRARDRERRDRHEDRDDR, HHHHHHHHGRQHRRRRHHRHKHRSAEREQEE, EMERCLRRGEERRRRRGWRGRWERYLRRWREW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGQ1	PseudoU_synth_1 domain-containing protein	2	35-57, 60-80	RGNRGGRERGNDKQKRKHSGFGS, GPVPDKRERVQNDRNAKRRKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHH4	Delta(24)-sterol reductase	1	480-501	DPDVARAKKRHWLKRLPPLGGF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKW6	Uncharacterized protein	1	515-541	LRNTRARSRSRSRSRSRSRGRRQPSTN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNW1	Uncharacterized protein	1	2361-2382	EEARRREEARTRERLRRMGRCP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPG2	Uncharacterized protein	2	61-82, 366-388	DGQGPSESKRRKKEDEAEPIMT, PADWSAKQKGRGKNKKTNKGGEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZK1	Uncharacterized protein	2	47-72, 1033-1057	SSSPAARVSARKRRNAKSLQNELPSA, GLDKPSKLGPQRQKRKRQESAVDGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q178	Uncharacterized protein	2	41-64, 319-339	PEPPPDRRLHRSNAVRHRRRSIPD, RGTAYRKRKDRLRKVFKGYDI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3C5	Exonuclease domain-containing protein	1	61-85	WQTIERGRPVKKHKKVPGPGSSRYP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q432	Uncharacterized protein	2	203-228, 269-292	SGPTITLQNKPKKRKKPVHTPTPADD, NTRGRRLGASRRDRAKNRDKESSI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4I9	MFS domain-containing protein	1	589-614	HTEHKTGLHHMKKRSRKEEDDDDDRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q591	Uncharacterized protein	1	571-596	DTDNKEEKPKTRKVKKQVRKGELPIV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5T3	Uncharacterized protein	1	302-326	GHQDHDQRRRRHHHHHRHERSPPPG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q610	Ribosomal_L14e domain-containing protein	1	113-139	TDFDRFKVMRLKKQRRFEERKALAKIR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q614	Uncharacterized protein	2	13-37, 226-247	LHSFLHGFRRHRNSRQHRSDSSEPL, GLAPAPPPRPRPRPRPRTYDGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6H6	Uncharacterized protein	1	117-139	LHHHHHHQHHHHHHHHHRHPRLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6J2	Zn(2)-C6 fungal-type domain-containing protein	1	20-39	SACSRCRSAKVKCDNKLPAC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Z1	Glycosyltransferase family 41 protein	1	1328-1350	LTWDEEQRRRWKMRKDLFPNLPD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8F9	Uncharacterized protein	1	540-606	KDLLRDWKQLKRQQKRARRQLRRERKQQRRQEKRERRQARREQKRAAKEMRREARRRPPPPPPPPPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9X6	Uncharacterized protein (Fragment)	1	56-75	RFRLRHQKTIRITRQTRKAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB65	Protein transport protein sec16	3	1798-1823, 1864-1935, 1937-1977	ISDRTDPRPKPNGPKQPNRPKRGGAS, AGSTRTPGPKTRPRRRHPRRPGQHREPPSAPLAPARRLLPRQQKQPAARARARAPLPRPRVRRAPRAADQPT, VPLPAPRRRDRWPCYGRRPTAARLVPRRWVRAPRRRGRRPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBQ3	SANT domain-containing protein	2	128-149, 227-249	CRMFKGKTRKHIKLKFNREERV, DGEGNKKGGRKGRRKKGPVVMGL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBU7	Mitochondrial DNA polymerase catalytic subunit	3	16-44, 282-306, 477-499	ASFIRLARHRAARRRPWHRIDPVPRRWDS, MCSQQRPTWMKHKKNRELRDKIAKE, IKMVKGKKKNDPPRPAARQKKPG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBX2	Uncharacterized protein	1	165-187	ETALAPPKPRKTKRQLWDDLKIS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCA1	Uncharacterized protein	1	76-103	EKQLNRARVLRERKKAKEQQALEEKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDI8	Zn(2)-C6 fungal-type domain-containing protein	1	199-221	LACIACRRKKIRCSGEKPACKHC
