ProteomeAccession	ScentificName	ProteinAccession	ProteinName	#NoLS	Positions	SegmentSeqs
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQS8	Membrane bud-specific	2	528-552, 744-765	VGSKEKKTAKFSKKVKKAKEHLVED, NGEEFFKTKNKKKTLNPEWNEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRG4	SWI5-dependent HO expression protein 3	1	346-371	FETGRANEKRNSRRRERSGNYEHQRL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRV0	Global transcription activator swi1p	1	167-186	LTPEQRRRFIERQRQYRQMV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT03	Cell division control protein 48	1	23-45	DATATAILRRKKKPNSLVVDDSP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT82	Nrd1p	1	246-265	PENTRRPERRQEGRPERQNA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTL2	Adh6p	1	207-227	TAISRNEKKKESKKLGADHYI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTQ0	Trna methyltransferase	1	6-27	AADGIKRKMKKQQAKQDPDTTA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU12	Uncharacterized protein	1	420-444	SSVKNDLKAKKIRPKAKTRLQTSLT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUW8	Nucleolar protein 16	1	10-38	ARSSVGKVSRRKKDTHKKIRKFGNQIIAE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVJ5	Actin cytoskeleton protein	1	214-233	KSIARQKEGKSKTQRKWSSH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVM1	Uncharacterized protein	1	76-103	EFLIRGRDSKKKKYKHKGLYELSKRYRH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVP1	18S rRNA factor 2	1	184-205	EDTKSHKSRVKSGGNKKRKFDE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW50	Uncharacterized protein	2	10-37, 150-201	LLCFFNHKNEEKHRKKQKDSTNNVSKTS, LSAKGHSRKMHTYKEKRNESHHKLADSKADNTKQKLKQSKSSHKKKAGGCTK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXC0	Pre-mrna-processing factor 17	1	246-272	TIVTFTTKKNDKFRRIRKKTFGHHSAG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXW0	Yjl163c-like protein	1	82-105	SFLPESRPQKLRRRSRRLSLDQAE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXX2	Protease substrate recruitment factor	1	3-23	GISNNEKRKPSKDNKEKESLS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ09	Glutamyl-tRNA synthetase	2	148-172, 506-530	KALSELKKEAKHKKGKKVHMANFDI, PELHAVEKPKHKKNPKLGMKNVWYS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ83	1,3-beta-D-glucan-UDP glucosyltransferase	1	1408-1436	IRDRMQSTGSKNRRHKKMQNEQNFNQNKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K043	Cholinephosphate cytidylyltransferase	3	2-23, 34-53, 328-368	TVTSTRKKQKLLNGKKTDKLTF, LPAYRKFRPKGYRLNVPPTD, GDEKIPTLTVRRKRRPSMTRHSRISPRKRMGLRKMAREGRI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1T8	Putative rn mrp complex component	1	51-77	KAELLKSSSSRKRKKKKSIFSLIRPVE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2P0	Catalytic subunit of 1,3-beta-D-glucan synthase	1	1117-1140	GPIHTTTQTRIRRRRAERYAILYF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2W5	60s ribosomal protein l44	1	1-32	MVNVPKTRKTYCKSKKCRKHTQHRVTQYKAGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K309	Uncharacterized protein	1	191-212	FDPHKVLRLKPHNGKHKKSEGS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K385	Molybdenum cofactor synthesis isoform cra_c	1	264-283	VIGKAVKKKKAKHGGLTVAE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K424	Cytosolic Fe-S cluster assembly factor NAR1	1	387-413	QKGPTSGRGRALRRRRMQKGHTDPEHS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR49	Nuclear segregation	2	7-34, 351-382	SEDRERSRVFSKRRYIKSPNFKERDQKV, PKNPNENLSKSKKSKKHKKRASKTRVILEPTI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRE2	Catabolite repression protein crec	1	234-253	LNPIRQRYTRWNKNGRLKSC
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRK4	Xylanase chitin deacetylase	1	1146-1165	LQSPRKSKSIHTHRAKFDNA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTB5	Gata transcription factor	1	424-448	ASPQNQDHKQQKVKQEKQQSMQIRD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTW3	Signal recognition particle 14kd protein	1	104-134	VLKAGFPGLKKRSKKKKKKKKHQIQGKSEIN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU86	Actin-related protein	1	270-292	SKEYVPLRRSKRPDENKSEKMQA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUX2	Nipa-like protein	1	47-73	YTSYKQIHSSKQHNCKHQRFHRMINTA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV22	DNA-directed RNA polymerase subunit (Fragment)	1	127-146	IKIRDPKKRFQAVWNLCKTK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW47	Nicotinamide-nucleotide adenylyltransferase	1	1-31	MSLPTTRHERATRRKEQSLRHKIPKKATELE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW62	Pyruvate carboxylase	1	954-976	EPLRTNVLRGKRRKLTCRPGLEL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX11	Uncharacterized protein	1	133-156	SSPLLKKSSHKLHRKGYNKCVEKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXF7	Putative zinc finger transcription factor	2	487-508, 513-542	YVCPCGKKFPRQDALKRHRIRN, IPDDRGVLKRKGKKSKKRENKRIIIQNTIT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXG3	Putative mitochondrial ribosomal protein s4	1	128-150	EKAKNDPRRVWKQQDKHNKRSIL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXX6	Uncharacterized protein	1	311-333	TDSVSRTRSRSKSPRRRDLAYRG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYG7	Subunit of the rave complex ( skp1p) which promotes assembly of the v-atpase holoenzym	1	47-66	ASNRKKVEFLRKSIRKKLQF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYR8	Dna polymerase alpha catalytic subunit	1	35-62	IGETTSTPRKKVKKVRNKKSEITRFFKP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ00	tRNA (guanine(26)-N(2))-dimethyltransferase	1	65-91	MYQEEALAKRQKKRNKQPTSDGKNTED
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZU2	S-methyl-5'-thioadenosine phosphorylase	1	284-303	KFSVSTKKPARDRRAAIKMH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0X5	Forkhead transcription factor	2	163-192, 312-332	QTRELRKCDRSTRKCDGKKRSAPQHMEKSS, KLSTAEKSKRCKKKAPQELQS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2C4	Growth-and or replication-involved	1	356-375	GCSGSRKKDRGNNNNNNNKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQJ4	Duf1212 domain membrane protein	2	40-61, 325-349	LEQPGRSRSKNARTTRPKIFDI, KRNVDGKYANRKKNRFRGRFNVSKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQK4	Ypl150w-like protein	1	336-365	DGFWKLLREKRRYKAEKKKHRNHHNSVLLL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQX3	Dna replication	3	53-78, 516-543, 563-584	QQTKYFAKRTKISKNERSLRRRLDDE, SANMKELYIPKRKTKKKESTKFVNLTAE, DNDAGRKFLAQKKKRSEIRNSL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRP0	Putative sur7 family cortical patch protein	1	288-308	EGGIRFFKIKRNRRNTDEESL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTH6	Protein pfs2	1	32-57	GKMMIRKNVYNRRKTRQPLGHIRPEM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTQ5	Uncharacterized protein	1	19-45	KSALGIGRKVRRQRQRAKNPKEETNYS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTT5	Mrpl16p	1	39-62	ELAPRYTVQKKKQKGRVTVRTGES
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU00	Mrna binding post-transcriptional regulator	1	126-148	GSRIRLRWGRSGQRRQWRQKTGV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUC9	Uncharacterized protein	1	213-235	FAEKTDKPHKKRKLDSPKTRDVL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUM2	Uncharacterized protein	2	273-292, 299-321	FRLREKRKQFLKFRKIKAEI, REQNRQKRLAARRIKPKKEHDGS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVI4	RING-type E3 ubiquitin transferase	4	3-43, 59-78, 559-583, 690-716	SESSTNQANKPKKGYRRRGGQRKPRKPRESQDREKSHHDND, KELLKRKKDAISNKNKVQNE, ASIPGYLPKKRRRIKTHSSLTNSRN, LNETTNSQNKKKGKKKKKILLKIGVGH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVS9	Rna-binding protein implicated in ribosome biogenesis	3	3-27, 48-77, 169-198	EETPKLSKKQLKALRFKAKKSDKAA, KRKNETADGHPRKKRKTRRGHHGRGKNGAH, IKEKNEKLIKKRVEKIKKEKKSKESSDTAD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWB1	SAS4 domain-containing protein	1	309-340	TDPINLKEFERSRKRLRKRNKKYGKIIKVHFL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWV8	Serine threonine protein kinase	1	69-92	ASIIAKVMRRRSRRRLTNRSGSSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX30	Integral plasma membrane	1	149-170	LLTPPRSSLRRRRKYTAFAFFG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXN0	Putative mitochondrial ribosomal protein s9	1	274-302	GCLTRDHRVVERKKPGRRKARKMPTWVKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ21	General negative regulator of transcription subunit 4	2	78-108, 352-372	PGELKAQQMKAERRKREKRQQEKERKDAEMA, LQQRLAKKKDKREKEAQHALV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ92	Ser thr protein kinase involved in salt tolerance	3	236-264, 300-324, 705-748	SGGSTGWKRRHLKCKKRIHKVQKLFGFDL, DDGNWRPLHHHHHRHRHGRNKGDSA, VEIERKRRESMKKKKEFNILTNAKSSRLKRMQNGKRKSHRSLNH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZU7	Trna pseudouridine synthase 4	2	37-65, 342-366	KALAEKRNAGRKSRRNRRSNKLKMGHGGT, AIANRKSKRLRSLWGRKWWITRKSH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Z7	Protein with a putative role in actin cytoskeletal organization	1	346-376	ASSNRFSMHSGKKEKKKRGMRSRLGNFLHHK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1F2	Thiamine biosynthesis	1	330-356	EQTLQDRQKSKSKRKAMSKYNVLNRAV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Q2	Mitochondrial ribosomal protein of the large subunit	1	1-26	MRKKAKEKKLERRIAQKRLNAKKPAS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K302	Lsm1p	1	106-129	IDYDSAKKTWKKRCQDSLDKNTED
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3Q0	Rml2p	1	358-385	KGGFKTRTGKHVNKNKVRDRPRGKEARA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3Y4	60s ribosomal protein l3	1	111-134	SDEVKRRFYKNWYKSKKRAFAKYS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K403	Putative fungal zinc cluster transcription factor	1	96-127	EILRLKIRDLRLRGRRQRKKMKKFMSEHEKYD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K406	Uncharacterized protein	1	176-196	GGKQTGTTKKGRGRKRKKNDK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K422	Ubiquitin c-terminal hydrolase	1	151-176	EYPPRDAAHPRKRKLRVKGEKPGFVA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQH6	Putative spb4-like dead box rna helicase	3	474-510, 512-535, 553-578	ARKHELLTHERKRQRREKALKKKSQKNKNFSWSDKNS, KETRIERHDKLKRRREAIERKIQE, DWKLDILEAKRKRKARKNAIVQGSFD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQH7	Putative trna pseudouridine synthase	1	56-82	HESAKERREAKKIRKINKQRGIDFSKY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQU7	Mitochondrial division protein 1 (Fragment)	2	80-101, 387-408	LTKQLRQERKLRGKAWKRKDFD, IAPSQIRKHKPTLQKYFKPGEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQZ4	Rho guanyl nucleotide exchange factor	1	1213-1239	FEPIDPINQRRQKKKFRSETKDVNFGS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR27	Atp-dependent dna helicase	1	127-157	DEETFRSTKGRKKKNPKKKKNEKNSDSPLAT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR68	Ylr290c-like protein	1	118-143	KRSPPKSSQLKDKKDKKTKTAQKQAL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRE8	Uncharacterized protein	1	211-233	LLDKYFKASKRSHGRKRFVFSMS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRN3	Phosphatase subunit of the trehalose-6-phosphate synthase phosphatase complex	1	581-606	INSASARKSLQNRRAWQQKRLSDSKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRP7	Positive regulatory protein of phosphate pathway	1	23-44	TGFTKVLKKWDKRSKSTTKELY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSF3	Ccaat-binding factor complex subunit	1	200-228	DIVPRVPEKPKRKHSRHKHDRHSANPKES
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT27	Putative-like co-chaperone scj1p	1	214-233	LDTYEPDLKNKKKERCRSGW
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUG4	Putative mitochondrial ribosomal small subunit protein mrps35p	1	263-285	KVGYRYGKSFRDNRKDRKIDFDA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUW6	U3 small nucleolar ribonucleoprotein imp4	1	3-22	RRQARERKEYLYRKAQQLKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWW9	Non-specific serine/threonine protein kinase	1	253-274	VDCIRRFFRRRFKYIPKANSSN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXQ7	Sit4p phosphatase-associated protein	1	654-681	NPEVAGEKGVRRRRRRRRSELSQDYNAA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ94	Uncharacterized protein	1	257-290	QEEKERRRKKEEEEQREKKKREEEERRREMQRKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZD5	Tma64p	1	346-373	IANFEPYRTVKPKKNRTKNRENTVSPDS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZI1	Defining member of the set3 histone deacetylase complex	2	130-154, 574-594	LPVDGQKKTRGNRKEKKVREEEERF, VRKFSLADYKRKTKRNMAVTK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K042	Single-stranded dna cleaves single-stranded dna during nucleotide excision repair	1	472-500	YQGGKIDKSNDNKRRKIRKQMKADLFLGR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K057	60s ribosomal protein l19	1	172-197	AEARRLRNKAARTRRQDRLDEKKAVK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0B9	Putative nuclear cap-binding protein large subunit	1	626-645	VESKLKKESRKEKLEIFKGA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1J7	Ubiquitin-protein ligase e3	1	199-218	VKEGQIVIKKKPKKHRRSRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Z1	Aldose reductase	1	21-41	GSGSKHRLRKWSDPKLSKDTV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3F3	Putative mitochondrial atpase	1	128-150	KGATYHSKECRKQRKHHIDSWYS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K441	60S ribosomal protein L8	1	7-27	ASPFTTKKSKSAKGGKNPLVE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQN5	Golgi apyrase	1	210-235	MRTIVSWVRRHRSKKYVKLDENDTPV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSY3	Glycine cleavage system P protein	1	127-146	AMLKRLKKIASKNKVLRSYI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTA2	54S ribosomal protein L31, mitochondrial	1	13-42	GSLLWKRPWRLSKTQKFRQRKRLQQVDENI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU62	Uncharacterized protein	1	31-50	MPRLSQKERKRRAATSKLRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU80	Copper-transporting ATPase, putative	1	522-544	GLFSRLRRAFGRKRRPNSEEYEM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUH7	Homeobox transcription factor	1	91-122	ERSVRIWFQNRRAKQRKLEKLKKVKEEEQQKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVF1	Dihydrouridine synthase	1	173-194	LLERLPPKLNQRPPPLQRQKRA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVX5	Subunit of a golgi membrane exchange factor (Ric1p-rgp1p) that catalyzes nucleotide exchange on ypt6	1	215-243	EGSKVKEESKSERKKRKARALNQATIQRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW27	Transcriptional repressor tup1	2	101-121, 592-611	NVQNAQKQQNQQKQQNQPQQA, PPEFRHKCCRLPSHVHFPRN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWG3	Tfiid subunit (150 kDa) involved in rna polymerase ii transcription initiation	1	252-275	FDIQYNTKYRRTRRRKEGLLDDSE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWN9	Clathrin light chain	1	1-23	MNLQRMRTRRLCKRPKEGDDDEF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY20	Cation translocating P-type atpase	1	306-337	MKIARFYKRMFGRKKSKKKFKNLKKEFSSFGV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYD5	Uncharacterized protein	1	19-38	QKNTTKHQSCFKKQLSRKES
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYQ3	Subunit of the cohesin complex	2	11-35, 67-89	DTSIGSRLRRTNRIRKRRAVEDSED, RPAQNKKEGGRKKRRIARSNHDE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYS9	Uncharacterized protein	2	106-135, 256-280	HEQNKSVGVKTNKKKKKSKLPRMLLRLDFL, PPSKVDKPPKIPKLRIRSKLFKFCM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ07	Subunit of the rna polymerase ii-associated paf1 complex	1	127-153	RTSKLSELKRQRERKSKQKNQKFEDDE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZF0	Ras small monomeric gtpase	1	196-218	HEASERRKELKKQKKGTYQETGE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZR8	Dna-directed rna polymerase i subunit a34	1	182-219	KEPIPSPRKRKASNVQDTKSFIKLYKGLRRNSKKASPS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K143	Polybromo 1	1	333-383	QEPAISKPKKQEEEKKPKLKRKIVIPDSIFPFPKRRGRKSNKQKQIEAQIK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K273	Putative nuclear thioredoxin peroxidase	1	17-46	AESEKEKPAKRAKTDKKVAKKTGKQAKAAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2H2	Non-smc subunit of the condensin complex (Smc2p-smc4p-ycs4p-brn1p-ycg1p)	2	242-262, 264-285	NREENKKTERIRKKENPTDAE, KEAERKQKVKDDAQKRKQKVMD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3W6	Histone-lysine N-methyltransferase, H3 lysine-4 specific	1	600-621	SSRRGGRIRRKHQSTVKNRRNV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K437	60s ribosomal protein l2	1	183-202	GRAFYKYRVKRNSWPKNRGV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRR6	Aspartate carbamoyltransferase	1	1904-1925	TSTSSPVTPRSRRRSSRFSFDS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRS4	Terpene cyclase/mutase family member	1	52-71	GEKFPVKSFKQQRTRASEVL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTX5	Eukaryotic translation initiation factor 3 30 kDa subunit	1	60-91	EKAALKKKQKEALERKKKKKSGKPTLLKIDKV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTZ7	Uncharacterized protein	2	21-66, 134-160	VPETAERKANPRRNTRTKRKKLEISAKRVVKRSTRKSLPKSKHAVE, SSKVTKAKSSVPKKRGRKKRVELVGIK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU04	RNA polymerase II transcription factor B 38 kDa subunit	2	54-75, 160-181	VCPYPNCNKILRKNKFKTQIFD, RLQKLEKQYKSKRNKLNRQILY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUH1	Dead-box family helicase required for mrna export from nucleus	1	26-48	DSDTDKKQKVKLKHQVRHQVAVP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV02	Component of the small ribosomal subunit (SSU) processosome	1	241-270	RGLNEKEKEGKQKRQSQKEKVRKGPEETQI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV26	Protein phosphatase regulatory subunit	1	1-20	MPFLPSTRKRRSNSAPFISF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW20	FHA domain-containing protein	1	1-29	MEPKVRHRIQFGRRPRKYRPPFKDDDQVK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWV0	Voltage-gated chloride	1	249-270	IISKLLCFKKRRQFNRSGIEID
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX88	Anti-silencing function protein 1	1	237-257	EEEERRREKRRMKSETDQPDA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXK8	Bleomycin resistance	1	372-396	HGCIKRFRRLIKAYRRQLKHDRHMK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXP4	Uncharacterized protein	1	136-164	RPSDERSSRGERRRRRRRGRGRDRGDLFD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXZ7	Map kinase kinase ste7	1	332-355	VSQKYRSLIKRWAKNVRRMEKGKP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYJ8	Vacuolar endopolyphosphatase with a role in phosphate metabolism	1	201-222	KLARRLSKSSPLKKNKEIKGKN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYW7	Allantoin transport	1	24-43	LRANKDLKPTPPKERTWRLY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYZ8	Interferon-related developmental regulator 1	1	372-394	VRDSNKKVGKRSKKEVRSIYREV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZB0	1-phosphatidylinositol-3-phosphate 5-kinase	1	71-97	ECRACERRFTTFRRKHHCRICGKIFCG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K009	Rnp-1 like rna-binding protein	1	76-101	FGYYMGRRRGQRRHRNSSQTYRSRNN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0H6	60s ribosomal protein l10a	1	89-110	DLKKLNKNKKLIKKLAKKYNAF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0N1	Uncharacterized protein	2	15-45, 115-135	HDPISYRKKIKTIKRTTRRSKLKTKGPNDVA, SNNFVRLKINNHRRGRFRGRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0R7	Putative snt2p-like dna binding protein	1	655-678	HKIWDNYPYRPKNRFKYIKNTELD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1N9	Putative guanine nucleotide exchange factor eif-2b epsilon subunit	2	415-434, 519-544	NYTKIKNLFKEKKRIKEEPS, IASSTITRRSTKRKKRTMSSTASQAA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1Q6	Tom70	1	44-80	NSSDSKEKTPSPQKPKKSHKKRKKKSEKEAKAIYPVS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2C2	60s ribosomal protein l5	2	9-35, 258-289	TYLSRYQTPFRRRREGKTDYYARKRLV, SKEQYAENSKKYRKKKLSKEERKARVAKKLEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2I8	Uncharacterized protein	1	90-110	GSLPDRSRRENRDRRNSKFSW