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEA8	Zn(2)-C6 fungal-type domain-containing protein	1	49-79	GKPCSSQTPAPARKRKRPRTTRVAELERRLE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGZ4	Zn(2)-C6 fungal-type domain-containing protein	1	6-34	RRVALACTYCRHRKRRCDAGRPSCRSCIE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH29	Uncharacterized protein	1	173-198	SLLRRLSGPPSRKKRNVPKGGWGLRV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH84	SSD domain-containing protein	1	950-969	ACCVDRRKPCFWRRDPPWNI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH88	Zds_C domain-containing protein	3	573-605, 683-710, 770-790	TSSWKWFKSEDKEKKKREKEKEKERERERERER, VSKKNRDKESSHKKKEHRPLTPDPPPRP, QIPTSPQQKRQEEERKRREAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHZ2	Uncharacterized protein	1	174-196	TPPPMSPKPCRGPKRYQRPATVD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIT1	Uncharacterized protein	1	26-45	LSPTPKPRPLRLRSPQADHS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJL3	Zn(2)-C6 fungal-type domain-containing protein	1	1-41	MASERRSERVEQRRRRKIPLACEPCRERKSRCDGAKPICST
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK88	DNA replication regulator SLD2	2	236-267, 342-361	QQPLRQFKKRGQKRTTRLVKMRPTRTKRPTQA, RSATAKNKDKDNKTNNGRSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKM5	Uncharacterized protein	1	1-24	MSRNVRQKYPPKPVRAPKSRDYDS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN34	Glutamine amidotransferase type-2 domain-containing protein	1	1614-1641	DKTRGFMKYHRRSEKYRNPKTRTKDWAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN81	Replication factor C subunit 1	4	13-43, 45-69, 123-146, 242-266	GAPPPKPAAKKEEQTKKPRVKGRKVVEDSDD, EVIETKKPTRTSPRKRAPAPTAVKG, AANPKQNGTKKKPITSYKKYDADD, DVKPAKKAAKPRAPRAKKQPEPESD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPA9	Uncharacterized protein	2	151-176, 189-217	ESSDEKKLRRSPSKRRKDPSEKSEKE, RDKERDKERERERRKEKEKERERERERAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPC8	Uncharacterized protein	2	34-59, 258-294	VQTANLSMKEKKKRMKQDPYGWAQAQ, LEGPKGHKDKNNKRSLRRLCHKRQRLLRYLERKERGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZM0	Importin N-terminal domain-containing protein	1	66-85	AVKHWEKIPKEQKPAVRQHL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0G0	Uncharacterized protein	1	179-201	SAQGKPKKAKEQPDQDRRQRRID
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J2	Uncharacterized protein	1	18-38	ATKHCAMYKRKTGAKSRCLPE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3S8	Uncharacterized protein	1	759-778	TTTTSPQQPQRQQQQQPGGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4E8	YL1_C domain-containing protein	1	23-49	HSIHKTFRNPHWRPNQRRNKNVKAILG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4V5	Uncharacterized protein	1	441-470	ESSPHSSKAAEKKKNKKKKRKADRLAADTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4Y0	ThrE domain-containing protein	3	24-44, 302-321, 353-375	LSPAPLPPKGKEKKRVGFASD, RSSTPKPDSRRSRPRAAQSS, QEASKSRKTAKSKKKAEEYRIKI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5V2	Sm domain-containing protein	1	44-65	ADTEEFRRTKRKQNKPAAPGSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q621	Nascent polypeptide-associated complex subunit beta	1	16-37	RIGGKGTPRRKVKRAPARSAGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Z2	Uncharacterized protein	1	84-105	ALKEPPRDRKKEKNIKHNKSVS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q804	Isocitrate lyase	1	25-46	EEVKRWWSEPRWRYTKRPFTAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q940	Topoisomerase 1-associated factor 1	4	325-346, 547-574, 950-1002, 1113-1146	RERKMDNSKSFRPPRRARREDM, KQNVDLQVRSRKRRRRRKKAANKAAGDD, RTAEDEPPPPPKRKRRRRRGSDEAETDEQREARARARRKKERERARRIKSAMY, SSSSSSSSSARRPNKRRRTTQKKKNKAAEISSDE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAW2	Zn(2)-C6 fungal-type domain-containing protein	1	3-56	GPGGGPPRRSHTKSRKGCDTCKRRHIRCDENFPQCRNCTKHKIRCPYNDVPVPE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC59	Uncharacterized protein	3	1059-1081, 1116-1139, 1360-1380	DELLRAMDRKKKRKSAVDDRGDD, GAATPKPKKIPGKAKRPAREERFI, AKAAPAPKKSKTPPAPKGKAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEA6	Uncharacterized protein	4	83-108, 191-211, 794-820, 1104-1123	LKDAITQLRRRSKKYREWKAQQLAAS, TEEPPSKKRRIAPTNISNNTT, SDDHTVPSTKKRRRVKRRDAQAAKVRS, DSEPSKKRKARKMLHVLKAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEP3	3'-5' exonuclease domain-containing protein	1	216-235	YDARLRRKPGWEHKVRDAAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF30	Protein kinase domain-containing protein	2	198-221, 423-451	GDGGCGRKRRWRRVRGRKEAEKDW, FDDLWFRRQNQIRLRKRRRRAEEEEEADE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGU6	Uncharacterized protein	2	34-79, 90-122	DSDPSAVKIEKKKKKKEKRDKKEKKEKRDKKEKKEKKAREDQSEED, EADSEDRPAKKDKKKKKDKKDKKDKRDEETSNV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIS8	Zn(2)-C6 fungal-type domain-containing protein	2	61-90, 92-119	ALNPRSCVTCRRRKVRCDKHMPCSNCRRAQ, PCIFPAPGRAPRRPRPKDPNAPAKQPSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ16	Uncharacterized protein	2	466-490, 566-587	HSAVGPVSRRWRRRQKHCPGASSCG, HDEARAKKPPKQGDNIERKSVS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJH7	Ubiquitin-like domain-containing protein	1	71-109	LRLRGGAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKVD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKR7	J domain-containing protein	2	23-45, 516-537	AEVKKQFKKLALKWHPDRNPGKE, ASTSPTRPIRPIKKPRPVRMTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLD4	AB hydrolase-1 domain-containing protein	3	36-57, 59-79, 735-759	DSSSCYPAKAAKPRRDRDYDDV, ADWTSRSRDRHADRHHRDQED, SITSSLPKQKRVKRDKRGNGTGTRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMF9	SWIRM domain-containing protein	1	217-240	AVRVQKPRSPKTKPQQPRPIRATP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMU4	C2H2-type domain-containing protein	1	422-441	GPYMCECCPKKPKKFETEED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN99	Uncharacterized protein	1	1-21	MQAKKRGRERPPRASNPDAAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP45	Uncharacterized protein	2	13-35, 63-85	NQANLPKGIRPRKGNRLHPTTPS, DNPEPDPDPKRQRTSPRPTKDAF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP64	Uncharacterized protein	3	35-94, 100-130, 164-184	RSEYDRDRERDKDRRSRDRSRDRSRDRSRDRSRDRSRDRSRDRGHRRRDRSSGRYRNSSS, RSEAGSHRSRRRSRSRDSGRHSRRHRNDGDY, RGYRRRDDDRRGRRHSTPRDP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPT8	Uncharacterized protein	1	184-205	LGIFLWRKRKQRRDAEEQRRKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ41	WD_REPEATS_REGION domain-containing protein	1	702-730	IPLTSAPSSKKKSKKQSRASGSRNKPDDE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q062	F-box domain-containing protein	1	150-170	EEERKRWRKVVNRRHEPPPNP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q079	Uncharacterized protein	1	59-85	GENVMGKWHESKKRKFRPTELRFEVRF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0B9	WD_REPEATS_REGION domain-containing protein	1	307-327	GSIKVFRHRPRRGGHVKREDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q181	Tyrosine--tRNA ligase	1	537-559	LKEAEEKEKKEKEKEKEEKEESA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3J2	Uncharacterized protein	1	190-210	LLTPRGRRRQQQQQLGKKYRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5A7	RING-type domain-containing protein	1	403-425	NPLAPRPRPERERDRQRPYRSMQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q659	Uncharacterized protein	1	470-490	PSPPRKVKLDVPKSKSKKSFT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7X9	Uncharacterized protein	3	56-78, 152-181, 186-207	NLPGLDKDKKKKQRVYTEKELGI, KAKLEETKESLRKKRKRNKGKARKEEEEGE, VAATGTKAAKPKKKKRVSFAPE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAH4	TPR_REGION domain-containing protein	1	98-123	WKEVDDRMARRRQKQREAREKAEREE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAY7	CNH domain-containing protein	1	1130-1150	GTAGATRRHLRRQGRERDGDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB93	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit	1	7-32	RVLSRGKDSSKSSKKNKDSKDGTASP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD41	Clr5 domain-containing protein	1	58-78	TPKMYRTRIRRWGIDKNNKGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE46	