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2W0	Uncharacterized protein (Fragment)	1	199-222	LAARRKSRAKFGRNDRRRGRQEMQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K409	Pol polyprotein	1	612-633	SENPAKGLSKRLKTNKLDDFKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQI6	Cell cycle regulatory protein	1	24-51	LRNPLFQGSPSKKSRRRKIIYSDRYIPA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRA9	Uncharacterized protein	1	1-36	MAAAKRRRTTRRDDIAKRRRPVRQAKEKEEKKLREE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRB4	Phospholipid-transporting ATPase	1	155-200	SGKNNPKRSKTIFRRDRWGTQRYKSGRPRRKGTLRRGKTRKVMDSI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS50	Mitochondrial translation initiation	1	76-96	KTSNSLKKKKSQKLVKKHLSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS57	Putative epsin-like clathrin-binding protein	1	307-331	DQSQDKKVESKKKKSHEKRLSQGEQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSC3	Gcn4p	1	219-238	TEAARRSRARKMKRMAQLEG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT19	Negative regulator of transcription	1	1-24	MAALTKGKRGKKRKVSDDEKTSIA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTD8	60s ribosomal protein l4-b	1	302-324	QASVKRPNVVKKNPLKNKQILLR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTM7	Protein ldb19	1	27-52	RTALEVARKKVRRRKFNRNSNGASGP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTP9	Nucleosome binding protein	1	1-21	MGRKGTRKKKDPNAPKRSLSA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTS5	Uncharacterized protein	1	68-90	SRTTGKGKWTRDKTQLQRRKTSL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUF1	Dna repair and recombination protein rad54	1	39-62	ETFKCKRCDAKTKKQRIKPKMMLY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUQ1	Putative ebna-like pre-rrna processing factor ebp2p	2	167-187, 197-240	RETMDKIKSLRKRRQNNDIGE, ASQTPQGLSRKKRRIQRQMSAKGKGKEKTGKKQKKQMEEIIRDF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVN8	C6 transcription factor	2	172-198, 1099-1120	IEQACDSCRKRKLKCSKEYPKCSKCIA, SQQTRRVQLRPQQQQQQQPQQL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW49	Uncharacterized protein	2	46-75, 130-167	HGILKGKVKRTHGKKRKRAKTGSEKPKKMA, GSTDKDKKVRKSTKNVKKRKKKTTKKKKKTVAEVLGLD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWE3	Protein CASP	1	397-422	VPILARQRDRFRKKNKELEEENKKNF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX67	Guanine nucleotide-binding protein alpha subunit	3	23-47, 218-237, 387-406	SQVEKILKASKQKKKNQIKLLLLGA, GSIHKKPRRIRKYSKYEIAE, KDKVRRSPLRKYFPDYKGKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY92	Cytoskeleton assembly control protein sla1	3	42-64, 91-112, 202-229	ATSGSSQGPRKNRKNSARGEEAS, ERQELARERRRQDRRARELKTY, SLDRYKVENKKDRKDKKDKKEKEEKEVA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYR9	Uncharacterized protein	1	2-24	MVTKMKKQETMKQMKKTRKMVLI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ60	Dna2 nam7	1	195-215	PGLQHLKKVKTEKKNNITKSE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZL8	Gln3p	1	385-408	LKTDVIKKRNSRRQSHHRRDSSSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K028	E3 ubiquitin-protein ligase	2	937-960, 1077-1121	ILEKLAATRKKKKKDIVLKPVIYK, GEEHIKSYRKSKHGKGLETRKERAHRLAHKRQKKNTGENAWSTKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K084	Mitochondrial oxaloacetate transport protein	1	1-23	MSEHQEKKTPKKKEVTKLGGCIA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1C1	Uncharacterized protein	4	57-100, 113-148, 174-209, 242-281	TEEPEKKNPWKKIGKHEGKKWKHYGKHQKKKWGKKPKEDPPSDS, EIKIKNPKKHWKDYGRDQKKYWKHGKEERRKWAPKK, VKDPKKYWKHYGKDQKKWKHFGKDQKKKWSPKPASG, DYGKEQKKYWKHYGKEQKKHWKKYGKHQKEKWGKKPDDGE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1D5	Putative zinc finger protein	1	47-69	AFARQEHLKRHQRSHTKEKPFAC
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2K4	Uncharacterized protein	1	419-442	SGAGSRSRSRSRSRSRSRSASSTS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S6	Kinesin-like protein	1	6-26	LYNKEAQTPVRRNKHSRISSG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Y1	Uncharacterized protein	1	268-289	LKCYFSSRKKIIQDEKKRKLLL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3U0	DNA ligase	1	554-576	EDACYRPAKRSKNWLKLKKDYLE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRF3	Uncharacterized protein	1	89-114	LSTPSSIRKERKVKKYQKFQTEAPDH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRQ6	Heat shock protein sti1	1	1-23	MPTTHLRRQRKIMKKNNELNSPQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRY5	Upf0592 protein ydl073w	1	235-256	RVSRKSFRRGLGRRQIPRQQLW
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSE7	Uncharacterized protein	1	103-134	SKPNKPDKSKSNKYKSDKFKPNKSNQSKSNKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSJ9	Putative oxysterol-binding protein	1	336-358	GSSKEKSSKTMKHWRFNLEKFNA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSR8	Ydj1p	1	295-314	IVTLKERKKAHKNNYRMGVK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUV3	Uncharacterized protein	1	58-80	TPQYNRPSVRAHRRSRSRQYVVI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVD2	Pre-rrna processing protein	2	246-269, 291-314	HISSTKPKSSKKSHNIQTQNKLVF, KQAPIRTRGNKLKIIKKGREKKMV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVM3	Ydl063c-like protein	1	467-488	YLELYKKTPKVEKLHKKCWISC
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVN5	Uncharacterized protein	1	235-254	RQNQSPSMQMKKKRRYEDEG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWG1	Phosphatidylinositol 4-kinase	1	357-380	DIPSLLPKSKRGKYHKICHICVNE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWM4	RNA helicase	2	28-57, 163-188	GETQKQRPKFVWDRKKKRYIKNQDNNKYII, RSVDDIRKSRKLKERRRAKNARPSRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX35	5'-3' exoribonuclease	2	101-124, 389-414	DGVAPRAKMNQQRSRRFRSARDAE, DTILYKKHEKDRRREDNYKRRKIEKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXU0	Putative membrane-bound transcriptional activator	2	242-264, 416-435	SFNVCRKCMRRELKRASRRKSNS, GVGSKARSAKRQKRSWSSND
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY74	U3 small nucleolar RNA-associated protein 25	1	2-22	IYEKSANSKGRKRGREDTEFL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYE2	Yml020w-like protein	2	287-309, 557-579	VYDSPKSKKKAKSSRNKGKESIK, FQASSWEYRKRRKSITNKSGNYT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYF0	Fatty acid synthase alpha subunit (Fragment)	2	1069-1096, 1255-1274	PQLDIKYRARQIRRRRKQVKEWQYGNEF, DEYYKVARRHKKSYSYMQNA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYU1	Uncharacterized protein	1	81-100	LRNRSRKLENARRQMQKRDI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0U0	Ubiquitin carboxyl-terminal hydrolase	1	510-538	IHFVRFFWKRETKKKSKILRKVQFPFQLD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0U9	ATP-dependent 6-phosphofructokinase	1	913-935	DYESESGKRSRKRIFWKDIEIAD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K118	Protein SDA1	1	65-85	EAAIRKINKKRSSKNTPQFLN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1I4	Yor052c-like protein	2	109-138, 151-171	DQEHTIRHTRKKSRSKSKSKGKNRCSFGTC, FCKGRFCSKHRLLEKHNCKGL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1S0	Uncharacterized protein	1	108-132	RGNTHVKTIPIKKNKRSQREINTVM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K226	Nadh dehydrogenase	1	45-68	AATDKTKAVKQKKAPKHGWFNFFF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2U3	U6 snRNA-associated Sm-like protein LSm4	1	81-101	GGNNYQRRGNRRNYNGNQRYG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K327	Proline utilization trans-activator	2	264-290, 293-312	LDGYKLSGRPHKKRRRKDGSKPGEADE, RQGKHSRSQKHKYNSSKAAR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3A0	Mitotic spindle midzone localized microtubule-associated protein family member	1	211-238	RATFYRHRKFNRSFKQRRQQSSRSSRRE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3W8	Nma111	1	8-35	RTLDRGPSNGQPKRQKKNDINGKNTPLN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K453	Methionine aminopeptidase 2	1	30-62	AKAQDGAGEHKKRRKRKNHHKKKAVRGISKIFP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQI7	Anaphase-promoting complex subunit 5	1	134-158	SDSDKCFHQKMRKRLKKPLHSSSFL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR62	Subunit of a heterodimeric peroxisomal atp-binding cassette transporter complex (Pxa1p-pxa2p)	1	317-337	RLEFLKRTQSRPNIRRKMLYI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRI5	Protein kinase c	2	46-65, 151-174	QIEERQKQMRRQEEERRREE, ASVAGRTKHHHHRHHHRHRHGLDD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRP2	Eukaryotic translation initiation factor 4C	1	1-30	MPYNGKGKGKGGKNRRRGKHQNYSQKRELV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRR7	Cdc11p	1	6-27	ESSAVLRKKKILKKSLNFTVMV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRT8	Ybr138c-like protein	2	42-61, 330-356	CLNTRSRTYGHKCRKRISVL, IMGDRDRRDNRPTKKRASTRSMGKFNH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSD7	Isocitrate lyase	1	17-39	NEVSIKKWWSERWKGIKRPYTAE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT30	One of six subunits of the rna polymerase iii transcription initiation factor complex	3	40-63, 131-161, 615-638	DEEEPPNERRLRKNRRTDNDVDSS, LREASNFKTKKRKEAKKPKKKGGLAALRRKI, ALIADLPQKKPNKKKKLTFSAAGT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT52	Myosin class v heavy chain	1	136-156	VGSKKDNKKKKESSMQTRPDI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTG6	Scaffold protein scd2	1	8-30	NCSYSFKSSKSRREFPGKRQDFD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU30	Rna polymerase ii-associated protein	2	43-64, 136-162	NEKEKKDYEKGKKENDDKNKSK, LKPVLKKYGKSKQKAKKVRFNNEAKVQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUR0	Calnexin	1	1-21	MESIQCKKKNGGKAYNGKWEI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW55	Ylr149c-like protein	1	33-60	PHKNAVSRLNFRRRGKHHQVKKAGSNVH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWK1	Eukaryotic translation initiation factor 2 beta subunit	3	4-30, 33-57, 61-89	AELGFDPTLKKKKKKKVLDDSSSPSTD, DDLFAGAKKKKKSKAKKSAEGEDVD, KAFEGIKLKKHHHKKKKKASKLNESADFE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXK3	Uncharacterized protein	3	252-286, 292-314, 426-467	PRSKTKIRIVRSPRKKQQRRRRRKRLSGLSRELKN, PLSWRDQGEKPRKEKRRNSLVSD, GENNKENVPSKKQSKKIRQTTNKRRKKRKSKKSAASVPKMIS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY39	Uncharacterized protein	2	67-88, 347-366	SVSLELQKQRRENRHKANNAGS, FSPLKTQNRRIRNSILKKMN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYF2	Suppressor protein stm1	3	30-63, 74-97, 186-209	VKPQKSTKKSGVPPKADKSKRKNRAPKFTGNEAG, EGPRVTRRKGGKSKQDDRHSKTGR, IAPTSTKKLRSRARKEKKVLDIDI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ42	Ribonucloprotein	1	13-42	SKKVNKKILKTVKRASKCKHVKRGVKEVVK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ72	Histone-like transcription	1	104-123	ASIARSRKRKKIQYADFHVV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K049	Splicing factor 3b subunit	1	123-154	TPPRVSSGDKTPPRKMRKKSARKSLWDVKPED
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1S3	40S ribosomal protein S6	2	76-100, 176-197	DGSPCYRIRRKGERRRKSIRGCIVG, VTPQRLQRKRAVRAHKIKNAQA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1V1	Uncharacterized protein	2	94-118, 131-150	LKPPIRPKPLPKKSKTPPRVVRSNE, APPPLPRRRGKEKKQISEDE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1V5	Glucan synthesis regulatory protein	1	155-178	SKYNVNPARKQRPRKKQLMRTGFS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2L6	Potassium transport protein	2	198-243, 272-308	KLPIRQVKTRSSPKKQDIQFAELPRPDKKRAGKRRNKDIDPRDLYM, ERERLRLPGHHHRHRKYHRQRRHQRLRLLRQQAQRDF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K323	Uncharacterized protein	2	18-56, 79-99	DALEEPRKKKRKTDSLQQEKKKKRVSRSRSRRKVTITDT, NDGKRNVKRNPSRSRRLRESS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K417	Translation initiation factor subunit a (Eif-3a)	1	755-779	EYERVKKKIEMEKKKHEHEVRERDR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQH1	Protein alpha-1	1	1-26	MKMNKKKPEKKRKRGFQKFRLHVSSG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRH7	Muscle m-line assembly protein unc-89	3	32-54, 251-282, 335-361	KPAESIRRLKIRRAKVHKIALPE, NSNARKIKAKQSKAKSRRHKPKPQTSIQKPIR, RIEARSPSSPKRRRKSHSITRTRVVHK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRL0	60s ribosomal protein l6-b	3	8-30, 98-120, 240-259	LETARPKSTRKAVRPHKLRASLV, VPYFAREKKSKKSHKSEKDFFNE, DDDDEKKPSKKSSKKNAKKV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRM1	Nucleolar protein 9	1	1-32	MGHKVRGRQAKKERKSKHAHHKHSSSEEKHKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS16	Peroxin-13	1	283-304	IAKNQHNKFLRRQRQQNNMLTA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS79	Uncharacterized protein	1	14-42	DESTKNTRAKEKQHKSKQKVQKTDEEPKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSA2	Putative gtp gdp exchange factor for arf	1	154-173	KTRSLDPKSKPQTKRTGNSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT32	Actin cytoskeleton-regulatory complex protein PAN1	2	936-956, 985-1013	KSSSSKKQSKAPKALQQPKPS, QKKALEEKEKEHKRKKQERRARRIAELKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTC0	Biotin carboxylase	1	2045-2065	WREARRFFFWRVRRRLNEEYL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTQ1	Uncharacterized protein	1	42-62	SITENRRKKKLEREEEREKMD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTV9	Uncharacterized protein	1	18-42	DSIYDLRDHRHRKRKRATSSREGED
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTW2	Asm4p	2	130-150, 457-485	LPFRARKNTSVEKNKKRWEDE, KLKDGSKLIKSKKNLPKKSKGGIVKNSVQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUF7	Iron sulfur cluster assembly protein mitochondrial	1	95-119	AIKSAIKDYRTKRHNRKPTLGPDAT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW17	Ribosome production factor 1	1	1-27	MKKQEEKEKLKLRRERRKEELEHPELK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW59	Beige-like protein	1	682-701	TPLQIFYRPHPRKWKSTPYQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX03	Peptidyl-prolyl cis-trans isomerase cyp7	2	44-70, 339-358	KHAYKNTFFHRRGRNTCKRETRFFRSS, KREERVKKLKYDSEKDRARY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX90	Regulation of g-protein function	2	262-284, 320-344	AEPKYVRKVIKKVKKTSEKTASD, STPKATPKTAPKTKPTKPTSKPAAT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXI2	P-type atpase	1	275-296	GIKPYKIYYRDRKWKKISTDDL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXN8	Antiviral protein	2	187-217, 235-279	MSEGKGKKKKGGKNKNKKKGKENMKDAKDQK, KDEDKKGDKKVDKKGDQKEDKKGDKKEDKKHYKKEDKMIRKKIKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYX3	Low-temperature viability	2	62-87, 168-194	PNILNKESRSKKKVKRKKGAMTDTSS, ADTVSKSKLAQRRRRQKEKGVSLKGLS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYZ1	Cellular morphogenesis regulator	1	32-55	GNSNERKLSSKEKKYKANIERALA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ10	Uncharacterized protein	1	138-159	EDDDWGTGKKKKRRKKKSKEGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZY0	Transmembrane protein subunit of the glycosylphosphatidylinositol transamidase complex	1	348-370	EHTPIRRAIKKIKQTVKVLKSKI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K058	Putative tea atts type dna binding protein	2	6-25, 210-231	ATLSRLKSRCAKKSNLELGD, DLPANKRRKRISSEKENKPPDE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0A7	Dolichyl-phosphate-mannose--protein mannosyltransferase	1	124-143	YCYIRFYKQRKQPFSRDWYL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0C0	1,3-beta-D-glucan-UDP glucosyltransferase	2	200-230, 1729-1754	NLEVGKMSRKARKAKRKSKKARKAVEENGGD, RPPIYSLKQARLRKRMIRKYSALYFF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0F8	Shared subunit of dna polymerase epsilon and of isw2 ychrac chromatin accessibility complex	1	116-139	LEKFNRRKELKQKEKMYKKQAKAA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1D3	Chromatin assembly subunit p90	2	88-170, 181-203	EVSPHIKKSPLKKDEPKKKTESGHKITKEERHKRKLQKDEEAKKRRVKREEAEERRAKKQKEALEKAKREKENEERRLRKEKE, AEERRLKKERREKEKEERKLKFE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1E1	Putative glutamate synthase	1	2-22	RYSRRHEKYRPAKSRIHDWKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2C3	Swr1-complex protein 3	3	29-132, 138-167, 309-352	DDGYLKKYEAEKKRKSKESKEEKDPKKKVTRRKSKEEKEKEKEQLRLEKQIRKQKQREERERLKMLEKEKRERERELKREQRRLERIKEKKEREKEREIREKER, LREKERLEKLKRKEQRERERKLKKEKMALR, AEEKKKEAVKKSSKKKRRHRKNWGSSRRKTRSSSIQQQERRLKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2E3	Uncharacterized protein	1	268-287	EDDETRKKRELIKAARRKSH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2V0	Chromosome segregation in meiosis protein	1	59-78	IKSLSKYRFRGKKRPAEMSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3I2	Nucleoporin nup159	1	317-336	ESLQKRKKINDLVSKVKKQD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K407	Uncharacterized protein	1	15-44	RTGNYSKHWTFRRRTQNSRKEKNNELNDEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K438	Putative single-stranded nucleic acid binding protein	1	1-28	MEARYNQPYRRQRKTKEEKIRKLQEGTP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR50	Lipoyl synthase, mitochondrial	1	31-58	QSAHPATKPPKAVKRRRRTHFSDKLNMG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR56	Tfiia large subunit	1	194-223	VPTNLRRKLAEQRKSRKHKKRSLLRTASQA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR80	60s ribosomal protein mitochondrial	1	107-131	AVSRMLPKDSHRRRRLRLKLYDGSQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRE1	Protein implicated in polar functionally redundant with boi1p	1	805-826	AYVSQCCKWSKQRIASKASSNN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRL1	Peptidylprolyl isomerase	2	44-91, 96-135	DLVKKDEGKKKQSGKKRKAEKEESGAEGKSKKSKKAKKDEEERRVKFD, KGPTQTEKKEKKEKKEKKEKKEKIEKKKKKHPVRKLDGGI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSB6	Putative argr fungal zinc cluster transcription factor	1	520-539	NTVSQSRRKRVGKYNERITD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTS9	CCHC-type domain-containing protein	1	251-294	INSFRVTNRKRDRNDDQEKQARIGGKLKKKKDIQKIKCFKCGQR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUZ0	Protein transport protein Sec61 subunit beta	1	6-35	PGGAKTLSKRRANKENKLRQQKLNKPNSSR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV40	Uncharacterized protein	1	154-174	LPALKVTFKKRIKGNKKKSIV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV97	Ras gtpase-activating-like protein rng2	1	1-22	MPEYSRPKRDSRKNLASKYLSA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVE2	General transcription and DNA repair factor IIH helicase subunit XPD	1	679-698	LADRRFLRKRSQLPKWIAQG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWD0	Putative mrna decapping and decay factor	1	7-26	DPSAKPGKRHGDRKANLDSF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXM6	Septation protein sun4	1	15-37	DCTTVEKSYHKHHQHKRAVAYDY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXQ5	Oxysterol binding protein	2	678-697, 715-734	EKNRLEEKQRAVRKHREETG, EPYWRYKQTYWEERRDGKLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXW3	Cell division control protein 25	1	100-122	YEEYKVWTDKRKKPQQEKIIEVI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZN8	Uncharacterized protein	1	16-49	AAYPNLPKKPKADKHKHRRTRREKRKELEEIARS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1U7	Uncharacterized protein	2	5-34, 77-113	GDTPKRPSATTKIRRIPRRAHEDRFKHSRI, LNLGKAKKKTSQRKKVTKPKKRRKQGGRIKRNLRSND