rRNA-processing protein EFG1	2	13-44, 246-268	QPHEDAARKRMKPNRPHKKKQKKPVDMESLAA, SRSGSTKVEQKHSRKNKDEDGDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF08	F-box domain-containing protein	1	136-157	DIYARCRQRRGRGKASRTSWHR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFX9	DDHD domain-containing protein	1	923-942	EEERKAQKLKREEAKVRALN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGW4	Peptidase M20 domain-containing protein 2	1	403-422	LDEVKRQWRRDMKATREQFE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHC6	Uncharacterized protein	1	302-333	RGPGRLQSSTRSRRCNKKKKFAPSIQDCHDPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHH5	HeLo domain-containing protein	1	105-128	AVSYEAKKKERRHLRGTNHIREFF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT2	BZIP domain-containing protein	1	192-212	RNTLAARKSRERKAQRLEELE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIT5	Structure-specific endonuclease subunit SLX4	4	164-193, 301-323, 708-728, 786-808	NTLPKSRVRTTVKERRPKKRTETVSRHFAP, SPDASPTKPKAPKKRPRTITDLA, TEAPQPMKRPRGRPRKSSTAS, RTATSPKNARCSPKRNNPAPSTP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKT0	KRR1 small subunit processome component	2	220-250, 279-307	RYLPNFKKRTLSKRRKPYKITDKSKKPYTPF, AEAERAEKAKQKKEEKKREREREYVPPEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMU6	Uncharacterized protein	2	74-102, 154-175	IERVKKEYEERQKQKKNKEKKKEEEAKGE, TFYNRRLSKKRQAEIARRNFET
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q134	Septin-type G domain-containing protein	1	130-152	ISTINSPRRVRRRKDPTPFNILI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J6	Uncharacterized protein	1	551-577	GRKGPAASKRSGRPKKTERGQQKLTFG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q243	AAA domain-containing protein	1	9-34	DLDRRERDDKDKKVKNDDNKGNQNGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2J7	Cytochrome-b5 reductase	1	81-104	MPKNTLKFWKNLRREKLNNTNCLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q300	Uncharacterized protein	1	117-140	WVYVALRRRYRRNQTLKKLRAEFF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3N8	Origin recognition complex subunit 1	2	209-233, 605-625	QEMVRKNTKATRRRKQTRDEPTDQD, GQTPSMKKKKMRSAAGRVTIE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5S6	Chromo domain-containing protein	2	118-142, 409-428	ERQGAGPKEKKKKPGRPAKIPMEDV, RYRQKKKAGLLKPPKSSQKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8R3	Uncharacterized protein	2	19-44, 353-372	NGHTAAREAKCKKCKKVFDICQVNYH, KEAAKGKGEEKKEKEKPRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8U6	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	2	78-97, 527-563	SKVDTGSRGRKRKRDAADDD, VDKLARKQERREQLQKVQGTGGRKARRKERDEKLGEM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAI1	Uncharacterized protein	1	310-336	GTTPRPDRYNARNKHRRPSFGNEKPSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBI1	Phosphodiesterase	1	870-895	PADPGARQLKKKPSRFRINGLQNLFR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBL8	Uncharacterized protein	2	351-376, 514-536	EEPHHEPERKLKRPRTRRLPPTNGES, DNSDSEHRGRRPRQPVRHGPLEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCG2	N-acetyltransferase domain-containing protein	2	39-58, 591-613	DSQRKLKPPSQPHSHVRNEL, PDNSPVYKKGPNRQRQYFKVYLN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEW2	Uncharacterized protein	1	10-35	LEYYRDLGRHSRKKRGRGIVPQPTVP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF57	BUD22 domain-containing protein (Fragment)	4	141-162, 331-354, 372-396, 448-509	GVPVPEKKGKGKKGREEKTEDK, SSESRSPPPKKAKKAKGALKPTDS, SDIDVAPKRKNRRGQRARQAIWEKK, TNETKQTNEKKQADNEKKQPTDEKKKKPAPRKRDDTGPLHPSWEAKRKAKEKQQLSAPFQGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFE0	Uncharacterized protein	1	118-143	VSLFSSTRRRRTRPPHHHHRSSRSGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFT6	Uncharacterized protein	1	5-30	YVEVRVALQRRVRRRRPWLEAAQTPF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGB1	Uncharacterized protein	2	29-49, 51-78	AMKERRGRRPGPNRARERRVP, LSPQSPPLPSRRKPRRERNPWPMRFVQT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGF1	Uncharacterized protein	1	52-73	APVGLSKREKAKQHFRRFWWAY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGR7	MYND-type zinc finger protein samB	3	54-79, 1154-1183, 1335-1364	GLTRRSKSAVRYRKWLKGRKGDCSSL, LPLDPAPRPRPPHRPPRLRRAPAHARHHAR, AKCLKVKYCGRTCQRADWKRHKKECIAKHS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHP1	Fungal_trans domain-containing protein	1	103-130	TSSSKRSSPGRSDIRRRRHQQQSFSCTT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI01	AAA domain-containing protein	1	429-448	TSPVGRRRKNHRPRLSSSPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL41	Zn(2)-C6 fungal-type domain-containing protein	1	118-142	QLGCEYIRERKKRGKASRKDLAQQA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM63	tRNA-binding domain-containing protein	1	186-208	AGAAAKKQKKEKKERAPKQPAAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNW0	Uncharacterized protein	1	3-24	PSWYYQKPPSWKTRDANRARAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPS7	BHLH domain-containing protein	1	375-396	GTPSDPTQTKRQRKSGTGKSGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q251	Uncharacterized protein	1	110-131	DQTDDEKSKKRKREALEEADPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q292	Uncharacterized protein	1	41-61	TQFSIFVRKHHCRKCGRVVCN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q309	Uncharacterized protein	1	533-571	FLYFFRKRERRMRLYSRFSQVIRRQRKPGHSNPRKNGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Y9	Zn(2)-C6 fungal-type domain-containing protein	1	69-112	HIKHRRTRSGCYTCRSRRVKCDEARPICERCRKGKRECNYPEPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q470	Zn(2)-C6 fungal-type domain-containing protein	1	42-68	AAQACDTCRSRKQRCDEQRPKCGTCQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4V3	Uncharacterized protein	1	100-121	QERPAVPQPKRRKTTNENDPTP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q592	Chitin synthase	2	785-812, 815-839	MRESRVWRRLSQRQRRRRQQERGYVVEV, DDGGNRQRPQQQQQQQQQQQQQPRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q631	Uncharacterized protein	2	135-155, 978-1003	DDLKCKKCLGHPSKRRKMLTM, QGDEITPRRPSKRRKMAAEDQPLREN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6T3	Uncharacterized protein	1	272-293	KLSTRARALSQRRRNNIRARAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7J3	Uncharacterized protein	1	639-660	TTTATSRTSRKKTKQETSAYTR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8V9	Uncharacterized protein	2	62-81, 185-209	RSPLNSTPAKRRGRPPKSAA, TTPSRTPGRKRRTAGRKRSPTPPRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV6	Uncharacterized protein	5	167-198, 233-253, 336-358, 454-485, 545-566	TEEDRLRIRMRQKPKKKKAKPDQSEDKENRDG, DDNWMKGKKGRSPPRNGPTGT, DDGIRVKPIKPRKPKPDTDDGIR, QTAPETPTKRKVSKRHSKRKSHGHSPNPVVRT, ADARNSSTKRPKAQRNPSFKAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCP1	JAB_MPN domain-containing protein	3	50-79, 169-198, 494-515	DPQIAKFAQKKKEWLRSQRNRFGEKRKGGF, QWATMWSTMRKEKRDRRLFKRMRFPPFDDE, LNELHKKRPKSMQKQSLLRTLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD28	Uncharacterized protein	2	37-61, 72-104	QPADEPHKGKEKKKKKEPLVASSPK, AEEREERKKREKEEKKREKERAREERRRETKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDV2	AAA domain-containing protein	3	26-64, 387-417, 427-454	DPTEVRPTSRRSAKKSRSSKSKGRRKRSNRYRGSDIDDD, ESTPTPRGRGNRARSRRSRRKKDDSGDEDIE, LEELRESSRSRPRRSRRRSPSIQYEEPI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFJ5	Uncharacterized protein	1	499-522	SDEEDARPRKRQNRRTRAVAPSDE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFR6	Cation_ATPase_N domain-containing protein	1	1063-1088	NDNDNNNGRHGRRRRRRSGTGPASVL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFU7	Uncharacterized protein	1	468-488	LMFLNRRHAKRREQLGKNAVL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFW3	Mannose-1-phosphate guanylyltransferase	2	79-99, 222-266	