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Q7	SRP9-21 domain-containing protein	1	111-134	ESTTEKVTSKHKKRSKKSRKGRKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3Z9	Overproducer of inositol	1	435-459	RGSVSTRARRWLRRKIRSQMSYDTN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQL0	tRNA-intron lyase	1	395-414	KKLGLDSKRHPRKSNNRGSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQN9	Ada histone acetyltransferase complex component	3	1-30, 646-666, 689-712	MGARTYSRRGRNSKRSSRYARSRSRESGDK, MRQLQKQLKAVQRNNHKKRVL, QVEQHYRRRLNVNPRKKQEKRWPP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR75	Elongator complex protein 1	2	1122-1144, 1180-1214	SQSAQLKRLRELRQKKQLNPFAF, SSTAKTGSSRRTAKNRRREERKRARGKKGTIYEEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRB5	Uncharacterized protein	1	54-75	QESYTKVSRKEKHNAKERQNAI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRE4	Serine threonine protein	3	239-262, 811-831, 925-945	NSEPRSSSQHHRHHHHHHHNPGSH, FDYSRRSKINHKQFKLIRKGM, TSSQKSTLSRESSRRKPKKVN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRH8	Serine threonine kinase	1	59-100	VKIPQIPTKKAVKRRQLTRSEQERRREIRRARDKKYMKKLTQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRX8	Rna binding protein	1	89-121	GELRRAKSSARELRKRRSNPPKEKAKPKYTTMG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSJ5	Ribosome biogenesis protein SLX9	2	1-25, 67-91	MAIKKRTSLRSKARKRNVADKVQGH, QPGISKSAVRRRKRKLKEQLTAKLS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JST0	Fungal-specific transcription factor	1	269-288	PSDSGKTRKVQKCPIKNEAA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTF8	Uncharacterized protein	2	129-157, 160-183	LDDYKKQKEQQTAKPKKKKTLKLNLSSST, IGNSKKVEKKTVKPEAPKVEKPKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTQ9	Zinc-finger transcription factor of the zn-cys binuclear cluster domain type	1	637-659	QQNAWKSLKKKTRINKGIKVDVL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTR4	Putative bzip transcription factor	1	363-385	AASARFRIKKKLKEQEMQRTIKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTZ8	Uncharacterized protein	1	24-54	DIVIKAPTVNRKRPRRMSKRLQNKSKANNTI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU57	Splicing factor subunit 145kd	1	2-25	RILSRLKKFGKLSKRQFRLKYGIP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUF0	Dna repair and recombination protein rad54	2	1-21, 218-239	MLMKYRSRRKKQPVANDGMGC, NEIARSYRRKWRQPNRSLNDLL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUU7	Domain family histone demethylase specific for h3-k36	1	278-302	SAVGHRLPMNKKRRHSENKSGVFSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV39	Cell cycle control protein cwf19	2	12-39, 193-214	VDDSLRPRYHHHHHRHHHDQQNNKRTIP, REELQRRKTRDKSKWFKPTGRI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV95	Essential protein required for determination of budding pattern	1	441-463	DIAKDIKHKRLQKDDRERRLKVV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVJ4	Glycerophosphodiester phosphodiesterase gde1	1	1-20	MRHTRTWKQKKYKGNSGSTI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX36	Uncharacterized protein	1	24-48	VSSITKSLFKKRPRKVTGNNNTKLE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY44	Spt3p	1	257-277	AGPATKRRKVRHIFDKPEEDS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZE7	Ceramide glucosyltransferase	1	698-718	ISSRKYLPYHIAKKKIKYFDY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZR2	Smg4_UPF3 domain-containing protein	2	187-251, 266-292	LDSCYPKRQKTTQKNPRKQAKGKKTKNINVRSGPKSERSQKEMTKKERQIKRLKRKAFKEAKLNS, KTTASTTKGKEKDQKKNEKTGNTKQAI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1N2	Uncharacterized protein	1	141-164	LNKEQLKKVNKTRKKAKNNFGLID
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2X9	DNA damage-inducible protein 1	2	248-267, 360-380	QKIPRRGQRCWIRPKSKDEC, VKKPAKAPKVSKRVNADPKKV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K333	Uncharacterized protein	1	25-57	VKIKLRTYRKIKCIMSKKTKPPNYIPKNKMPGY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3C6	Uncharacterized protein	1	51-70	IDDPKPKSSIERKSNKRIKF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3I3	Uncharacterized protein	1	173-209	AQANAEKRKEKWKKKAEKERKRKEEEIRNRIEKRKEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3X3	Rho gtpase activating protein	1	5-25	LSRRERRHSLVHGKHGKHKVH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQI5	Dna repair protein rad14	1	242-273	KEWLRREAMRKARKEKKFNSKLSQMRRKLRAE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQQ1	Gtp gdp exchange	1	346-367	EDRAWKLSCKIQPRKHETQSTG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS82	Trna acetyltransferase	1	1-22	MGKRKWTGGKARSKRQRSGSLI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSS8	40s ribosomal protein s11	1	18-40	HIYSNPKSKVSKRAKRWYKDIGL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSY4	Uncharacterized protein	1	259-317	VDEAVKQRWNAKHKRWYQRKASHWKAKAKRKYKEIRLFKEKRLIKKWRQKQIERLIEEN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTM8	Ycr016w-like protein	1	73-107	QTIEAKSVKKSKKAPKRKKLPKNKRPAPPEKDQLA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUL4	Ccr4-not transcription complex subunit 7 8	1	57-79	PVSKRGTTKRKDGKKHHHQGDSD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV37	U3 small nucleolar RNA-associated protein 22	2	54-82, 1098-1119	HEVHHKAPLKASKKSRKRRTVEDIQIARE, VFNPAVTRGKKKFRVNIGFDIK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV48	Flap endonuclease 1	2	22-41, 278-303	GELEKRLKRRQDAEEKAKAE, VSSGKKRTASDSKDKKKKRKTGRSRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVU9	Dna repair protein	2	26-50, 340-359	AAVSRQRMSKRKFIKAVKRHTGSRD, GERPMKSRKKSKISKDPDNY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXG4	Uncharacterized protein	1	135-154	TPSAKKFRMLGPKLKKKNNK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXH6	Uncharacterized protein	1	1-45	MVLHNDKWKYKARRNYMRKHGLKTLERDKDKRKNRDTNEKDEQNH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZL0	60s ribosomal protein l35	1	81-102	RAKQTRAIRRRLTKSEKNLKTT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0P5	Mitochondrial atp-dependent rna helicase of the dead-box family	1	1-23	MQEKKDKNSKKKHGSPVLPPYKF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2A3	Subunit of a heterodimeric peroxisomal atp-binding cassette transporter complex (Pxa1p-pxa2p)	1	63-88	RIIFRLQGFLRRRQRKNNHNPLESSE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K379	Uncharacterized protein	1	1-20	MKPRRPKWKKDVETDDKPES
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3H5	Uncharacterized protein	1	38-88	KDDEEKKEEKKEKKEKKDKKDKKHKHKDKKHKHKSKKRKSEDDEEHKSKKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3T7	Mitochondrial inner membrane half-type atp-binding cassette transporter	1	637-667	EAEKIRLKEEKQQEKKKKKMEEEESKKNNEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3U2	Patatin-like serine	1	814-841	DDSPYSKILYYRRRRSKNLKGNQQYLFT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3W1	H/ACA ribonucleoprotein complex non-core subunit NAF1	1	268-296	DEEESRAKRERKRQKSKAKDGQIQKRQQH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQH0	Uncharacterized protein	1	139-161	GFNTGISKRRKGRRLSKPIVSIL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQP2	Hmo1p	2	105-129, 216-238	AAGAEPQQKKKKKRDPNAPKKPLTS, APSSKKRSGEPEGGKKHKKKRHE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR70	Diphosphoinositol polyphosphate phosphohydrolase ddp1	1	163-188	ELSQVWPECKKRQRKWCYEEAKHELI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRD9	Tis11p	1	331-351	EQELKRIKRCENWKTKPCINW
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSG6	Arl3p	1	127-151	GWIQARVTRNKLNRKPNYRKHRRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTU3	Essential protein required for the accumulation of box c d snorna	1	49-81	ADNIIIKTHKRNNRRQFDWKRNKRRVTEHYDFT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTW6	60s ribosomal protein l7	1	5-26	VPKPETQIKKEKQQEKDLKKIA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUI5	U3 small nucleolar rna-associated protein 7	2	1-33, 448-501	MVNTKGINKKKNEFSRKKRHRTGRLGSKLRELD, QPHIKGKNSALRRMKRKQRNNLITERSRRVEKALEKEKDLRKRKAEKADHLEES
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUT9	Cold sensitive for fermentation protein 1 low-temperature growth nutrient uptake fermentation	1	1670-1690	MGSQRKQSKFSKMKKIHILFS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVT4	Zinc-finger inhibitor of ho transcription	2	243-264, 294-318	IESPGKKSKKLNTHRRHSHTSH, LCNSCGLRYKKTRARCINPKCLRIP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVW5	Uncharacterized protein	1	132-157	ITVKNDFYKRKVRYRYKDRFEEPIRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW72	Rna binding domain-containing protein	2	13-43, 134-171	IGSSRSSKSRVNKPARNSRRRNGRHFRPVLH, DRIFAASQRKPKKKNNRRKEKKEKKKKQTHRKTAEELD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWQ9	60s ribosomal protein l18	2	4-25, 163-185	DHYTKPHKKTGHRTAPASKNFY, KIMSKGRKFERARGRRRSRGFKV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWR4	Isoleucyl-tRNA synthetase	1	905-927	DWPVLGKKLKRDVKKVKNALPGL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXX8	Putative proteasome-interacting protein cic1	2	1-25, 335-363	MPAKGKRVKKVKSVKTKVHTKESPE, EEARKVIDSKRAKHKKRKHEEEGSSSQDL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY37	Mitochondrial homologous recombination protein 1	1	46-70	QQFFRPNWENRKPSKRRDLWRPLAV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY45	Elongation factor 1-gamma 1	1	204-244	TPITHPEHKKEKKKGGEKKQQQQSKKQKQKQAAPPAQPKKP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYW3	Uncharacterized protein	1	19-39	EFTHSFSKKHALRKRQDLLDS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZR7	Transcription initiation factor IIE subunit beta	2	34-71, 249-281	SDSRNESKKSGPKRNSGDRSSQRRKRQKKNILSDSFTD, PESLRNKKDAPIQRRKQKKPRRGKITNIHMRGI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZW5	V-type proton ATPase subunit a	1	256-276	FVDPDHKKRQDQKVDIRHKLD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0W5	Skn7p	1	214-242	TQQATQPARKRQRRSSRRGQQHKVRKADQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1J9	Part of small ribosomal subunit processosome (Contains u3 snorna)	1	41-69	DDEYDENLKKKKKRSKRTKISQIEDKTAE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1Z7	Putative bud neck localizing protein phosphatase subunit bni4p	2	213-232, 476-505	QKDSAKGNSHRKQKKKTAGL, MQSALSKKPLGKRRSKQGKRKSHHVGVKFS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Z9	Alb1p	1	11-32	KALSRARRGKHLSSKRAYRTSR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3F2	Nucleolar component of the small subunit processome containing the u3 snorna	1	369-391	FFDKKDFPRASKQSKKRSANGES
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3H2	Transcriptional regulatory protein	1	352-371	EIAAQRKKLRRDSEQSLKNC
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3Q5	Ap-1-like transcription factor	1	1-58	MSTNKAPSKKGSRPGRKPLTTEPKNKRTAQNRAAQRAFRERKERKMRELQDKVKKLED
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQG4	HMG box domain-containing protein	1	38-70	LSSSIQPVKGKKRSKKRKSQKDLEKPKRPMSAF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQP0	Rsm24p	1	319-354	DVPLDTRPVDKRNKKKQHRNKKQYKFPEQWERPIHP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRM2	Nop9-like rRNA processing protein	1	6-26	EEPKSHHARERSKYNKNDDKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRP4	Putative secreted cu zn superoxide dismutase	1	169-192	MACGNFRKAKKRFWKKEYEEEESD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRU7	Rad1p	2	498-517, 547-570	LKRYLQEKRGPQRNKIQRDL, SKTFLGRQPSSKRRRTRGGSIIAE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSX4	Tma16p	2	6-59, 95-118	SLRKVSKLIKQKKTTLHPNSRRAKRLARATLRQEKITRQKIKHKLKKSNDLMAL, DELEQLKKERRHNRPPTKRQELLE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSZ1	60S ribosomal protein L36	1	63-88	FGDKRARKFAKKRLGSQKRAKNKVEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUJ1	Uth1p	1	16-39	EKIGNWWRRITKHKHSPHSSEKSV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUS0	Palmitoyl-protein hydrolase 1	1	231-251	TCPERKCMVFRHRSRNKSADS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV67	Transcription initiation factor tfiid subunit 1	4	45-71, 162-187, 270-289, 693-719	DADVEKKKIEKLKEKERREKLLRVFYP, EVDESGKKRKDQKAKRNRDHEVRSTE, EEAKLQRRKKRRLAAASTGE, EEALAKLQKQQEKKKKKTSGITPANID
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVW1	Transcription initiation factor tfiid subunit 7	1	94-122	LSSGMERRLHRRRRKKKSKHQRTAVSSAT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX34	Protein arginine methyltransferase NDUFAF7	3	2-25, 82-103, 158-177	LSFGKLRSPRFHKKDAKHDDKFIH, IDSNVLAKRSKRPRNVKILTSD, FSQGKRKTKIRMSSQSKKIT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX54	Subunit of a complex with ctf8p that shares some subunits with replication factor c	1	58-84	VLSNGKKVKLKPRKKEGSQKNARKSTS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY35	Uncharacterized protein	1	153-194	TRSTFPKYEKKDAKEEKKGRTGRGKKEMVRKPRERKERKNES
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYK5	Uncharacterized protein	1	185-204	QEKYQKCRGNIRNSSNRIGR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K072	One of six subunits of rna polymerase iii transcription initiation factor complex	1	1-26	MTANGIRKRGRPRKQKKSTSDDDEYT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0S1	Ddt domain protein	2	20-39, 798-824	GNNNRSRHPRHEKSPDESDN, LKTTRNLLKARKPRKINQKPVTKFNSE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Y5	Exosome complex exonuclease rrp44	1	1-24	MDRTLPKIRIRTRRSRALAGKRIV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K147	Putative zinc finger protein	2	63-89, 339-366	EDEERNLSKKEKRRRAKEALLEKKNKL, QYGAYKQSKRSWRSEKKAQDMNERRKAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K198	Patatin-like phospholipase domain-containing protein	1	61-89	QSDWKPIYNRTPGRHRHNRLTPKIQERTR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1G7	Essential deah-box atp-dependent rna helicase specific to the u3 snornp	2	1-44, 162-183	MEGSKGKNKRREQLREQLRKQYKTLSTQKKKRLNKYIEHQLKRE, SILGEQRLRRKQRRKHEDDDDF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K230	Clathrin heavy chain	1	1503-1524	AAVIYRKNKKWNKAISLLKTDK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2U5	General amino acid permease	1	530-552	FIGWKLVRRTRYHRDPRQVDLVS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K355	Cytokinesis protein sepa	1	1-31	MMRMLKPRNWRKKRREEKKRKKQLEAQAVDE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQL2	Transporter mitochondrial	1	712-732	TDKEEEKKKEQELKQSKKNNK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQY7	Metalloendopeptidase of the mitochondrial inner membrane	1	4-23	RSLRAFPKYKHPQNAAFKGV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR26	ATP-dependent DNA helicase	1	92-124	ASITSARKNKAKRKSRKRKKTRKDSDDDRQMKL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR51	Map kinase	1	643-666	SKQGRQFVKRCLRKDPKTRPTYAQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRE3	60s ribosomal protein l10	1	1-31	MARRPARCYRYCKNKPFPKSKYNRGVPEPKI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS77	Rna polymerase i alpha subunit	2	36-55, 397-417	PKSTQFHLYQHKKRKLNDVV, LTVPLKLPPIRRGRKAQNNNH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSU5	Atp-dependent rrna helicase rrp3	1	167-186	EAINKVKRFHAHRKFHPHNH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT06	Tryptophanyl-tRNA synthetase	1	408-442	LVPAVPREKKSKGKKESKKNEKKVAKEQKKDEKKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT26	Sh3 domain protein	1	183-203	GIPSKNWKSCNKQKERLTNLL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU84	Uncharacterized protein	1	29-50	FLSTEVKPARKQRKHPFWHGIG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUH3	Snf7 family protein	1	462-486	PKEGTSRSLKRNDKHPDKTREPLTA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUZ2	alpha-1,2-Mannosidase	1	9-35	KKGPLPLYYKDKPKRRSPLSNLTNFMH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV61	Wd domain protein	1	162-184	SEEREGSHRKRRLKRHQTLVCTL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV79	Uncharacterized protein	1	178-206	SSSLSDQQPQKKRQRKSKFKHRGSSCEFA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVG2	Dna repair helicase rad25	1	2-24	HLGKIPITTRRRKSKDNEEEEDV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVN0	DNA topoisomerase I	1	347-375	SLLEKEKERNEKRYTREKQKLDWDKKTIF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVS3	Klla0c00649g-like protein	1	98-125	ETDLEASKHRRNSRRRRSNSKEHRAHSF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYA6	Uncharacterized protein	1	1-23	MNKVKRNSKKRSRTDHTDKADIN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ22	Serine threonine-protein kinase hal4 sat4	1	4-26	VKEFKKRPSESEKKYSRRLTNEF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K088	Histone-lysine N-methyltransferase, H3 lysine-79 specific	2	3-50, 106-144	QSGVYRKKTKVLTPEEKRRRKEKLEESMMRKKELKRQQAIERAKRRAL, LDEVRQKRSTRRLKTLKRKKTLKEKKLIHKAAKKPKGTT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Y3	Tpr-containing co-chaperone	1	196-217	LAKVQDKKQKIKKAKEEKEKML
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1I8	Uncharacterized protein	2	12-60, 115-137	AESQSKSKQSTHNLKRRRILKAKCKSKTKQKNKSKSKSKITLKLKLSPK, EEDDKHGKKRCSRRDFRSCFNNF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1Q4	Cis-golgi t-snare syntaxin required for vesicular transport between the er and the golgi complex	1	25-51	RQNAKSRKSYSDQKRQPRSAINRNQFT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1Q9	Ypl034w-like protein	1	31-51	TSGTPKRRLEQWRRQCKHQFT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1W9	Arf gtpase activator	1	9-32	KEEIKKIFTKLQRRSANKKCFDCD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2W3	Putative rnase p subunit	1	82-102	IFDPYNRRKKKDQDEDEDETA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3D5	Pentatricopeptide repeat-containing protein	2	35-62, 269-289	AYKVLASAARKKKQRKSLSKAEKEKLWD, LIKHQGRKLKRDNFLKDKRTR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQD1	C2h2 transcription factor (Fragment)	2	298-323, 335-359	ECNVCHSRFKRKSDYIRHNKEQHTNS, DGTKWGCGKRFFRKDQLKKHLNANR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQZ0	Ppz1p	2	135-157, 304-327	HHHRSHSKSLQRPRKHRTSNSTS, TGTGQNVHRKRKKKPLNIENLIQR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT21	Uncharacterized protein	1	204-230	QKTANGKESKRAGKRKRSASPVSKETS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTA4	Putative calcium channel	2	54-87, 229-249	SSQPPVNTQKHKSGKHRFRKKLWRNPPPKALQSS, WMPSERSRLRRRKPPPLDVPL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTD7	Putative transcriptional regulatory protein ybr239c	1	1-30	MQKVNKGLPKKRGRKRKNTKASSKIFNQTH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU03	DNA polymerase delta subunit 3	1	329-372	NSKANSRASPKRKAAKAKDHVISEKGLSRKRKKKSASNQTSLMS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUA8	Myosin-2	1	602-627	LEKKTESLDKKPKRNRRMGAMRKPTL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV28	Uncharacterized protein	1	113-141	RPPQHRLRLPLQRQKRHPPRPEQHPHTGV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV44	Uncharacterized protein	3	62-86, 288-316, 353-394	EKDLDEKLLRKRPRRGNGGKNQLMA, WETSYSRSKGKRGKRRKRKDYSLPNIESI, LVVPSSPLKGRQRKVKRKTKERQEKEKKRRRKRKSKTIQRDR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVN1	Uncharacterized protein	1	54-75	IEEEKKDTRASKKRSRTTKVKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVU3	Transcription initiation factor TFIID subunit, putative	2	193-223, 412-431	SGSATTKTKKKTPRKNQKKNNKTQTKKLTKA, TSFACRLAKHRKSNSLDVKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWQ8	Pac10p	1	3-22	QKRWKFCKFLKEKHDKLVEN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXG5	Calcium calmodulin-dependent protein	1	111-137	MPVKLLKRPKEQQIKARRKSDDNKKID
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYM1	Upf0559 protein	2	244-264, 301-322	LCYGQERKPKESRKPIPKVLW, METLTRKKIQPNLKKRAKDEKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYP7	Uncharacterized protein	3	3-35, 304-329, 414-433	SINKSRTHFIPKLGKRRKNPNRTPNVPKPSDKH, LKKGEKYYLDRKKNRIRKLKLSNGSS, PFEKVEGKGAKRKKSRRERR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYR3	Uncharacterized protein	1	107-127	NKENKVRPGKRATTKFRPIST
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZV4	Radiation sensitive protein	2	1-21, 58-81	MKCPERCEKRRPSCEESSPNI, FEQFRNTSKRQAKKQRNVNIHADS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K010	Transcriptional activator	1	108-153	VRLAIQSVRRNKKRSEKRQALKILQEERKTKRIKFQQQRESSKFFS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K099	Aaa family	1	61-80	VLNGGKKKSRRSGGEHRIFS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Y6	Protein gcn20	1	129-162	QMESRVDKRKLKKAEAKIARKLAKKKDRHVKYEA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Z4	Arginine permease	1	540-566	EVCTEKFKMTKPKGWRGRARYYFDRLI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K190	Ulp1 protease family protein	1	1-29	MTNKERKKLKRLKKSQRKGHKQIISNNSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1C7	Gata-type sexual development transcription factor	1	96-115	QLRQQRQKIQQQQQQQQQQQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1D7	Ykl027w-like protein	1	159-179	DPLAKAVRRRLRKRGIMNGVT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1L8	Dead deah box helicase	1	7-29	PSDSGQQKIRKDRRVIHDKFQEL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1P7	Mitochondrial inner membrane protease ATP23	1	36-58	MNNDEKKKFEKEKKAHDDEKQCD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1R6	Elp3p	1	1-21	MKGPKGKRKLAPERERFLQCC
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2F6	Snf2 family dna-dependent atpase	1	310-340	PCAGRRRRVIPLPFLRRRRQVLPYRARRGPE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2T9	60s ribosomal protein l32	1	1-31	MAPRLTPKIVKKNTKKFKRHQSDRFKRVDEN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2U9	Uncharacterized protein	2	44-65, 70-92	EEKKAEQEKRRRQVEQKRQQKA, SEEQASPRRTRHRKKINYNEDAL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2V2	Uncharacterized protein	1	3-30	KKKTGRAKSGEAKKNRSKREQQATTKAT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K464	Uncharacterized protein	2	13-44, 314-333	LDEPERKKKSYFKRKMNKLRHRSQSPRSISAF, LSYRRANKFKVKSKKSMILP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSM7	Snf2 family helicase	2	60-82, 184-210	VENRHIVVKRNSRKKPGEKILET, GEREIMTRKRKPRKKFNFFKRQPRLMS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSR5	Uncharacterized protein	1	199-269	DLIPPKSKGKTRKSKRRKKAVKKKASSTKKVLEKKKKLGTIRKAPSDSSYRRVSTKKLHPKKQNEDNEEES
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT09	T-snare required for er membrane fusion and vesicular traffic	1	274-298	LVKANDRNKNSGRKFKRHDYFYGRT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTF9	ERF-3	1	363-385	KLEKGTNRKSKRAPAFAKKGMKI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTN5	Kinetochore protein nnf1	1	18-37	LKRGKKVAKSVHSKSRREKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTV7	Zn finger family dna binding protein	2	107-134, 149-169	SEHIKLSSSGKKKRRRKKYYEVERFYMC, LNCHILRKKHGRKRLPSEFKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU87	Rab gtpase	1	175-202	KMPIEETLKRRRDRKRGTVDLNKRPSTN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVE9	Putative zinc finger protein	1	1-21	MINCKLTKTSRRRQINYGEDA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVG7	Gram domain protein	1	479-509	QELRKKVQAGKEKSKRKSTSKKRVEKQILEV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVJ3	Glycerophosphocholine phosphodiesterase	1	36-60	GELNKRAFRKILKKLDKKTGTHRQD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXC1	26s protease regulatory subunit 6a	1	58-78	MEEKVKDNKEKIKNNKQLPYL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXT9	Pre-mrna splicing factor	1	95-118	RARSTPAPRRRKRWAPPPDRELPR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYR4	Non-specific serine/threonine protein kinase	1	256-286	AFKYLNTDSKKNKHRSKRKSVKCFSDFKDTG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ53	Putative compass histone methyltransferase component	1	84-105	GEKAVRDKKKFKPAKLPNSRIT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ67	H/ACA ribonucleoprotein complex subunit CBF5	1	414-481	ESSKDGKIEKSEKKEKKEKKSKEDKSSDEHKHHHHKHEKDHKHHHKHDKGEKKSKKRKSDDADDETVD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZH0	Uncharacterized protein	1	116-144	RSTSFSRKPSVRARRHRKRPQSMFIEKET
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZI0	Ykr023w-like protein	1	29-53	LERALEMKRQQKRLRKQHEDEEKAS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZL9	C2h2 zinc finger protein	2	34-63, 152-172	IGLAGLSRKKKEKERERRKRREEHLLNLIV, SSIRRHENKLFRKRLKERAVE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZX2	Vacuolar protein sorting-associated protein 74	1	1-21	MSSKLSRRRRVISKDKADGSD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K124	60S ribosomal export protein NMD3	1	398-430	PDVVLVKKYYKRSNKRRRNWKLKRMAREKEEIG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K158	Spt5_N domain-containing protein	1	115-134	GDDVHRRKRRRGNRFLDVEA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1V2	Chk1p	1	271-293	IEYTEHTKRRKLKRESNDDNLIF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1Z5	Phosphatidylinositol transfer protein	1	305-325	PALIKTCRKNRERYMERFKKF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K236	60S ribosomal subunit assembly/export protein LOC1	3	1-22, 28-51, 111-136	MTTQLYGKKKQAKKYSEKELDI, SINPGAIKKKGKKKGKKFVADGDS, ASQARSERRRASRLKKRLSKNVGAES
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2P6	Vacuole biogenesis	2	13-39, 121-146	APYGLRPKKGRVHLRKMKKLGKNYFTT, LDAKMRRLEKERRKLNKRPNAFKGEA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2T4	Atp-dependent rna helicase dbp9 (Dead-box protein 9)	1	527-562	GFVPFNRSNGRKRRRGGRNGKDWKKRKVDPLKKFRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3V8	C6 transcription factor	1	664-705	PGSFRKLKFHLNHEKHRKRRSQSARPSTKKAKKQTPPSTAAT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQQ3	Glutamate decarboxylase	2	1-26, 455-484	MNHANQSKRSRQRKKEHPGSKVVERL, PLPGESKCRNSSNRKNKQRDPPGGRQVRSE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR18	N-terminal acetyltransferase	1	349-372	PAFSLNRTKKEKKAEEKQREELVK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR34	Protein kinase implicated in activation of the plasma membrane h(+)-atpase pma1p	1	115-134	SSMVQLRKFFRPKRNRSHDS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRN6	General transcription and DNA repair factor IIH subunit TFB4	1	183-216	VMLKRKPRVLPLLKKAKRKRNSSTPDNPVKKREN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS45	Uncharacterized protein	2	17-43, 86-110	DEMIKMLRKAVRKKRKRREVSDSGSEE, TSKVVTNSHKGPKKKKDNLEFDSIT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSH7	Atp binding cassette transporter abc1p	1	1490-1510	YWLFRVPKKDRVKDESQLKST
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSL7	Eukaryotic translation initiation factor 5B	3	1-57, 87-117, 195-218	MQKRKRRRDWKRRRRRERKKRPKRLRNKKEKEKAKIAQLKKEGKYLTKKQRERAIAA, AGKKNDEKEKEREKERKRELKQANEKKKAEE, SKEVEKPAKKSKGKKSSPEPKAAP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTU2	Essential component of the rix1 complex (With rix1p and ipi3p)	1	1-34	MGSSNRHKKQKQKDFAKRKLKVGKLAPRRANQTD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU06	Ccr4-not transcription subunit 3	1	43-67	LEGDLKKEIKKLQRQREQIKNWMSG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU55	U4 tri-snrnp-associated protein 1	1	229-256	HSDYLKPKRMKRLKKKTRDGFRNQEKFI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU77	Transcription coactivator	2	41-69, 236-259	KPKTVSSKSTSRSRSRRRNGKGSRDHGES, RSSTPKSRSSSKPKPKATPKVESS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVU8	Uncharacterized protein	1	71-98	RKEINIPLKINKRKKKRQTNRLSTGEAI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVX9	Rna binding domain-containing protein	1	175-203	GKKTDDRNHHHHHHHHHHHHKHHHHPAEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWT3	Uncharacterized protein	1	56-81	NLLKLVEDRKQRKKQRELHRKQHLNE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX37	ATPase synthesis protein 25	2	31-56, 166-187	HNDIHEPKKGTPREKKLEKQNVSSSV, EFNKIQRRLKKKGRGAPQYAKF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX59	Vhs domain protein	1	387-416	AAPRRPAKPLAFRVKRGKREKPAAEPSARR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZW8	Histone acetyltransferase ESA1	1	89-123	LYMPKPQEKEDKKHKKKKQKKKKSTKDTDNDKGQS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0I5	Rsc complex member	1	683-708	VDSLNPILKRRRINPRKTIKLGHSAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0I6	Lactose permease	1	538-558	AENKRAKEKKELKELKSKQTV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0W1	Hexameric dna polymerase alpha-associated dna helicase a involved in lagging strand dna synthesis	3	2-30, 45-76, 302-323	ELVSAQNSKSRKPKNKRLSKSKEESTDFN, VDSYSQSEEKHQKKRKLKHSSKKIDQEEFKEE, MDSLTKKLRKVKHYKDRRELYQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1B1	Protein involved in the hog (High osmolarity glycerol) pathway	1	262-290	EENRKEKEGNKKRDETKVKEKMRKDEEKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Q4	Alpha--mannosyltransferase	2	74-102, 556-597	QEEQKEQKEQKEQKEQKEQKEQKEQNKET, LLETRKQQLRREASKRKYRQRTKQREIKNRIAQERKRRLLSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3S6	Dna-3-methyladenine glycosidase	4	22-62, 118-147, 517-552, 644-668	MVNNIPKGPRHNKLSNKNVNESRKGARRRSNGNHSKRYQHA, ESIETVSRRRRKSGRRRSSYKRSPNLNLSG, PDVFREFKKRLKERTRSTKDRKRREDHDKKAFDKEL, QEAKTSQGKQGKKGRRKKRIVLSLQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3T5	Dna polymerase v	3	234-256, 274-300, 875-895	VQIPTKQQDEKRQKNQNRQSTSW, QPGDDDSKKTKKHKKNHSRAPVERIKF, GNKAHKLIKKICKEKVKLVSE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K446	Chitin synthase	2	167-188, 803-824	SGNFQPRRYKATQKIFRPRNGN, YSENLYKLKERRKQPEQMREGA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRT7	Alanyl-trna synthetase (Alanine--trna ligase)	1	41-62	SESVNKAKKGKSKKSVEGKSGG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSH4	Phosphopantothenoylcysteine decarboxylase	2	505-525, 701-723	IVVKRVKKIQKIEKKKLEEHE, NPYILKMYGKKKSQKEVDKGFES
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSV5	Dihydroceramide delta-desaturase	1	74-94	TMYNRVKRRTAGRRLFKQVDY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSX0	Pre-mrna splicing factor cef-1	4	33-61, 174-193, 267-292, 376-410	RVSSLLPKKSAKQCKQRWKEWLDPRIKKL, LANTEGKKAKRKARERMLDE, VTEELKSQRKKERKRAKGGKQAKSTT, EEKPAPKKIRRHNAEHYRKKKEKQLKKELAKKLMQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTB4	Putative compass histone methyltransferase subunit spp1p	2	75-101, 345-366	DELFGRGKTQYKRKCRLPECYKPARVD, FCGLCVKDRKKCSKHLTWYTTI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU97	Protein puf6	3	8-32, 73-95, 424-449	EQAKEVLKRPRSTKKEEKLSKVTSE, ESHENQKKLLQERKKNRKSGIEV, EIYVKFSKETSKKPQEKRRTEILNYF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUM7	Transcriptional accessory protein involved in tbp (Tata-binding protein) regulation helicase mot1	1	137-158	NISKHHGHKRKTPDDSQKKTSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUQ9	Structure-specific endonuclease subunit SLX1	1	78-100	AYQTRHIPVCKRRHNGKRHTGSG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUV8	Putative hmg-like dna binding protein	1	31-50	EKDKRRYQREVKEYLKNKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV51	Protein required for accurate chromosome segregation	1	14-42	VPPERKHGFKFNTKKINRRHTLQPLRSIL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVK1	Leucyl-tRNA synthetase	2	142-185, 934-956	LKEEDERKKKEEQKKETGQHEDVTKFTAKKSKVKEKAGRAKFQF, AEIQSLKKKKKGKQVDVDVNRPV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVM0	Bud formation and morphogenesis	1	394-422	LDSPASIKASKRKKVKRNILERANSKNSI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXP6	Rnap ii-associated protein	1	27-52	FEGKVEKLRHPIRKNLRAKRVWNFLP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY88	Ribosome biogenesis protein NSA2 homolog	2	18-67, 134-157	LDFEERKRKKEARESHRIAKDAHRLKGWRGKKFAKKRYSEKVAMKKRIKA, FKVVRSGKSKRKSWKRMITKHTFV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYB9	Putative translation initiation factor subunit	3	158-190, 986-1016, 1273-1320	EKEEKEEDKKEEKRKRRRRKWKINQVSEERKDI, AESQDLKKSRKSKKKNGKKHHHQYHQHAVEA, RQEYVKKMSMQKEKEERKKEGKKEKGRKKQKEKRKKNQDSNPEIAQKV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYG5	Dna dependent atpase	1	12-36	NDDSGKILGKRKRRKVPIDDEYVEP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ36	Coatomer beta subunit	1	177-197	PVAIRPIRSRHRRTPSHQATI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZL3	Phospholipase D	1	22-43	FVQRWNYLLRQKRPSRPTPLLL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZY7	Vacuolar protein sorting-associated protein 27	2	49-69, 229-257	AMRSLKKRFLSSKDPNKQKSS, DKLEAQKKTSNKKSHKKHKSKASKYSIGN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K148	[RNA-polymerase]-subunit kinase	1	289-308	VEFPRPTPSKLPKSEKESKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1J4	Sac3 ganp domain protein	3	1-23, 53-84, 153-172	MATKRIQAKRTRRDIKVSKNVLE, VLTAEKQKQKRLAKLERKRMRRAMRKAALKAT, MNSEQRKKLREKRFERELQY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1K0	Part of small ribosomal subunit processosome (Contains u3 snorna)	1	59-83	FEQAHKESRKSKKNGGKSHPKTVDE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K210	Cytochrome c oxidase assembly protein COX16, mitochondrial	1	3-23	TFGNREFRTKKQQQERAKSFM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2U2	Putative phosphatidylinositol kinase	2	2396-2415, 2429-2458	DAKIMKLKRSCRRLERDLEQ, AEKMGVEQRKRARRNAKKEHSRLKLRSRME
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3T9	rRNA adenine N(6)-methyltransferase	1	1-20	MSHRMPKSRKQLGSRKTPSA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQT4	Cell morphogenesis protein pag1	1	176-195	VPTHRIKTTKSQKHQSTSPV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQW9	Kinesin-related motor	2	21-48, 50-71	NSSFSYRRCKSRGKAQQRRFKLNQSFGH, ANNGRRVSSRMDRNRRNKILET
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRH0	Dna topoisomerase ii	1	164-200	VYDSRCSKSQRKREEDERGTSKLRTMKPQAQRKRQRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSN5	Magnesium transporter alr1	4	59-79, 185-204, 359-378, 782-803	VETKSFHKHLTPPKWNKQYLG, GLRVPKKKPSSGRHRSKSMS, KYTPRFRKTKKSGLKNKVSE, QLVHGYGTKKRYKKEHKFWSVC
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU14	Kinesin-like protein	1	366-405	KSEKSEMKRVKRMKRVKRMRVKMKKKNKEKSEKNEKSEKN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUN7	Intersectin 1 (Sh3 domain protein)	1	1-30	MEKKKFGNRHKLLKQKKHLKAIEKKAKKGL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV75	Gly-x carboxypeptidase	1	5-26	PEDPERQTQHQKHRSWVKKATA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWP2	Uncharacterized protein	2	18-42, 202-225	WATSRNKNTKLVRMQRQQPRQAQVG, ASPAATPPTRRRRKPRARKGAGAA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWV3	GDT1 family protein	1	21-43	IIPGERRYRSRKEGNVRHIKQSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX51	Uncharacterized protein	1	1-21	MFRFKFKFKFNFKFKFKFKFK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXM2	Dna repair protein rad57	1	306-329	GVIYRQLMIRRRKKRPWEIKTGEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXN5	Chromatin elongation factor SPT6	1	105-124	EPVSGRSKFKRLKRGGDEEG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY80	Uncharacterized protein	1	112-132	GAPPEKKKRHFTKDALKQLKP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZE6	Alpha-1,4 glucan phosphorylase	1	1-24	MSGFQTPSPRRRFHKRSMTGFTPT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0D1	Uncharacterized protein	1	192-213	VALKSKDTRLRKIAKRFRGGKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0P4	Signal recognition particle subunit SRP72	3	539-570, 575-598, 609-630	KSAINSNRKAAKHRRHRQKPRRLPKNTIGNID, LPLKDRSYYRSKKGKSSNKTQGGV, TKEPEQAKKGGGKRKKKNKGRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1K7	Alkaline phosphatase	1	6-25	VMHLAPQKPQKGKKNIIMMV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K227	Uncharacterized protein	1	1-22	MVPAARRTRHKRVNYTEPKDYE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2A4	Iron sulfur assembly	1	119-148	ASGKSTRDGRRRLKRHHRRRKLRPLKAVLT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2L9	Yer010c-like protein	1	218-237	QDIREGKKCNPSQKARRAAL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2M6	Type ii myosin heavy required for wild-type cytokinesis and cell separation	1	555-579	ELETRDKKTDKKKLSFKPNKVRDGF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K421	Rme1p	2	401-426, 489-512	GDPVILKLLKPRKRKKYGDYKCLHCG, GIKGCGRMFKRKDSLRRHERLVHE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQF5	Exportin-1	1	513-535	ADDREEEKKEKARQEKEKAKLVG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRJ5	Putative spliceosomal factor prp8p	1	311-330	GYNNRRCWPRDQRMRLMRHD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSB5	Thiol oxidase required for oxidative protein folding in the endoplasmic reticulum	1	341-360	EETTGKKKEDGKKHIPNMDV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT12	Uncharacterized protein	1	32-70	LMQGRLRRERRINKKRNSISQSSIKRKKRKSVELAVAPA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUC8	Putative mitochondrial ribosomal protein mrpl3	1	26-45	VKPPQLTSTPVKRRRFKFSY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUD0	Uncharacterized protein	1	44-71	FSKQISKVSRERKKRERKLEEQRKKEYH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV78	Uncharacterized protein	2	224-246, 297-323	STNHGHHHHHHHHHHHHHHHPHH, SRNTLQYRSTAKRHREHKRRLTCAVIF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVB1	Elongation factor 3	1	1000-1039	AMGNKIATQKKKKLSSAERRRKRKERMKKKKLMGDDYVSD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVS2	Karyogamy protein kar4	1	2-26	NERLNKRFESDKRKRDIWRNTSRGI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXG2	Nucleolar protein nop2	1	16-67	EEIQTAKEKRALKKRKRLDSSKASESPKKPKAAKKDKKPRKKEETSETQGTD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY27	Transcription initiation factor tfiid subunit 11	2	15-55, 119-145	RRENTQSTKKDPNAPKKPKKPRKPRKPRKKKATESTGFNGM, QLSKAQAPKHKEHKKKIKLPEPEKPQP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYH8	Sso2p	1	239-259	VIKARDHAKKGRKWRWILFWI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYZ6	Uncharacterized protein	2	86-106, 289-313	QHYHSKSVSLRQKRKDHQDDL, QQQQQQQQKQQQQQQQQQRRQKLLV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZP0	Transcription factor tfiiic complex subunit sfc3	1	9-30	VIDDGKKKKNSHRLPLKLVSKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZP1	Largest of six subunits of the rna polymerase iii transcription initiation factor complex	2	79-116, 140-186	FQKVKFFKKPNLTLKLRKSKKVDKEKRLRKSRIGILKS, EHDLLKPLMRNKKRKKLSVRNKHVSSATHPGMKKKRTSVKLDRKYIM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZS7	Effector of rab gtpase forms a complex with sec4p and t-snare sec9p	1	2-28	VLGKNLFGKSKKKNAEKRSSNNWGAFT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZZ2	Putative membrane protein	3	299-322, 324-361, 383-408	RNEGKKSKWYNKLLGKKNKQWWEM, EEGMKGAKSKKKLKRSRKNKKGEKRSRIRKRLDETSDL, EAMMDNKKKDPEKKLSRGQKTKGVQS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K040	Uncharacterized protein	1	7-29	ILFMTRRHNKMRKQQNIETHAKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0A8	Mitochondrial genome maintenance protein MGM101	1	97-138	LWDPRFIKTFKKKKCEHIFVEHIPTHKKKMIWKRRDTDVEYP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0R2	U3 small nucleolar rna-associated protein 5	1	5-33	LRWIQRSKSVDQVRKRKSNDKPDGISKMN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K107	Homeodomain-containing transcriptional repressor	2	25-47, 111-132	VATSPSMRKRKRPTPVKKYAFIS, IWFQNRRQALRKHKVVKKMVVE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K114	Elongation of fatty acids protein	2	218-238, 260-279	YIDIYKKSTKKSKVVRRVGGV, NTGSPLPTKRRLHRGEKSEL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1P4	54s ribosomal protein mitochondrial	1	99-118	PDSVEEKKKKEKKPEKLLSL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K297	Faf1 (Forty s assembly factor)	1	36-60	EQLLRKQRLEEKRKLGRRHTKDDED