EGSHKRKRSLSDSPRRERPPS, GIVQSDPKKRKRNFSNRTKTGCLTCRKRKKKCDEKKPECNNCYKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHV5	NIBRIN_BRCT_II domain-containing protein	2	499-521, 588-618	APASPKGKPKKGQAKGKGKKIKE, ADGRWDPRWNGRKNFKRFRKQGEPVGRQPPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIA5	Uncharacterized protein	1	296-316	RGKGAKGKTRKGKGALKQEGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK18	Uncharacterized protein	1	53-75	ALKASECRRKRTGRGLKITREAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPP9	Uncharacterized protein	2	610-633, 807-830	QSPEMSKKGKPKPAKAPPGPPPDI, VQIKGGKPPTPRMPKRHKTGNNPV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ69	Uncharacterized protein	1	18-40	ASAYSKRHPRYMRLRQRFNNGTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ93	Uncharacterized protein	4	152-178, 189-227, 269-293, 1648-1676	TTRRLFQSPTPKQRRLTPRREPKTMVT, DDEGVTPRRRGRPRKSGTPTTTRRKRPGTPAKVLRKSTG, GGAPGSQPRKRGRPRKQTSTADDLA, PLELQRQLARHHHRDRRHRPPRSSFSFSF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQC6	Uncharacterized protein	1	750-827	REREREKVPDKDRENKNRDKERARDRYRDREKDRERERDRDRDRERDRDRERERDRDRDRDRDRDKERERPRHPANGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQF3	Uncharacterized protein	1	43-67	SSSSLRSASSRRRRQARLRRSLSLV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0H0	PNPLA domain-containing protein	2	886-909, 1298-1333	GLDRRRARERRAKAHPRRRAKSEE, NAEYREYNRRKLRAREEERNKKKRNGMKQPAAAARA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0R1	Glycosyltransferase family 1 protein	1	11-30	QSPQDPSYTRERKNRARIEN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1G0	tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial	5	81-103, 165-186, 558-578, 1067-1095, 1632-1692	VRGIARLTSRRRQKAQNAKFGIK, TFAWLRRKGTKGKKAEKPGAES, SGHGPRQKAERERRRHEKEDA, TGGCKCEYRNWWRRNKKKKQDLEPEPERI, DWEDWDKFERRQRLRNEERRRERIQRWLESRKLTAWVGKLKKRQARKLERMRKERIKLKYQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1L9	Uncharacterized protein	1	69-93	STDASDQTGRRKRKRYEVVLHSSPF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q247	Uncharacterized protein	1	3-28	DADDNRNYHHKPRRSQRPRIHFLLRW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3W0	Uncharacterized protein	2	134-159, 241-265	TGSVYVRRRRSRSRRRYSRRRGSVAG, IEEHSPPRRRRSSRVRSAERRLSGY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q475	Uncharacterized protein	1	13-35	PPPPQRSPWPWSGRKRRNSESSL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4A9	Zn(2)-C6 fungal-type domain-containing protein	1	23-74	AETSPQPPPPSSKKKQRRGADPANQKRRCVSTACIACRKRKSKCDGALPSCA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q575	54S ribosomal protein L4, mitochondrial	1	37-58	ALLKRHKYRGARDNKDHSKHRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6S1	Uncharacterized protein	1	418-452	ETEDRRGHGKRHRRRLPRRKHRKHRHRHISESPEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q749	Zn(2)-C6 fungal-type domain-containing protein	1	296-319	KEIKRRTKTGCLTCRKRRIKCDEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9H0	Protein kinase domain-containing protein	3	322-342, 665-691, 698-720	DTTPRTRKVKKIVRRLKEKPT, ELESKALRREKEKKEKERARAAQQQSG, PGSSSARDRDRERKRPNEGVDAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC66	Uncharacterized protein	1	84-108	SSAAGQLTKRRRRVTRRGKSPAASR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCI3	DMAP_binding domain-containing protein	1	1723-1743	QTPTKDHRTEQQQQQQQRQEQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCI5	Uncharacterized protein	1	156-181	PSEEPKPQPKPPPEPKQQPQPPPPQP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCY6	HET domain-containing protein	1	436-466	RVYFYRRRQAVWKDRRERKRPRAEEILKTEF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD40	Glycoside hydrolase family 31 protein	1	1-22	MASSRYRYTFPRNPKANPKAVV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEK1	Mitochondrial distribution and morphology protein 34	1	352-376	GSGRHSKAGRKKKTRVVNLRRKAAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV0	Piwi