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K392	Putative fungal zinc cluster transcription factor	1	17-60	VELNPEPSSFRPKRKRNRPTVSCMSCKRKKIKCDRMKPMCGACL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K472	UV excision repair protein RAD23	1	66-90	QIIFMKSKLRKQKSKPEPKPEAQAG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQI8	DNA polymerase zeta catalytic subunit	1	590-611	DLTIRLSRVCQKQRNKDRWGYT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQJ0	Uncharacterized protein	2	139-164, 344-369	TQIPMPTAPRRRRKSSRRSDSSKSDS, MEHRLLKYLRHVKEKHKTGKNLQIMH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQY2	Mitochondrial processing peptidase	1	1-24	MDLTLKNYRKQRQENEKPVPKKII
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRB1	Mrna 3-end-processing protein rna14	1	16-36	LLKENNERRHSRKQLARFALW
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSB0	Mrna export factor elf1	1	22-44	GYESPTSRSRKPRGNFRKGKMSY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU41	Putative cell surface flocculin	1	631-656	SAIVAFYIRRKNRKQKQDQEMTEEKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU70	Elongation of fatty acids protein	1	290-316	FYINAYKKPKKATKSTPKKDVDEKPAA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV00	Cell division cycle protein 123	1	118-140	KADGETKKTAKKRERPAGVSRVS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVD3	Uncharacterized protein	1	98-117	NNLPQDKKMLRKRKIHPNVT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVQ8	Mitochondrial integral inner membrane protein required for membrane insertion of c-terminus of cox2p	1	86-108	MILASKEKFRRQRKIFKENGCQS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVT1	L-saccharopine oxidase	1	412-432	SYEVKQIKNWIKKTSHKRAAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWF6	Non-specific serine/threonine protein kinase	2	17-38, 357-381	MSYWKDSKVYARQKPSRALRGK, YDPILDWKKSSKKRKPGEHNAGAGN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX40	Translation factor GUF1, mitochondrial	1	520-545	ADISRKKKLLARQKEGKKLLKSRGQV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX80	Bud site selection	1	1-23	MTVLKRGRKKRKKEEDAPLLKDA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZI2	Dynein-related aaa-type	1	985-1011	ASQFRKDKIWMRRTKPSKRQYQIMIAV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZL2	Phospholipase d	1	49-71	ASLWRHGLFRKRKQDRNRGEDDE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K070	U3 small nucleolar rna-associated u3 snorna-associated	4	1-25, 413-443, 714-739, 822-874	MGRKNKSKSKSHRSRADYRQRAMNA, RGQKDSKRLKRIKSKAYRRIMKKERLKNKRL, AAKIEKKRLKEMERRKRKSHEDTSAV, DESTNKNRGKGKKGRWGKREPKTTIVEGVVSRNKRKDKNRKNVIINERVNKKN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Q2	Nucleolar forms a complex with noc4p	1	56-83	GLTGQTNKKRKGKKHSRKTPNESRRADR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0X4	Putative ubiquitin-protein ligase	2	13-45, 52-77	HSGWFSRIVRKKQSSSQKRSPSLRQKNGPIWHE, NPLSLNQKSSLRRRLRQNNTDFHTGV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Z0	Nuclear pore protein	1	445-464	IFTKRTKLSKFNPENKEKPY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K170	Maintenance of ploidy protein mob2	1	13-41	GDSARPESRSPNRRVQKQKGQNINSKHHL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1B8	60s ribosomal protein l6-b	1	13-36	DAPVAKKTRKAVRPQKLRKSLVPG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Q9	Uncharacterized protein	1	97-123	SPSKMTYKLSPIKKRHKKIPSISIKDS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Y8	Constituent of pre-ribosomal ribosomal biogenesis	5	29-64, 211-231, 289-308, 352-386, 393-432	YDEDTSNQWKKKRKTKEERQRDKRRKLDPNTNNDVS, ILEERRRKRELKKSNKQVEEE, LTAVRKAKKKKGPANKDIGA, DEQLLRKSLKRKEATKRRTKREWRERKKDLHELMD, LQNVWIQKENKRRGKKDQIRQLPSHKKLSRSNIKRARAGF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K308	Uncharacterized protein	1	299-331	YESLDKKKKLSPIRHKIKYPRKTKFPNTSVFHK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K365	Muscle m-line assembly protein unc-89	1	411-435	PNVTSTPTKASPRKRKLPTTEGGNS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3W0	RNA cytidine acetyltransferase	2	64-101, 1003-1029	AYKKKLLGFTSHRKKREKKIKKDIKRGRREPNELDPFE, KVKGTVSIKSGKKKRARKSAEEIYKEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K408	Methionyl-tRNA formyltransferase	1	236-260	GQLYTFKRYKSRKSRNGELKLRRVV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRL7	Yjr056c-like protein	1	232-256	CTDDKCAKRKVLPPNRHLKKSKVDR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS52	Histone-lysine N-methyltransferase, H3 lysine-36 specific	1	589-615	EQFALRELQKKRRQEQKKAVKVEEQKL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS86	Snf2 family helicase	3	5-25, 339-369, 1281-1306	AQSKFFKSRLRKKESLWEKPY, RELHRAVFKPTRRPKRRCTKRLKFDPVTYDY, RYISSADTGRKRRRVREERGFVNRHQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSA0	Putative transcription factor	1	596-627	SSMISQAKNHTKRKGKYKKKKGQAMSNSGREN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSB1	Mrna export factor elf1	1	558-593	DDSSPADIKIKKKKKRKMTRNEKKAQAERRRLRYMA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTL0	Wd repeat-containing protein	1	106-130	QKEYGKKQEKEGKKEEKQYGKRDYR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU32	Cysteinyl-trna synthetase	1	1-22	MSEKSRPKNKHFWVKPKTETPA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUY5	Zinc finger protein	2	470-496, 520-543	FCGRIYTRHSRLKKHFLTKHSGKRFVF, GKYKCPKCGSTHDRAKRFRQHLLQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVD6	Myosin-4 skeletal fetal	3	17-40, 51-78, 629-661	NINKESTKWKSPFRQGNPNVQNRT, MNKIKLAKRNLGAKKRVKKLKEKVEDVV, IQQKEEQKRIKEERKNQKKLERLKSKRHSFGLN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXB8	DNA-directed RNA polymerase subunit	1	136-155	RKMKIVKKVLDQAKKQRRCL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXY8	Putative histone acetyltransferase saga complex component	1	957-981	IYTYYKEYLAKRKKLKDLKTALEEF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY12	Putative nuclear dna repair complex smc atpase	1	128-148	EENMKLKQKHRNVQQKIRDSD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY34	Membrane protein of the plasma membrane and er	1	38-63	SDVEEEKPKSRRPKENPFTQQKLKAV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYE8	Uncharacterized protein	1	30-58	LRRNVRESLAKKKKVKKNEVKIAPNAKNS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ81	Tae2-like protein	5	71-95, 195-223, 746-780, 813-836, 959-979	PQPTSFCTKLRKHLKSKRLTHVEQV, EEQNKNRETSGKKKKKKGRIFSVNKLCFM, SKDSTTKLLRGKKNKLKKIKRKYKDQDDEERRLRM, IIEASMRKEKKKQQQINQLQHLLE, AEVKKNKGGKGSKPKKGRRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZE2	Putative signaling network protein	1	699-718	YAPSRTQRTVRGRSRSKSSL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K003	Uncharacterized protein	1	257-283	SSVHKIAERGRKDRKKSENCTNRKACK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K075	Nucleolar protein involved in pre-rrna processing	3	455-501, 522-554, 588-623	ETTVERYRNKEKERKKKRKEKIKELKKKEREERKEKHLKKGNRYMKD, KMKDIMKAEKLKHKKKKNRKQRKEENELQNIDD, MEKLIRQGQKRAKENNLKKNGDTKRKKHPRDEDEEN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0T1	Transcription initiation factor IIF subunit beta	1	165-187	GTTRSDKYVKKNKSKFKRFVPYA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1D0	Atp-dependent rna helicase rok1	1	500-570	PKWLREGMPKLSKKKKHELKRNPVKRGRISTVPNIDRKRKKRRDMIDGSKRRELLNKPKNRKLQDNDDQAA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3I7	Fun19p	1	200-229	SDSSPVSPPPKKKRRRRRPTTRKANSATTR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQC6	Amidase family protein	1	360-381	ITIPVSQRKRCKTFRYLLDANR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSA1	DNA repair protein RAD51 homolog	1	342-364	SSTTRLYFKKGKGRNRICKIYDS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSQ9	Non-specific serine/threonine protein kinase	2	593-618, 1086-1106	NSPHEQDKRRSRRASRRMSKLKRLST, IKNTRKTSFFRRFSRKSHEKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSS6	Mitogen-activated protein kinase	1	260-282	VASQRVRRKIPMKKIFRNANPLA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSW9	Protein gis3	1	105-129	ATNGCSKCYQQKKPSHKKSLLQLVH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTF4	Transcription factor	1	373-408	EKAKVISKKGRPSNKRQKRIRSKTPVLRKARNLKVS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUD6	Myosin i	1	256-275	IVKCEPPKSKSRPAPPPPPS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV59	Fad transporter	1	702-727	RGKSLLSRKGTTRKNKKQEDDLPLTS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV99	Deubiquitinating enzyme anchored to the outer mitochondrial membrane	1	368-391	SSGHYECYKRKPKYYKQLSTGKYY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXU4	Monocarboxylate transporter	1	572-594	AVDPLKRTEKRPHQTRQIPCSFE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY18	Uncharacterized protein	2	1-40, 143-165	MEVKKNMNKPNRSEKNKKDRKIKAKGKKAKQEQKEFSIPP, SSQSSRHSRNQSQRKSRSRSSRA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYA9	Rna-binding la domain protein	1	217-278	KKGCWLQEREMKRRRRGRRRRRKRVRRRRKRVRKRTKRTRKRTRKRTRKKKTSSNKIQDMCV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYH7	Ph domain protein	1	422-443	DCLLSKSKHEHKFKFNIRGKDQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYM8	Uncharacterized protein	1	114-138	NFLKNHPSSLKPKKRERGTVKLDAA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZG0	Telomere elongation protein	1	108-129	LFANKLFEHRPKRNRLFKEDVT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0D3	Zinc finger protein csr1p	1	16-41	SDPSSRSHNPQPQPHHHHHHHNYTNF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0S9	Transcription factor hac1	2	18-70, 123-142	GKIGTLPPRKRARTKEEKEQRRIERVLRNRRAAHASREKKRRHVEQLEKYAKQ, DSSSKPLKRKKSKSDISTPE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Z9	C2h2 type zinc finger domain-containing protein	2	261-283, 306-327	MSFARHSDRRRHERNQHKVSPGF, GLLAHWRSQKARKKCLNGVPDV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K199	Uncharacterized protein	1	185-204	GQKGGKRKSHHYELKERANQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1E2	Nuclear envelope morphology	1	214-237	RPIRTPVARNRRKSHKKTFIFPRL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1F3	Ribosomal RNA-processing protein 8	1	1-29	MMDSKDDDTRKHKKQKHKADQKPIAGKNI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1S6	Putative rrna methyltransferase	1	36-61	RELSEKEKRDQKRKRRANNEVRQKEV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2J1	Uncharacterized protein	1	248-267	GFLSRFKQDKQTKTHKRISF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2U8	Putative yta7-like atpase	1	503-529	AQAKREARRSARRRKLRARSDLRLKNT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2V9	Ring-8 protein	1	573-598	ILDTVRQRRDDRHRARERSRREAVED
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3F6	Vacuolar atp synthase subunit d	1	176-203	DAARKAKIKEAKRKRKEAKKQAAKKAAE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3U1	Fatty acid synthase subunit beta	1	1973-1992	KPFKRFLIKKIPKSAVKPAL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3W5	Poly(A+) rna-binding protein	1	7-30	IDDRSRGRERSPRREDARDRSRSP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K461	Guanyl-nucleotide exchange hops complex subunit vam6	1	1-21	MHNKKKKDPKSKKDEDYLINQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQS9	Bud-specific protein with a putative role in membrane trafficking	1	125-144	YYRSCIRKYRQKIRLEAQRE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQW5	Non-specific serine/threonine protein kinase	2	320-339, 725-745	LNYRLRHSPRRPKRLTPDQL, VKENKHTLQKKDANNNSKRID
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR57	Zuo1p	2	87-117, 166-208	TSNRDHKRYIEKKNHSARRKRKTDDNKRLDA, AAEKAKEAQKQKREKNKKSKEAKKSAKKKSKRTIRAAVKDTKY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRY0	Importin subunit alpha	1	7-59	TRYVPEYRKANFKNRNRFQKDEVRRRRETQQVELRKQKREQLLTKRRNFNPEA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS80	Uncharacterized protein	1	664-683	GSGKSHYNTRINNRNYNKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSN1	Sh3 domain-containing protein	1	203-228	RDIIARRKQALREKQKSRAAKRSGEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSQ1	Translation initiation factor subunit of the mrna cap-binding protein complex	2	582-616, 658-685	GSRRRSGRGEKSRQGSRRRKDSHRSRRGEPRDMRE, LLKKAEHKWVPRSLRKKEKEKYAPDGKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSY0	Ypr011c-like protein	1	1-22	MKAWLARRRQKKYNLSHPEDPV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT62	Uncharacterized protein	2	53-86, 142-163	HEYEARTKKKKETYKKGSPRKRGRRYPKQSTTLN, SSTKKRPSSKHEKPDHNFNHRN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTI1	Uncharacterized protein	1	5-33	IEDMEKRMKHHQEQQRKRRRSSVHYQSKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTI9	Putative nucleolar ribosomal biogenesis factor brx1p	2	12-37, 269-289	KEMSQTKGSKVSKKRVNRQRVLLISS, VDKKVRKSSRVAKKNPLSNDA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUT7	Cytosolic regulator pianissimo	3	99-118, 1218-1239, 1275-1297	GSKKEKPHIIRQLSAKRKRS, VSQGKAYRNLNRSKKRHQLFSS, MENLLKLEKRRMKRERVTPSSPA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVQ2	Uncharacterized protein	1	36-55	STLSTPKKSKGKQEKIVTPS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVQ5	Rna binding protein	1	233-255	TPSTSMPSYRRRRENRTTGKELI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVT6	Origin recognition complex subunit 1	3	20-52, 225-255, 296-343	NEASKKSDSLPKRLRNSRRSHRKDPEIVLRRDN, IDPRSLKAEEKKLKRKKKRQQQKNTKKLDYA, YVDRKFRSSPRKKKTRAGRPRKRKRSKVNTPKKRLKPRLPRVARKFQF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWM0	Nitrogen permease	1	76-96	NSTFSKSSRKRLEPRDKVKLT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXD1	40S ribosomal protein S24	1	95-129	GLANKIEKPSRQQRKQKKNRNKKVFGTQRRYAAKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY04	Ubiquitin carboxyl-terminal hydrolase	1	195-226	QSSKRKSFFNHRHKKTKDKRKNSPSRNTEYGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYB6	Plasma membrane iron permease	1	31-53	FVKQSVAKDKKLKKLYKQIWFGA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYM4	Plasma membrane atp-binding cassette transporter	1	334-371	NSSFNEKAPWQRHRLRRRRLRDNRRLRGHQKAGRVRCG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZS5	Respiratory growth induced protein 1	1	87-107	NSLNKKFRRHLKHHLKRHLLP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZU4	Chitin synthase 3	1	34-55	SGSLQRKRTLVRRNRSRHTFVY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0P2	Very long-chain fatty acid transport protein	1	547-569	ELTSSHKISKKRFRDPILPAGKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0P3	Trna pseudouridine synthase	1	16-43	LTSDGKPMFPNEKRKPKKKVACLIGYCG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Z1	40S ribosomal protein S25	1	15-39	AAAAGSKKSKKKWNKGKVKDRADHM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K281	40s ribosomal protein s23	1	3-31	KGKPRGLNSARKLRTKRRNNKWADSLYKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2P3	Essential protein involved in rrna and snorna maturation	2	149-169, 177-221	TESARKRKSSAKETSCKRRKI, EDEQRLHRHKHHHHKSKKTRLDGKVSQKKHHKHSHSVEKEKKNSR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Y2	Ubiquitin isopeptidase	1	704-726	RWMCPVCKSKQRSSKQLRISRLP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3X7	G1 s regulator	1	209-240	ETGLKLKRKREMQKAERIKKAKHDSKPGYCEN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQN0	Uncharacterized protein	1	56-94	GPNPFSRPRRNENRGRKNGRQFSWEKKQHKEQDHKLIKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQT9	U3 small nucleolar ribonucleoprotein	1	243-277	DELSRADKSRLRRAKKRKIRNRMKENAEKKRRVLV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRL5	D-lactate dehydrogenase	1	30-49	DVQIKAKKEEQSNKNDQFKQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS62	Major facilitator superfamily transporter	1	17-41	SEPEESKWKLWQKHKSKLWDTDKSP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSC4	Translation initiation factor rli1	1	10-33	IVSADKCRPKKCHQECKRSCPVVK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSG0	Transcription factor	2	69-94, 100-125	IDDEDKHKAKSNQKVRKPKSECPYCH, RGYLTRHLKKHSKKKAYKCPFYDPNA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSN9	Uncharacterized protein	1	234-260	DGVESKCGKHRYKTKIKKNAHTRLIIT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT25	Uncharacterized protein	1	1-32	MRRPRRMLSVRKRQLTCKKKKKKDLAPILADL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTH1	Target of rapamycin complex 1 subunit tco89	1	298-317	ASQFRMPRRYQPTTRAQQKL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTK1	Chromatin remodelling complex atpase chain isw1	1	102-121	VEQRKEANKRQRRTEKEEDE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTR0	Uncharacterized protein	1	327-349	QDEIYAKKKRELKKKMNGICKSG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU83	Ybr030w-like protein	1	319-338	KLDKKFKNEMRKKDKERLED
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV42	Uncharacterized protein	1	50-74	GSIRPNSTYHHKRRRLTPRPLHMDI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVE7	Membrane protein	1	403-422	VARKKYQLQKVKRGLRKTKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVQ1	Transcription factor tac1	3	3-35, 42-67, 835-857	VLRAGHRKRTSKACDYCRSKKIKCDGRPQCAVC, CTYNYVAKRRSASKKKNSNQVKVESA, NCSVDDPRKKAKKPFSGNQNFYN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWD8	Bzip transcription factor	3	53-77, 200-222, 490-509	TRIVTSKKWVLPPRPKPGRKPSADV, EDSVPIRKRRRVSRKSPDQSSKD, PDAYRKLSKHSNFRRERLGN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWG0	Phosphatidylinositol 4-kinase	1	156-176	EDWNKKKQRIRKHSMYGKHEN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXU3	Uncharacterized protein	1	79-103	HEISRQKSLNQQEKRKRQLPQHNSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY00	Glycogen [starch] synthase	1	426-451	DMMFSFCQKTRRQRINQRNRVERLSD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ77	Putative ubiquitin-like protein-specific protease	1	239-258	STPVKKQKNLPKVKLNDRKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZA5	Uncharacterized protein	1	379-408	ESKFEEKEIQKRLRKLKRHCMEIKHTYFRD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZM3	Putative dna binding component of sbf	1	80-134	DGPVPRKQTSKSRTRKHKNISSSYPATKKRKNEDKPRKRGRKSKKESVSEKPEQS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1H1	Trna isopentenyltransferase	1	191-214	QYQIHLKSKKHRRAINKGKKEYEA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3Z0	Guanine nucleotide exchange factor	1	46-67	IIVQPDHKKKPLKRYRELVLNE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQQ8	Mfs monocarboxylate	1	64-85	VIFLKPRLPAKRKKGQNFLRLD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRN8	Dna recombination and repair crossover junction	2	246-274, 352-376	DDNANMKPSQPKKKRKKSKAKAAEQINTL, KFITPATAKRFNKKNPKLISKSCTG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT37	Uncharacterized protein	1	10-35	QGLTLQHQQQHRRRKRRDYHAYAALG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT71	Uncharacterized protein	1	25-85	ELAAKKAKKEAKKKAKEAKKKAKMAKFLAKKKKREQLAKNQAKNQATKQKKSKEKAEPAPC
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU17	One of five related septins ( shs1p)	1	529-552	LEKKAMQLKLKEKRLKERIASRGT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUL0	Nucleolar gtp-binding protein 2	1	287-312	EEYGVDKKGYKRKRAEREVRNDGKSV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUZ4	Dna-(Apurinic or apyrimidinic site) lyase 1	1	90-122	GAPGRKEQLKFEKKKKKEATTRKRKATGKNGDI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW05	Uncharacterized protein	1	71-90	NNRYQRNKYKGDQNHRRNET
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWS3	Transcription initiation factor IIE subunit alpha	1	210-229	EDIKRERMQREKRNEKLRQN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX10	Phospholipid:diacylglycerol acyltransferase	1	11-36	SPTATGRDSFSKKRKNKEEIHEIEPT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K092	Uncharacterized protein	1	496-516	EDSSRRKPSASRRPREAVRTH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0A4	Subunit of the hir a nucleosome assembly complex	1	268-293	TALRKCLSYDKKKWQHKPRYKIARIY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0B1	Serine threonine-protein kinase sch9	1	89-109	AMKVLSKKGNCEKKRRLAHTI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0H0	Uncharacterized protein	1	347-368	FFSHLFGKKRHSNKRSTKSSAS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1S4	Cingulin-like protein 1	2	1-20, 529-548	MSHKSGKTVKTKKDLKQSGA, DWKEWKKYNDMKKNLFKARN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2X3	Swib domain-containing protein	2	15-48, 161-181	IHKGITKRKTQTLPDKKPKKRKMIKASNLSKKEP, SKSNNVKKSGAKKDRSHLKKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3D8	Putative RNA polymerase II transcription factor	1	221-244	AKETDRHKEKGRSKKRRASDLQIT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRR8	Chromatin modification-related protein	3	205-225, 308-335, 371-390	LRFNIKKPKIVKPKKNIKSLI, EVKQVSSNSTKKKTRRRVNSKGEPIYCY, AWYCEDCKSKMRRKALQQAH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS03	Putative u3 snornp protein utp8	1	717-746	DGVSGRKKREQAERRRRRRDTQSQSKTVEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS98	Gu4 nucleic-binding protein 1	1	158-181	DELRRVNRKKWEKIASLKTNNKGE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUW2	Sporulation protein rmd1	1	89-108	DLGPRMKPQRTSKNSQKLKL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV84	Aft1_OSA domain-containing protein	1	292-318	VANSATPRRKRESKMAKEPANKKKKLM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVT8	40S ribosomal protein S1	1	1-28	MAIGKNKRLSKGKKGLKKKVVDPFTRKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVW0	Tfiid subunit (67 kDa) involved in rna polymerase ii transcription initiation	1	1-36	MKMKTKMKMKTRMRMRTKMKKRQEKQRLKAEKLMKN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWL6	Putative pp2a regulatory subunit b	1	43-62	ICNGKPKKQSQAQGNTQHLR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWX3	Mitochondrial type 2c protein phosphatase involved in regulation of pyruvate dehydrogenase activity	1	286-308	SDPAAKAEKKPFRQFNKNSKEYL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXQ8	Sit4p phosphatase-associated protein	1	40-70	ERLEQEKRKAQKKAVKDKQKAGSKRHPDDEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY40	Nuclear encoded protein required for translation of cox1 mrna	1	58-78	KEYHRTQKWKILKKVNVYEHD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY89	U3 small nucleolar ribonucleoprotein	1	286-312	VRLPASKAKESKRDRDKRMRNEFFGRG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYL2	Putative set3 histone deacetylase complex component	3	405-425, 773-798, 919-938	PVPSRRTRRIHRLISRRDQAD, GEQQKLRKPSKSSKKQKVVPEKEPNS, ENERLERKRIRQQQIAKNIE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYM3	Abc transporter	1	359-388	VPAERARVRIHRHRRHQHPRRPIRPPGPSL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYN7	Dna-binding protein snt1	1	198-253	DLEDRIKKDKENKKDEKKKKKEEQQRKAREQALKEEEERKQKARRARHHGDSVRTE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0V1	Adhesion and aggregation factor	2	268-288, 551-571	SLKVEHTKRNRRKSKFTEEQD, GTNTTRKKAAQIKIQRDPNFN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1H2	tRNA dimethylallyltransferase	1	133-153	GDSPDKFKKKVDRSEKDIEYK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1J3	Protein phosphorylates the alpha-subunit of translation initiation factor eif2	1	176-201	KYISAIRHHRGKKKKHLDKQLRLAWN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1R8	Copii coat assembly protein sec16	1	163-206	EKSKKEAAEKRKKEQERKQKEEKERKEQEKKKKKSNASKGWFSW
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1X8	Translocation protein SEC62	1	249-274	WEDPSSKKQGHKHKHRKTTKDTGDAS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K256	Asparaginyl-trna synthetase (Fragment)	1	56-90	SSSALKKAKKISQSLKRKQEKKKKLEEQEAKRAAE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2J0	Uncharacterized protein	2	1-26, 48-76	MRSTPVKRKRGRPSKHRENRVGESTL, VCSSPVMKLKSPKRKRRTQSNSSSNNSSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K340	Ste ste20 paka protein kinase	2	1-24, 129-153	MTGNSGNRKKFRDKFRNCTIDCPQ, ANPYGSPKKAHYRHRNKRRGSQLTE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3P4	Serine threonine-protein kinase atg1	2	394-415, 471-490	GILLHKKYKKRKEEEENEREIR, ISSWKRKREMYERQKKRLLP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3S4	Myo-inositol transporter	1	448-477	GFNIKASEKLAKKRKRQINNKMKDQDKPST
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS71	Nadph-cytochrome p450 reductase	1	92-111	ATGKRTSKTLKSKNAKQIGE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSX5	Uncharacterized protein	4	47-67, 77-97, 109-132, 161-194	ALSDRKFPPTKRKHMEEPSGY, ELSHFKKYLKKTYPNVKRTDF, LEIYRAKKSKAKKQRRLKPGLFVT, SIYPEKKKNKHMATPKQKSKPSRKAKKTEDTESF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT08	Uncharacterized protein	1	131-158	SSPNRKTLLLRPRRIKSRRRGSSSKVGD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTC8	Dynein heavy chain	1	457-478	LSLQPLKNRKFLRKVIQRAEYE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTM6	Transducin family protein wd-40 repeat family protein	1	418-465	GRGMDRSRDRERNRERDRDRDRDRRSDRDRDRERDRDRERDRDRRSDI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTW0	Protein msn5	2	1080-1099, 1111-1140	EALLADCKKLRQRRNCFLEL, TGDDEEAKRRERRKRLDASRRSKRNTNGGS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU69	Subunit of a complex with ctf8p and ctf18p that shares some components with replication factor c	1	346-369	EKFLLKFCKVKRVGKKHYAMPMRA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUD7	Myosin i	2	1-33, 725-754	MAGFLRKRNRNRNKTAPPPKKGGGKIKRAQYEH, ASKAKIIQRACRRYLRRRERAARIVQRLWR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUR5	F-actin-capping protein subunit beta	1	11-30	DLLRRLNPKKISKNLLNLCR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVE5	Uncharacterized protein (Fragment)	2	1-44, 135-154	PKTSPKTSPKTSPKRQSPKTSPKTSPKTSPKTSPKTSQKTSPKI, SIQKLQRKKKQHSMKFVPPE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXF1	RGS domain-containing protein	1	240-263	GNGSWGKLTRKFKWRRASSSSKSD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYT3	Uncharacterized protein	2	319-340, 471-498	EDVLHKRKPVPKQRPKSVAQIK, GTMIKDDYARHSKKKKRFKFKKFFSTSG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ89	Choline kinase	2	1-21, 28-57	MSTVPKHRKFARGRRSAPSSP, LSPALKARRRSLSRPIYRRRRSSSSTRSIH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K047	3-hydroxy-3-methylglutaryl coenzyme A synthase	1	433-452	DDKFRRSYTRKGAKNEETLA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K119	Protein SDA1	2	127-151, 153-182	KGKIMRPHSSTNKQKARKKNFMMMV, NRGVQGKKKMSLRQKQRVLRAHIKRQKRGY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S7	Pop1p	3	96-125, 146-173, 629-655	PRELRRRTASHNVKRVPKRMRPRALKEMGL, KSHPRGRELYRLRRKQKLLKYAAKHKLS, RIRMEENTKRWNRKPKSKRIQYDSLQL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQY5	Cullin binding protein	1	310-331	LSFIHVCSKKLFKKKRSTKAGY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRT5	Uncharacterized protein	1	26-50	LEKSKGQKNGKKKVKQRVARNNFAA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS02	Uncharacterized protein	1	45-70	GTVVQMRSTKKRRRFDERRGRPAKAI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS33	Isomaltase	1	491-510	VLNFWKRAIRVRKENKDILV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JST1	Fungal-specific transcription factor	1	58-82	TDGGSNEGKRKKKKTGSLKSVNDLS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT96	Lin1 family protein	1	314-338	CGEEYKQRELKKRRNTQKRESITIS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUE5	Formin binding protein	1	502-539	FEVLKRREDEEKERRNRKRTLTERESSNKKQKLPRLGY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUP3	Seryl-tRNA synthetase	1	51-77	ELNKKQNKLQKEIGKKFKNKEDPKELL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVX3	Snf2-family atp dependent chromatin remodeling factor snf21	2	333-359, 394-421	DDDADRPKPGRKRGRKRKAESEKSAEE, PEDAPTIKRRGRRRRYKVSPPVCRKPTD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXA5	Ribonucleoside-diphosphate reductase	2	6-31, 768-793	QVWVVNKKGSRQRFDRPRLRQYIEKL, SPTMERESRSREARRRNSRIRGSIAG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXI0	Golgi-associated retrograde protein	1	31-61	EPTSRRISRRSISHPKRKKNADTFKKDDTPM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXN1	Lyr motif-containing protein 2	1	4-28	KLTNTALRRIRHKPRRKPVDDISFE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY10	Protein lst4	1	118-139	IIKLLKKNYKPQTNRNHRTSKN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZC6	Uncharacterized protein	1	248-274	TEKEDVGMKKKTKKGRKKEEASSPPSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K031	Uncharacterized protein	1	98-118	CSCNSCCCHRHPPPPPPPPPP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K035	Oxidation resistance protein 1	1	9-31	RSSNSSPKSPLQRLRKRLTDNIS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K061	Constituent of 66s pre-ribosomal required for large ribosomal subunit biogenesis	2	18-49, 508-538	TSKNKEKSSHHHHSHDKHHNKHHEQKTSKAES, KESDHNTEGRHKRRAKKGKHGGKSVKQEIKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K069	Uncharacterized protein	2	54-78, 193-212	GNKEYQGSKKSRKRKLKESTEYDKY, KPEVTKKSPGKHVQETRQNL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0M5	GTP--RNA guanylyltransferase	1	390-422	EPDIKKRWIERENIKKQRQKQFQQQQQMQHHQH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1C8	Spindle pole antigen	2	77-99, 876-895	LLPQSNYHPKRNQARQKLAALPS, GSTPRSSKINKFKQRFEQND
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S0	Mrpl49p	1	152-181	KTKPMYVKEITKKRNRHTRHVQVKHDLTKI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2U6	ATP-dependent 6-phosphofructokinase	1	211-230	ELGKASTEKKPKKRIAVMTS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K318	Beta-tubulin cofactor d	1	697-716	KYQGCRKRIVWIYRNHPSPK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K326	Tyrosine--tRNA ligase	1	292-327	AAKGYPEPSKNNKQKKQKKQKNRGSRYPGKKDEEKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3A1	Fe-S cluster assembly protein DRE2	2	180-203, 225-247	GPLKNCGRTGKKRRRACKDCTCGL, QKTVKVGKTEKQAKKQEQKTGKV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3M8	Na(+) h(+) antiporter	2	514-548, 637-667	ATPAGLRRRRLKQRRLRQVRRRKKKELERLSRENG, IRSKEKLQQIRERKERRRKRLSKLKGVQEGE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3N3	Dom34-interacting protein 2	1	56-85	CELFRFRTEKEMKKATKRTKRLQAKGLSEA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3R3	Protein required for s phase progression and telomere forms an alternative replication	3	35-59, 359-386, 728-753	DILQLAKKNDKKRHDLKAKLIALKR, LKNVNPRKRQQFLKRQRKKNKQDSEMGD, RILKRGEESKLRKNRRMFHANPKDFF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQE8	Essential subunit of sec63 complex ( sec66p and sec72p)	1	56-81	ESYNKQDVQRLRRRKARSGAFFSKKF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQU1	Fungal transcriptional regulatory protein	1	23-53	SGKYSDRFKEEHRKKAPKRKGKEFAAHESKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQW0	Ymr244c-a-like protein	1	65-94	VASWVKYFKQKRPFDKKKAKILKQAKDEGA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRM3	Ste-like transcription factor	1	7-30	LRFLHRNQCLRTQKKQKVFFWFSV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT10	Gtp binding elongation factor 1 alpha-like protein	1	176-195	FPSRHDNKERKRQKLETQLD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT63	Exonuclease 1	1	220-249	KHDLGDKGRKDKDKKNKDEDKNSKKETVKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTA1	Cell wall biogenesis protein	2	458-479, 1237-1262	DEVWTSKREKEEKKRIKDYKEW, FPTCTFVVPCSRRRKCQRFFGCLHEA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTF1	40S ribosomal protein S7	1	101-120	PKPARNTRQAQKRPRSRTLT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTR9	Atp-dependent rna helicase dbp7 (Dead-box protein 7)	1	29-48	GTTSHKRQRVTKERGSNGGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTX6	D-lactate dehydrogenase	1	83-104	DGTVIKTKKRPRKSSAGYNLNG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV41	Mitochondrial import inner membrane translocase subunit TIM44	1	182-208	YYGLYETKEQRRKRREREKLKEPKTVK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVW3	Nonsense-mediated decay protein 4	1	379-410	EFSHSMKSKSKGYKKKRGFKKKSSSKSTATSM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX97	Pre-mRNA-splicing factor CWC26	1	9-37	LSSLNTALKRIKSKKRKHRGEYELANHEV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXE7	Uncharacterized protein	3	525-547, 573-598, 794-823	RELPNSRKMRKWREKEAKLSARA, STISNKSERKHKKEHFFRFGKKHERN, SDNMENSRKQERREKKKKSFGRKFMRFFDL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXK9	Proteosome activator subunit	1	787-815	QQTAGHRRSTQPPRQHRRLCRNLHSFRFL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY36	Protein sur2	1	306-328	ITLKGYKKFLHDRTDKRRKIAKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY79	CCHC-type domain-containing protein	1	248-308	SVNRLSFRSNRKRERSDDQRNKVAGGDNLKKKRKKNLQKLKCFGCKQRGHLKRNCPNKQGG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYA3	Uncharacterized protein	6	1-20, 23-48, 94-118, 133-154, 663-693, 871-890	MFKRRMRMKKEADQKHNLDT, KLNKPLRTLSQQERKKLKRNVSYIIS, EVQDCEKQNVKKQKQKPPFLHPVEF, KEWKQDCDRHYKHQKQRLEEEF, HDVHDVNKENKKKKKRKNKEKDNKDNKEDGD, NYIARIKKENEEERRKFREF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ74	Uncharacterized protein	1	13-34	AAARAEKERQQHKRSNNSENVP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZU9	Alanine--tRNA ligase	1	839-859	DKDVKNELKKRQKAATKKAEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1F4	Uncharacterized protein	1	192-217	CGSHSGRWGARPRRKKTQALSETKDY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1W2	Protein phosphatase PP2A regulatory subunit B	1	458-478	ADKSAFKTKRMGSTKRKNLSM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K242	Bud site selection protein	3	289-310, 425-445, 463-485	IDISKRRSRPSKKQLDHVKKEV, IMKAEKIRKIERKMNNKTAFE, IDEVERQRKKKDEENLKNQFKNV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2K1	C6 transcription factor (OTam)	1	148-187	AGETPRGRRRKSPPQPRTKVRPCDHCRRRKTKCIMIPEIH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3F0	Cell differentiation protein rcd1	1	27-48	RDSGRSSHSYHRRRHVRAHVEV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3G2	Uncharacterized protein	2	1-23, 37-101	MQPQEMKKKKKKQFDDLGSDSQF, ANEKRVKGQAIKRKTRKRRDPEDDDPIRFENRSKNDQRHKKHKHGHKHSSKRKEHRESKKEEAKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3Y2	Putative pheromone-regulated membrane protein prm10	2	346-366, 415-442	AGNKKRMMKKLPSRKKNDVTF, ASTHHNKVKFQRNKKQYHNKKRFGREET
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR40	Yil151c-like protein	1	369-393	LPEALKERKERKDKHKKTSKSGDAQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRS6	Putative zinc ring finger protein	1	483-505	YLKMYFPKEVKKKQAENEKEIFK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS72	Exosome complex protein	1	164-201	SKDESYRLRQKSKKSGSRKASRRHRSKERSRHVKDAGH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSY6	Plasma membrane snare protein	1	15-34	QQQARGKKELAPRIRRNGAD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTH3	Pab-dependent poly-specific ribonuclease subunit	1	409-428	GSRNIVTKYEKQKKLNIPKF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTJ0	Uncharacterized protein	1	206-230	LDFTKRPVKRCYRLKSRSTGKKDDF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTX9	Chaperone protein	2	449-476, 504-526	DTGKQTRSPSPSKRRKNMYNILNRNKPR, REFPGRSTSPKRRHLNEVKTPKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUJ8	60s ribosomal protein l13	1	4-30	GKNYVLQKNHFKKHWQRRVRVHLDQAG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV85	Bzip transcription factor	1	11-38	LERNRLAASKCRQRKKKMVEKMKEDLQF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX02	Rna binding protein	1	507-541	IAYGKDRCAGPPKKKKKKKKKRRGNNGDNDNKQQG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXT8	Maintenance of killer 11 protein	1	390-424	KKELDELVKKRKRKARKQRKREKEKAYESPDRKIK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY49	Dna replication initiation factor	1	33-58	PDEQHEHQINKKKRRTQMREGERTIE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYG0	Nuclear protein localization protein 4	1	75-99	ELDKDKGLIKRKKTQLCRHNDRGMC