domain-containing protein	1	197-218	ESASKKAKGKPKQASGQQPNAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFI7	MFS domain-containing protein	1	203-226	VSEVPHRSNRPRRKYTQRLAFRRI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGE6	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	2	4-34, 79-98	PGRFSTGCLRCRQRKVKCDEARPSCRRCCIY, AGKKQGQQHQHQHQHQHQHQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI34	Uncharacterized protein	1	166-190	AFFIWWARRRMKRRRRSTLLTPLDV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIL3	Uncharacterized protein	1	280-310	GVSDVNRGDKKRKRQNKQQQQQQQQQQQQQE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIU9	Uncharacterized protein	1	224-243	MSSSSKSKVKRKVVARAEEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJM3	Nucleolar protein 58	1	449-517	DEKVDHPPAKEKKEKKEKKDKEEKKDKEGKKEKKDKKRKSVGGEDVEMADVNGDGEKKKKKKRKSAAAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJR8	Uncharacterized protein	1	1456-1488	EEMEGKGKGKGKRKKKKEKKEKRGAAGWRDVER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJW8	Uncharacterized protein	1	1-25	MPDPAARNRKSLKKRVDKRAAAAAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNJ1	Uncharacterized protein	1	498-517	LHQLCFTRRNRQERAQEGDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPS5	Uncharacterized protein	1	320-345	TGGGIRKRGSKRREKKRRWVWTIGQD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQA7	ACB domain-containing protein	1	271-293	LLLIWMRKRRDRRLEDNVRAIFR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0U9	Nucleolar protein 12	3	140-165, 516-541, 562-608	VSGDKHQNEGRKRKRKQRDDDEALEA, KLTGKPAGPVNKKRQARKERFLNGGG, RASARDGKPRDLKFKKTKSKAAKAKPKASKKKKKAKAKAGKAGKAGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q143	Uncharacterized protein	3	18-38, 589-616, 806-827	AAGASRRSTRQQQQQHQTAAP, GQPPAPPAKRTRTRRKKKDVPEATMNPP, QPEPQPQQQQQQQQQQQQQQQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q203	Uncharacterized protein	2	13-38, 140-159	PEIPPARPGRPRFHRRCTEDRIREGS, QRPWYSRLPRVRRPRIKSVS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2N8	Uncharacterized protein	2	373-394, 400-419	EEEKDDRPRAKRQRTSDPDEDA, APTHETSRGRRRRVIQDDDD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q555	Uncharacterized protein	1	74-96	DRHPIFGKKPKRRKDLQDLCHCI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5T8	Uncharacterized protein	1	62-84	SVASDRREAKQKKKTLQEQRTAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7P5	Delta(24(24(1)))-sterol reductase like protein	1	21-40	VETPGRRSTRRKAQVLPESD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB47	BZIP domain-containing protein	1	71-94	APEPQKPAAKRKRENRYKNAPPAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF25	SET domain-containing protein (Fragment)	1	181-204	NNSNSNSNEKKKKRPNAEFRTAWD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFT0	Uncharacterized protein	1	23-47	EDPIESPPDRERRRRITPTRTAGDT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG40	Uncharacterized protein	1	2-23	LSSGFWKRRSLRVPDNQRTKAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG98	Uncharacterized protein	1	256-277	DSTGRRKHYYPKRKQMLRQLLQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHG5	DNA-(apurinic or apyrimidinic site) lyase	1	328-350	EDAMPKSKKRKAEKDEIPAKRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHI0	Uncharacterized protein	1	16-42	MSFVKYISKKPQKLQNRQQSKNCRSTG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKY5	Uncharacterized protein	1	38-60	PLSSCKPEQRRIKDAKRRAKLEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMK6	ERG4/ERG24 ergosterol biosynthesis-like protein	1	182-204	ACEIDRKRFKTDKRNKGKPYTGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNF5	Uncharacterized protein	1	7-33	DNSSIDRATRRRIRRRAAEGRNAGRKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPQ3	SPX domain-containing protein	1	104-124	VRPPTRASDRTNNERHRRPSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPV9	DUF2293 domain-containing protein	1	11-34	PGAGDHAKERHKRDRRGNLIDWTA