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYL7	Uncharacterized protein	1	1-28	MKRRLSKVKNKSIKKSRVQEKKTSPDVG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYP9	Eukaryotic translation initiation factor 3 subunit B	2	409-428, 628-649	KYLCCCVTRHTKSKKTKFSS, SLLTNSDKKKVRKSLKEYSAQF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYZ3	Protein transport protein sec22	1	179-201	SQNLKLQSKKYRKYAQRINFKLL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZB3	Uncharacterized protein	2	77-99, 199-222	LEEKRKQEKERRRKIAERFREQK, DVPVSRISSRRNKWLRRKSIRRRL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZH9	C2hc5 finger protein	2	247-275, 280-307	EASRSNSQVNHRKGRKKKVVKISINDAGK, VQELAFKRVERKRQIEKKREELEQQKKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2I6	Gtpase-activating protein for sec4p and several other rab regulates exocytosis via its acti	1	33-62	EYNGWWKKYSKYLIRRKRKWEKMMARNGLA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2J6	Van1p	1	359-380	EDLQKISQMERKKRRFGKYNDN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2P9	Enhancer of translation termination 1	1	3-28	KRQLGIGRNLRKRQKTEEASKAEKKQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2R6	Uncharacterized protein	1	242-263	QSTDYKKLKFAREKLHEKREAL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2R9	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase	1	208-235	TLYSYMLKQRKKQMKKLAEGDKHKKEVE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S4	Calcium-transporting ATPase	1	918-939	ADEIVKHYRKTRNVFPNNARWV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Z5	Mitochondrial ribosomal protein of the small subunit	2	35-59, 266-291	LSKSQKKLLSIEKKKHNKASQAAKE, KITKQANEERRKQRRAAKALRRAVSE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K475	Protein that recognizes and binds damaged dna in an atp-dependent manner (With rad16p)	1	98-121	EIAMIREKARRKRRRESGDNDDDF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQW4	Histidine--tRNA ligase	2	25-55, 459-479	NAEKKQVKSDHARKGKKKPHHFNLKVPKGTK, ETEYMYKKKVNPRKQFDAAEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS75	Rsr1p	1	223-251	RSSICGSPCQLNKKRKRKRNGIVNVLYYR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS83	Choline phosphate cytidylyltransferase	1	327-353	VLNNRKLYEERQKRKGWKGEKEREMEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSI1	Protein that contains a phox homology domain and binds phosphoinositides	1	518-542	IDNDYLKRVRNKKLTKNWNKINEHV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSS5	Ribosome biogenesis protein	1	248-295	KELSKMDKHSVRKKQKLERKQEQRENIEKKKKKHRKVRFAQDENKETE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSV1	60s ribosomal protein l24	1	107-132	AAIKADKDKKKADKERKAKARRIAAG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT81	Uncharacterized protein	1	596-619	NISNTGSPKKRKPATEQHKSSGRH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTX1	Protein involved in cell wall biogenesis and architecture	1	194-213	DTRFERFVKHEKSKRNQDIF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUP6	Shwachman-bodian-diamond syndrome protein	1	10-34	NIISTKCVNPKTKKRYPPTMIEKAL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVB3	Uncharacterized protein	1	1-23	MLNKRIRYRSKEYLRERRKEIIK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVM4	Ubiquitin-conjugating enzyme e2-18 kDa	1	7-27	CAERIQQERKQWRKDHPFGFY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXI1	Putative fungal zinc cluster transcription factor	1	317-374	AKRSRNGCLTCRSRKRKCDENKPVCNECRRLRIKCIWMKTQRQNKTKKHPYLLRVDET
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXM7	Uncharacterized protein	4	47-99, 102-156, 165-186, 191-214	LEDEEKRKKEKEEKERKRKEKQKEKKRLQQQREQEKKRREAEKLEKEKKEREE, RKAEEGRKRKEAERKKKREEEMVRKKKEKEKKEERKKEEKKKRVEEAKKKKLEEQ, EEEQRKLEKKKQQELERKRDEE, AENERVRREREREKKKDDKQTAID
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYM0	Alpha--mannosyltransferase	3	12-36, 113-138, 368-387	AERCRLFRFRPWKTSFQRYRKQLLL, QTWKCGAKDKRFPKKFQEPHRSWKEG, QYWVKHKKYDIKKRETDVDT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZV6	Protein required for mismatch repair in mitosis and forms a complex with msh2p to repair bo	3	60-85, 115-136, 196-217	KNTPNTPKSAKKQAKHEEKQNLAKDV, DEVVGGRRKRRKHQIVAAEDDS, DEAPRSRKKIAHKQSKRSEEIH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZY1	Abc transporter	1	86-105	SGFPKRLPFKKGFHKEPPAD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K024	Transcription initiation factor IIF subunit alpha	3	52-71, 73-103, 119-143	FENPTRLHRKDPKNLQFQLS, KELEEKRKEDEKKNAQKIQRRQEYIRKKGIK, ENGGARKRKQVIKRKTRQIRAYDED
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0J4	Phosphoinositide-specific phospholipase c	1	79-102	EDYIPDKGRRGKQRKPRIAPSVQT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0T2	Putative peroxisomal membrane protein pex30	2	405-426, 560-582	TEDSFSKYTRRRRWVRTAELIP, DISTSSTKAKRRKSLRLDTEPSA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1L0	Uncharacterized protein	2	10-45, 179-210	VILYLIAKRKKKARKSKKSKELKDDEKKRHNAKEDT, THSLKPQKSDHTKRKGDPKDNIKKDAKKQKLI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1W1	40S ribosomal protein S26	2	1-26, 81-112	MPKKRASNGRNKKGRGHVKPVRCVNC, ARIVRVRSREGRKVRRPPVRRRYNAEKRVNPA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1Y2	Pre-mRNA-splicing factor ISY1	1	133-157	EKTENTQNFRRKKRDESRKQLNLLQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2F9	Subunit of the tho complex	1	473-497	AEELRIRREKSRKLDQERRKREVEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2W6	Serine threonine-protein kinase cbk1	1	6-28	DYDLRQQQQQRQQQTPNYRQPAS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K351	Ubiquitin c-terminal hydrolase family protein	1	1005-1027	LVNFSRHHHHHHHHHHHNKGLKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3M9	Atp-dependent rna	2	1-60, 68-91	MGKKNHAKKSELPKKGKKGKKNDKSDEKESKKSEREIKQEARQKAREKRQKGRTMVAQSS, ALLQEHCQKKRWNKVNYDMRRVKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K402	Uncharacterized protein	1	33-52	RECSTKTTKKVPPRLTGIRH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K431	Ylr326w-like protein	2	45-66, 366-385	KLPSATKQEQKQWKKIQKAWLD, SSNGRQTSPKMSRRPPPGYF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQL1	Bdf1p	2	453-486, 546-572	EQLKKEWMKKHHSAKRLKRRRRRRAGGSSKSSIY, YDFIVRGKGTKQRRRKSAQSEEDKIRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQL9	Hemolysin-like protein	2	473-493, 697-726	NADRKKEKKIGLRINRNWRPL, DSTTKENHSSGKRRKSSWKFAGKNHKSGNE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQM0	Ydl025c-like protein	1	268-295	EVEKTLEEKKKLKKEKKLEVPKNDDCAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRD3	Calcium calmodulin-dependent protein kinase ii	1	377-397	KAEEGARKSRRQQKEHLTLAF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS69	Multiple rna-binding domain-containing protein 1	2	80-105, 111-133	RDPTLPLSWRERRKQQRLQERKLEED, ELQKSVRLRKKEQQRNKTVDEKI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSH3	Putative mitochondrial protein fmp30	1	201-222	DDGMPSKRGNRSKKKHTYEVVC
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTG8	Uncharacterized protein	1	11-36	LDIGAPKTRRTQRSKRGKHSVESKLE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU60	Chromatin remodelling complex atpase chain isw1	2	782-805, 996-1021	TLTRSEKRKLMKKLQKVEQKKIDT, VEGPEAFKRKLNRRPKSHSSVSSSRQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU82	T-complex protein 1 subunit gamma	1	493-514	WEPEVIKQQKCKKLRLRVPVCF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUN4	Pre-mRNA-processing protein 45	1	134-153	ASREIARRERRKRAERELRM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVG4	Srp40p	3	12-34, 54-82, 222-254	IADYLKRKGFKKAEKEVKKCISD, KQEEISKNKKEDKKEKKKEDKKDDDTSSS, SEEENKKRKRDEKSDSKETKPAKKQKGIPAAKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVI8	Protein involved in positive regulation of both-beta-glucan synthesis and the pkc1p-mapk pathway	3	23-42, 64-92, 561-584	GRVKNEIKTHQEKKKNDSSL, CSNYGEKDYKEYRKRFKLKTDDKTGNTRG, MNLNFTKKGPCRKREQRRWTVFLL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX63	Conserved oligomeric Golgi complex subunit 6	1	45-64	GKSGGVRKNLREKVRQRDLL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXA3	Uncharacterized protein	1	1-44	MAKTSKATKKFNKKHLKKTLEKRNKAKEYKRRIGNKKALREEKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXR8	Dna-binding protein involved in either activation or repression of transcription	1	31-55	KKPAPMRNLSSRQSRKRERDSLSVK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYW6	C6 transcription	1	421-442	YFVKMFGHKKLKKCAHLTKNLF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZE3	Mitochondrial inner membrane protein	1	437-464	ASRNEKAEEKEKEEKKKKKKKEPVDVKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZT4	Transcriptional coactivator p15	2	1-25, 124-149	MAKFHRFHKEPKSYKKQQDDGQPKI, DVVDERPKKRSRDERSKKSRKRSKSD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K205	Casein kinase i isoform gamma-1	1	392-415	YGHPNPPHHHQRRARTSQQYYQRH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K299	DDB1- and CUL4-associated factor 13	1	394-418	YANMPEIRRIRRHRHLPAVIKRARD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2J9	MFS domain-containing protein	1	272-292	ETYFLTRYKRKHNRNECVPHN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2L8	Cytosolic j-domain-containing protein	2	16-37, 161-185	ASKLQIKKSYRKLAIRYHPDKN, SEEERQKKFKKEEEKKKQEREKMEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S3	Rna helicase	2	20-43, 160-186	GDIKDDKKSRTKYDKMFERKNQSV, EDKNVAKERRAEKKRRRKEIERMAKEA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3E7	Actin-related protein 8	2	21-43, 90-116	AAVLEKRREGRKRAMARLQSKLE, KERVFEFRLAKKRKHNEKTKNQDIITK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3K0	Uncharacterized protein	2	16-38, 193-225	NAEFSRRKQKRLLREQAQQRELL, DSTFSSKKALIKHKKKYKSKSQKDQPVDFKKFM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3M1	Uncharacterized protein	2	18-41, 123-148	RPSSSVCRKNGKQQQQQEQQQQQQ, RGQGRGQKVRVQRRTRKKREDATGAE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K443	Protein involved in the transcription of 35s rrna genes by rna polymerase i	1	147-170	FNLVRGCNPRRKHHKTSAKFSQSI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQV5	Uncharacterized protein	1	1-31	MSCHRMLMKKKKKYERMKQAKAKAKSSRKTS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRA3	Gata transcription factor	2	176-196, 286-306	SDYPSEFKKRKTIRNNRAAAI, VSTLGKPRKKRHQVVQKCVNC
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSC7	Amp deaminase	1	557-579	DESKSDRRFHRKFPFPHKWNSKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSG4	Polyadenylate-binding protein	1	408-428	GDSNSKRTKTRRKSSANYFMS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSV3	Uncharacterized protein	1	15-42	VHSDNHKNKRLKLRLPPKFMKKPRILSL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT89	Activator of forkhead-like transcription factor	2	24-50, 83-110	EENQKARSDKFIKHRYHRDRRFSIISD, VEGSRTYTKTHNRKKTNRARVVRNMYKM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTA0	Nuclear migration	2	34-53, 222-247	MTIGRLRKYIQKQKVFHAKL, ERLLKQQKRKAEKTVKIPPLKKKAVQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUI9	Nuclear polyadenylated rna-binding protein	3	2-22, 154-177, 315-338	ASSRHSNSNKRNRQEAQQQQQ, FVPRKPIGRCKKFPHCHDRNCRYA, RSLEQCKFGRHCKNPRCLKRHATT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVD4	General amino acid permease	1	69-92	KSNVRSAKAPLRRKLKNRHLQMIA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVL1	Sulfite reductase beta subunit	1	152-176	SQGAWLEGSRRRRRRPARCACAAQE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW34	Essential nucleolar protein that is a component of the ssu (Small subunit) processome	2	49-75, 86-116	GDENSEKRPERKRKRGPKGPNPLSMKK, KKDNSKSEGAKKTRKRRHRRRGKSDQVEEGE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXC4	Component of the 4 histone acetyltransferase complex	2	68-92, 595-619	RIEELKKRDRWSLRQPRKHAPFLHN, RQIQHARRAQRQQQQQQQLRRQQWQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXM0	Duf221 family protein	1	244-264	LCKAVKLRNKAEKKHKPIPEP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXW5	Bud site selection protein	2	141-171, 199-218	DNEVQKVTSKHRKNRRGQRARRKIWEKKFGK, EKRAEKQKKHEEWMEKQKEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYE7	Serine threonine-protein kinase nrc-2	1	1-77	MERGEEKKGKEREEKKEKEKKEEKKEKEKKEEKKVDKKEKKKVREKKEEERKDKKDKKKQKKEKRDTEKDSDNSKKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYR5	Vacuolar exports large neutral amino acids from the vacuole	1	486-511	AVRIMEKKIFKKRSGKSNPVVKWEKN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZP2	Mms21p	1	263-289	VMLQRLTCYKRDKKIFKERNIKEKEID
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K041	Single-stranded dna cleaves single-stranded dna during nucleotide excision repair	1	7-34	QHIFHNLEDRNRRRRKGKVNFLENKDDY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0V7	60s ribosomal protein l7	1	33-55	AGERAAKRLARKNSKNQKFIRAE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S1	Mitogen-activated protein kinase kinase kinase	3	55-77, 1362-1392, 1697-1716	HTTEKHSTKARARRTSGNKHVEK, PDVKNNVMKEHRKRKPLRSKHTTSKVHRTVD, SAPPISKETKKRISPCGMKF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K364	Uncharacterized protein	1	205-229	SNIIKIGQNGKKKKSKNRAFMSLLD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3B9	Putative nuclear rna processing factor	3	11-32, 57-82, 1025-1047	AAEEQRKREKAEKNNAIRRAGR, LEQARLRLNEKRKRFKQAKEPAAARP, GGMFKLSKPKVKFPPHMQHKKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQC8	Ion transporter	2	53-73, 527-553	DDPNDPLRWSQKKKNLQFSIL, IFIFWGKKFRRATKKWYLKYSDSRTLF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRF0	Uncharacterized protein	1	14-34	TSYSKDSKKNIKKLIEKTKEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRL8	Uncharacterized protein	1	77-96	RSSSLSTPKRGKRRNSDSDE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSA4	COX assembly mitochondrial protein	1	60-92	DQTTQARRRRKIIRKKAERKKFEEKKKKMFEEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSA7	DEHA2G18788p-like protein	1	71-91	LSKSRKKTASGKVKKIKKADR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSG7	Mitochondrial protein phosphatase	1	437-456	NGWGKWPKIDRTKELREDRL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSI2	Px domain protein	1	291-315	ICGVKLVKAKKLRPRKRGFSHYGFI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTK0	Chromatin remodelling complex atpase chain isw1	1	642-663	ADKKRDSSSTPDPKPRSKRRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTV8	Putative transmembrane protein	1	355-384	AEINKIEHHHHGKHRKKRKHTSVKEHVLGL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUQ8	Component of the evolutionarily conserved kinetochore-associated ndc80 complex	1	433-452	YKSEIVKKIKSQKQLMKSFH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUR6	Casein kinase ii subunit alpha	1	61-86	KIIIKALKPIKKKKIKKEIKILQDLA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV25	Ribosome production factor 2 homolog	1	142-163	KEAFKIPPQLRRKTKKNVETDM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVF9	Hec ndc80p family protein	1	17-42	APNATPRPSSARRRKRLSLLPNNVTI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWH3	Acyl ligase-like protein	1	270-291	MYSQMEYRKKEKRDRLEMLDMD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWZ1	Zn(2)-C6 fungal-type domain-containing protein	1	19-45	YDEKNSTKARIKHSRRRYRFQRASIAC
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXJ4	Cysteine protease (Otu family)	2	23-51, 103-150	ARTTGMRKQASKKTRKRVRKQIEELEELK, KEEAAKKRKQDQQKVPHKHRNRQRERLERRKRDEKSRRNKLERRQSMP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXP3	Small nuclear ribonucleoprotein	1	88-134	KSDDKDKKDEKEKEKKDKSEKSEKSDDKQKKNKKEKNSKKDNKDNNR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ43	Homoaconitase, mitochondrial	2	4-23, 526-545	ITTFKISRRRISQNTETSKT, LAKLREQYKNEKKLPTRRTG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ93	GPI ethanolamine phosphate transferase 3	1	28-49	QGSETCFRPKKPFKKAIILLID
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K008	Tho1p	1	184-213	YLQKKNGEQNHGHRRHRRRFRPYARERTRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1J0	Protein phosphorylates the alpha-subunit of translation initiation factor eif2	1	501-526	RIDPKVPSRFLKPQRKNRRLGYWSCI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2A1	Ribosome biogenesis protein NOP53	2	1-66, 145-174	MGKSKRRKKKKKKKMRKWKKKTRKKMRHQRIDSFQLIPATGDKIKTKTKRNREKREKERQRLLSEM, SSGKIEAKRHIAKRKPKKKITQKWSYKDFK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2D2	Gtpase activating protein for involved in signaling to the actin null mut	2	107-126, 218-240	TPEERQRKMLKKKLTRERNE, AAAASAKKHSKKRVNDSGNSPED
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K324	Yjr054w-like protein	1	102-127	MKMYEKEERKKRKSMMHKRKIPSVIK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3Z4	Uncharacterized protein	2	1-34, 104-129	MIRNSVPQKEKSKNVKSRNDRKHNEQKEGKRDGH, GAFFRASKQTHQKKPEKKMSQEQINE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRI1	Diadenosine tetraphosphate synthetase	1	164-194	ARGKEPAAKTDKKKKNRKKKVKEIKAVKLDD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSA9	Ymr066w-like protein	1	66-92	EFRGCRSRFTKAKTKSKPELVTKPPAQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTG7	mRNA cap guanine-N7 methyltransferase	1	82-106	KSTYNYYLKSFKRKRNPEEDNIEKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUP1	Eukaryotic translation initiation factor 2A	2	455-482, 504-526	IPGAVPLEKKSKKKRHHKKSVNNEASTG, FSLEEKKTRNLLKKLRSIQKIEG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUT2	Bar domain protein	1	313-337	TKIQLNYHKKCNRRAFRIGRGARSV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUU1	Uncharacterized protein	2	56-77, 244-270	EYEALKRKRESNKQTKNGKAEG, ERWNNLVKTARRKKDQQVNLEKQRRES
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVJ9	Uncharacterized protein	1	256-287	WDNRGQLNRLFRRRRREAVKRSRRKKMSRAIL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVV7	Member of the puf protein family	1	393-416	YPSARSRISQQQQQQQQQQQQQNF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW07	Chromatin-remodeling ATPase INO80	1	4-23	MLNFWKKNEREEKMQRVKAE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWQ3	Nuclear fusion protein bik1	2	55-74, 318-337	KSKEERYSKFKKNAESQIKE, KDDKLKKKDDNLKENKNRVS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX79	Uncharacterized protein	1	277-297	LSEKERDRRRSLQYLRRSRID
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXC6	Arrestin_N domain-containing protein	1	261-282	EAKLLTPKKHTHHLKNCFWIDP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXL1	Nucleus protein	1	1-29	MRKAAYSCDRCKFKKRKCVRQIEVGQNAF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXZ2	Enhancer of mRNA-decapping protein 3	1	58-111	IKDLKVVDLPKKRKKGKKKDTEKKEKYNQQKKNSKENGKKVKSKSHKSQTPEDD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYF7	Uncharacterized protein	1	28-50	LNFLKRYKALKIRKHGDKTKPGE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYK2	mRNA-capping enzyme subunit beta	1	24-47	ITFQNCYFKNRKKHQSFANPTKLT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYU5	Membrane bound o-acyl	1	210-233	DDVPAEKRPGKRKRKIPHSGKVAL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ46	Uncharacterized protein	1	254-280	HGKFNNRKFHEKHRGDRKKQFRCYFCG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ49	Brf1p	1	293-312	PPSFIKDRTIEKKRKKAIES
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ54	Uncharacterized protein	1	139-159	IDEKQYRRIKHRRGSVHLHTN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K029	E3 ubiquitin-protein ligase	1	88-118	VNYTEERKRKKLLAKKKRDRILAKIKHQQKF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K065	Rna-binding rna annealing mrna export	3	13-44, 187-213, 234-258	ASDRAKKASHTVSRKRRAPSGRVGKSNRTRSN, SAVRARLQFKRNRRNQQVVRSNNRGRR, NGNNNKGRKGGRSRRQKKTVAELDQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0L0	ATP-dependent DNA helicase PIF1	2	780-803, 1024-1053	ARTISVDTKKSKRRKLNTHSAFSN, QPQTRKRSSVINRWSKRRATKARPNLFVVD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Y9	Uncharacterized protein	1	46-68	LTSSQRYRSKLHKQKKLDDIEKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2J4	Alpha-actinin	1	141-165	RAGGRRQKAKWQKRRQIQRKWMGLA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3A2	2-oxoglutarate dehydrogenase e1 mitochondrial	1	816-835	LFHLMRRQMHRQFRKPLIIF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3C4	Putative patatin-like phospholipase	1	49-78	FSEAEDKGKCKKKSFKNKLKTNRNIPKEDM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K470	G-box binding factor	3	207-232, 279-305, 319-341	RNCMHCRKLQRGRSKRWQLKIRNKVG, DLSGKYKVCSKCRKREKLIREIRRQTG, QGFKSCKRCRATRHGRKIVRSMS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQM6	Mitogen-activated kinase kinase involved in protein kinase c signaling pathway	2	14-36, 407-446	VPELCPPLPKNFKNKRIRGGMPL, FIKVCLTKEGRKRPSPRQMLEHPWIRGQMRKKVKMEKLVE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR25	Uncharacterized protein	1	174-247	EVAADGKVKKRKRGRPRKHPITQKEIELKKLRSSGIKRKRGRPRLPPLETRQKSKYTRHKKKNKTGGSTENGKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRL3	V-type proton ATPase subunit G	1	17-36	QIVAQARKCKQQKKDAKAEI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRR0	Amp-activated serine threonine protein kinase found in a complex containing snf4p and members of the	1	301-325	YSASSNGTDRKKRHRSFFKRLFGKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRT9	Rho1 gtpase	1	180-201	TATRAALQTKEKKEKKRKCLLL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRX9	Protein mitochondrial	1	449-470	REELKQCKKRFHDIKKTVGGNK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSJ4	Tom20p	1	33-60	RHNPEFRKSINHKKRKAQKKAKMQAEEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUP7	Nitrosoguanidine resistance	1	451-471	FFAYMSKKKIKKQAAAKLAME
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUX7	Intermediate filament protein	1	58-77	TSTYYGRKRHDIKNFRPFAF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV69	Uncharacterized protein	1	18-43	PLIVKQLRLSPKKKNRRNIAFQPVQI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVG8	Rrp17p	2	37-64, 250-293	EFLTGFHKRKLQRRKHAEEQKKEQNRLS, GEMDEEESKRKRRKKKQRKYLSKRERKIKKVKEKKRSMHRKNRL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVP5	Myb-related transcription factor	2	35-58, 238-260	SLGYHIFRKKQRRSWTPSEDKLLK, RLYTFEASKKSKKSKSKRLQSTV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWL5	Protein phosphatase 2a b-type regulatory subunit	1	88-111	DEQMKEEKTRKKLRNDHWKKLESY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWZ8	Zinc cluster transcriptional activator	1	4-49	NSQTTKTTSKPKTIRPPGSNTSRVSVACDRCRKKKIRCFYDDDDKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXB0	Vacuolar h+-atpase assembly protein	1	121-140	QDGTHRMNKVRRSERKIKGE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXS2	DNA helicase	2	632-659, 709-740	SQLLKGKPLKMAKRRKHEEQLNKSSRRA, ARDNGSQKENPYKKRKKTKKHLGMGRGPMKPF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZQ1	Hexose metabolism-related protein	2	149-172, 371-400	SEIGAFRRRRNLRRSGRNNNQRFG, NMLRAARETKTSKKKRRRKKINYDNVSVAN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0C2	Ribosomal protein L15	2	59-85, 168-188	FVVYRVRIRRGNRKRPVRKGVNYGKPT, GKKYRGIKKGHLYNKTRKGQY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0R8	Obg-like ATPase 1	1	236-255	ERDYIRKRNKWLPKIKQWVD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1N1	Uncharacterized protein	1	59-79	IKANFKKKVLALKNQNKKVKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2H8	Nop58p	2	431-455, 461-514	DSEDAKPVKAEKKRKRDEDEEETEV, EEGKEGKKEKEEKEKKEKKEKKEEKEKKHHHHHHKKDGEKKHKEHHHKHKKDKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3A9	Uncharacterized protein	2	277-299, 354-380	IDSRTIRAKKHQKSKRMELHPVE, SEIESTAIPRRKRRRRSLSDDKRSTSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K469	Uncharacterized protein	1	109-156	GTEPKVAPRKKIRRRKKGHAFKRNKKKKYKSQRERKYKMRDVEKNSGG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRA0	Ynl254c-like protein	2	6-29, 51-76	SKSLNVQGRKREHRPGVKKLRSLS, VSSFGKEELNKRRKRKAKVFIASLND
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSX3	Cap-associated protein CAF20	1	7-34	EEFGFYYPRTNKPRRKRQPKEVVDNDGW
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUD2	Transcriptional activator HAP2	1	162-184	ESLKIQKRRKPYLHESRHKHAMR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUH0	Ubiquitin-specific protease	2	109-131, 565-590	TEFRKNSLLKRRLHKNPDYPDGK, DAYEIVSSKQKKRKHKQTKEQELMLS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVP3	Uncharacterized protein	1	10-37	MQGRNNGRSRNFRPTKRRYRDQEYEDDD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW08	Hlj1p	1	177-199	LPKAWEQNSKRKKSKEERPGWDT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX04	60s ribosomal protein l25	1	18-37	SSKKALKVRHTTFRRPNTLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXS9	DNA helicase	1	634-661	KEIDHAKKVNKSPRKKRRMVNIEEPAKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYB5	Yhr149c-like protein	1	4-25	ALVRRTDKDCSKKDNKDSQLCA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYJ3	U3 small nucleolar rna-associated	1	255-280	GDASSQNKSKRRRRNQAVKSKRSDAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZG9	Uncharacterized protein	1	114-135	NDLMKKRKHNFMESKDRRNFKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZT5	Magnesium transporter	1	83-106	NSSDTTRDRKRYHRVPSYKKISSP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0A2	Uncharacterized protein	1	86-107	FLMRSSSTSRRRERRGRHSGSI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0B8	Large subunit of the nuclear mrna cap-binding protein complex	1	34-55	NDYETNKRRRVRHHSNLPPEIE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0M8	Transcription factor	1	13-34	QQKAVFSHKQQQQQQQQQQRIL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1M1	Uncharacterized protein	1	156-179	CYVIVRPQSRTIKKKKCGKIEVYT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K282	Transcription factor iws1	2	115-140, 372-395	EEKFAAAMKKPTKRRKKNEVDLEAMQ, NQKLTHLSQKKSSKKKGGVSIEGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3X6	Regulatory subunit of cdc7p-dbf4p kinase complex	1	56-76	VSTLKNIKKPQQQPDPQQAVS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRC2	Rsn1-like protein	2	29-53, 55-80	FVNFLKKAMKKLKKAEKKGHIIEPA, ELEQYVPRKKWPRLRPSKFSRKVDMI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRJ0	Serine threonine protein kinase	1	429-449	NNGGNFKKPKSPYRKANYTAV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRT6	Uncharacterized protein	1	207-235	EGKPKTVKEPKAEKDKKPKSPEKSGEESF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSI9	Hrt1p	1	15-41	TEQSQQQQDNKPKKKRFEVKKWTAVAF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSM3	Protein yth1	1	195-217	FCPEGPKCPRRHVRKVMCPRYLA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSN0	DNA replication ATP-dependent helicase/nuclease	1	332-354	VLESSYSTQRRKKRPVARWGRRV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT68	Uncharacterized protein	1	35-62	IWKMKFDARKSARKQKKKEQQLQQQEDL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTT2	18S rRNA aminocarboxypropyltransferase	1	3-22	DFGHCDPKKCSGKKMERLGL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTY5	Basic leucine zipper transcription factor of the atf creb activates transcription of	2	75-100, 154-173	RNRIAASRCRQKKKNLQKRLQQDVKS, SSDEKKSKSSKNGKNSGNKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUA0	Protein required for mother cell-specific ho expression	1	1-20	MDPRTGKKLKVSRKDTKEEV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUC4	GDP-mannose transporter	1	329-349	LYAVAKQKQKEEQHRKEQLPK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUI2	Uncharacterized protein	1	38-57	SQPQIQQKRIRDPRNPNAML
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV12	Secreted protein	2	75-103, 293-326	NSSDSKAASKKQKKRESVKHHKIRKQASL, EAEERESQRREKLRRKYERDLKLAKKGKKRIVIE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVM6	Vacuolar protein sorting-associated protein 35	1	222-243	IDNEKIKKSKNKEKTLPTKDSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWU4	Uncharacterized protein	1	106-126	TRPEVFKTRRGGERRRRYQSN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXA8	ATPase GET3	1	271-294	DDDQCKRCKSRWKMQKKYLDQMDE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXF6	Phosphatidylinositol 4-kinase	1	1463-1488	ISGKLKPYIRKSKAEKKRKIDEEMMK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXR9	Dna-binding protein	1	71-92	NTAGKNKKGKHRATKDSPAPEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYV7	Heterokaryon incompatibility protein	1	470-492	MSTSTKCDNKKLRAKYKYIPISS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYX1	Transmembrane amino acid transporter	1	281-313	VPGGFRRSFTSERRRQRRPREHRKKPDFLTRFF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZB1	Regulator of ty1 transposition protein 107	1	182-202	ESEEEERKHKKHEHKHKHKND
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZS1	Lysyl-trna synthetase	1	35-59	EYVSKSELKKRKKMRAVQAKKAAKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZW2	Positive regulator of mannosylphosphate transferase	1	170-195	YKPALKGRPTKTKAKQKKIKEFDAQP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K005	Pentatricopeptide repeat-containing protein mitochondrial	1	53-75	FYLKRSFHFGRRGKKRNASVLED
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0G4	Putative lipid particle triacylglycerol lipase	1	49-70	ILAIRHSPSRRLRKQLEECRSF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K154	Uncharacterized protein	1	53-74	QRPVVHKKQIYKQKNKKHDVAF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1I0	Uncharacterized protein	1	1-23	MPEKLSRKERKKRRVEEDSSSSE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K214	Dihydroxyacid dehydratase	1	560-586	VPDVLAQRRKTWKKPAPRYNRGTLYHY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K307	Chromo domain protein 1	4	33-57, 76-118, 1244-1273, 1402-1425	ESDEESEPQKRRRKHFDRDYAIDDD, DDDFVPDSGRKRRSRRSGKKKTRSGARNRKRSKSSRSRSTYAD, NGPLPDNKDPRRVRKERKPVKRQEASDSSG, PAQLIKKMYIKKSRQVREQRVERR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K410	Vacuolar protein sorting-associated protein vps13	1	457-482	ASMDRDFQKKRRQNRQKRPNHPLGGF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQK0	Maltase	1	128-149	KNNAKRDWFYWRKPKGFKKDGT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR45	Plasma membrane carnitine transporter	1	579-598	GELHPMKRKGWKGKIVNLFF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRR1	Pex29p	1	647-674	ESIGSMYRRRRWIRYCTRSVRKDDEHED
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT95	Sporulation-regulated protein	1	272-299	EIYYEKLRSNRRVRYKRRKTNTSNETMG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU36	Uncharacterized protein	1	311-331	LSFGSRRRRLLQKQHTAGSKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUB9	GPN-loop GTPase	1	304-334	DIYVKERERILKNRKKREQKRKEQNLARMMS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUV9	Putative u3 snornp protein utp20p	1	547-583	LELMNPKVAAKRRLKKHMRFRKKRRMNKDENGLYKAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV91	Putative small subunit rrna processing protein	1	107-131	MHDEKYMRKVQKRQKNNFYRFQIRE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVD9	Rna-dependent atpase rna helicase (Deih box)	1	1-21	MKIRRKPKNAKLPKYDLNNLI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVM8	Protein mak16	1	158-189	NKSSKRKADSDDSNKKRRRRRPRIEVEIEQEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW75	Mannan polymerase ii complex anp1 subunit	1	6-25	GPPISPLKHSRKRCQISIIR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWJ8	Uncharacterized protein	1	108-130	LSKRIEETIKRRNQRRYLRSSDW
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX46	Transcriptional regulator of the forkhead hnf3 family	1	15-46	EREKQEIRKQKLKEERKRRHRQRQEELSKSSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX95	Protein avl9	1	59-80	KDGSSDKPKPTKQRKHDKLIFG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYY7	Uncharacterized protein	2	6-34, 37-59	KPSLRGLRSRSGTRKRKEVSPGLRNARTN, NEDPNKKRQIGRRRIQDENKTTF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1Z8	Uncharacterized protein	2	633-657, 661-727	GTAGSSTRSKKPQRRSMFSEWGRRS, VHNHGGSSKKNDRKHKKHGTKHMSLMTRTTRKESKKEQKKESKKEQKQEQKKEPRKELEKDKLPQKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S2	Nucleolar dead box rna helicase	1	1-30	MAHPHSISRRDRRRFHKKHFEKLKELQEEA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2V5	Rab GDP dissociation inhibitor	1	50-71	QLYSKFKPSKPYKGQYGKDRDW
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2W8	Zinc transport protein zntB	1	30-58	MSTSADAKSKFKRRSRRYLGSQAKRERAA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2X8	3-methyladenine dna glycosylase	1	263-288	DSGVIPRTKKVSRNKKKDKYVSDVDL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3Q8	Smad anchor for receptor activation	1	436-456	LENTKSEGKRRKSSVAKGVPS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQZ5	Subunit of a rapamycin-sensitive complex involved in growth control	1	327-347	GQLVRQKKVEKPKPSFRHSTT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS25	Putative rho-like gtpase involved in secretory vesicle transport	1	80-103	TALHVTKQRKSRKRYGKTYRSTVG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTI5	Cation chloride cotransporter	2	114-135, 326-356	DVWWKTVKQFRKEERNMKKENT, EPSIIFVKEKKDRKKHEKKEKEPQKPLYKDS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVL7	Vacuole morphology and inheritance protein 14	1	515-535	AEKSSKDKGKAGKHYNNSSSN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVV1	Uncharacterized protein	1	63-85	LEKLSRRKAKQKAREKVKRATRT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX47	Transcriptional regulator of the forkhead hnf3 family	1	165-193	NGSSSQMPKKEKRRSKKRIYKPEEIPEPY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY94	Uncharacterized protein	1	40-63	DPNPSKSKSKYKSNQIKNKTNPYH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYI4	Putative srpk1-like protein kinase	1	460-481	TQSSVVTKRKSRKSRRPSVVIG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZC4	F-box protein component of the scf ubiquitin-ligase complex	1	753-772	QRQFEERQLREQRERRARAQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZM2	Sterol biosynthesis regulatory	2	6-25, 101-123	QELANKRKPNPYQIPKVGSK, TSHHIEERKSKHHKKQNSSFTLS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0H2	Ribosome biogenesis protein bms1	2	177-202, 331-354	LFKKQATLRASKKRLKKRFWTEVYPG, GLEAPTRTRRHRKRLDDKNKIIYA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0W4	Uncharacterized protein	1	31-56	ANATKRYRAVQKLKNTQKQNNRSISF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K176	Protein interacting with poly-binding protein pab1p	1	257-280	DQSPTNRKKDSDKQKDNRRPSAHP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1M6	Yil166c-like protein	2	260-280, 491-514	RTGPGKTRNRFTKRRNPWFNE, AFFTKFYYIFRNKQKAKKWDSMSD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1W5	Condensin complex subunit 2	1	116-143	DDDVEKRREQQRKYRRNRARNTLVSNFD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K257	Putative trna-specific adenosine deaminase	1	298-323	KTYSNFKSIKELRKNRRSQEDIQKTG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2K5	Uncharacterized protein	1	75-106	NNKRDAKKNTLERKMSRFRRRPEDEARKGTRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3P7	Spliced mrna and cell cycle regulated protein	2	4-32, 413-432	ASTPVSSPKKKAHMRIKSTKKNNNALTLK, TDPSIKQKKRTEIWEKVTKV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3R9	Ubiquitin	1	93-128	KAICRKCYARLPPRAHNCRKRKCGHCNQLRPKKKLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3V3	Altered inheritance of mitochondria protein 21	1	90-118	ISEISLEKKPPKPKKRPMVPKKPSSKIAQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQX2	Putative response regulator protein	1	178-207	HSKRASLHFKSRSRKEKKLQREHSWPPVFQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRK5	Uncharacterized protein	2	1-50, 55-93	MTMVSKRRRERRKEKREEKERAEERRREKRRRRRKETRENKKREESREES, REERREERREEERRRKRRKKRRREKRRREKYKINQLQIL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS01	Histone H2B	1	9-36	ASKAPAKKTTIEPRKRSKPRKESWSSYI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS46	Transcriptional activator hap3	1	22-54	QQQVLKQERGEPRKKKKKYSKSSKNNDGMDKKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSM0	Gtp-binding protein	1	177-201	DIIVQPKEKWRHQYHKYSPTHKDHN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT16	60s ribosomal protein	1	87-107	KWKTSWAKKIARKERRAQLTD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTS0	Atp-dependent rna helicase dbp7 (Dead-box protein 7)	1	133-161	ESDDDKDKNDKKHRKRKARSNVPKREGDW
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTW4	Ubx domain protein	1	445-481	AYEKSLKRDRERRIARENKQKAELKKQWIRWRRSLKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV08	Uncharacterized protein	3	51-74, 77-106, 135-159	DAGAAKKVKKATKKKDLEKESAKA, AGGAGAKLPQRKRRKRKTKKEKKLEEEAAA, ATAAPVKRRKRGRPRKNAPKAPSAG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVY1	Ivy1p	1	3-24	AQTTVPSPKKHIKPPAHLSEFY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWC7	Microtubule-associated protein	1	163-189	GQEPLIRPEKEKRNKEKKENKGGFFRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX24	Helix-hairpin-helix involved in dna repair and replication fork stability	1	192-218	QREFKTPKEINRKISRNRNLWERSRRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX74	Uncharacterized protein	1	2-32	KREQDLRLRELKKKKVREKSRAKRAELERKI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZS3	Protein involved in plasmid respiration and cell proliferation	1	107-128	LERAESISKRFKKKNIPSTVEA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0K2	U3 small nucleolar ribonucleoprotein imp3	1	159-178	WVDSKIKRNVLKYKNKLDDF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1A7	Uncharacterized protein	1	193-212	FVRFTLQRKRSVRNVRFPGC
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K222	Origin recognition complex subunit 2	1	4-23	RPPSGHLGQRSPRRKRTINM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2A2	Ribosome biogenesis protein NOP53	1	3-31	ETEVKAKSRMQPSKKGKRAWRKNIDITDI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2M3	Glycerophosphocholine acyltransferase 1	1	88-125	VELNRHKTYKWMKNYGRKLNDRKKKFHISKEDRIKWMK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2W2	Yhr131c-like protein	1	344-372	LNRRPMPKYRTVPRRRRHRRNQESEHLHY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQK3	Uncharacterized protein	1	304-324	GLPTSKFSRNQVHQHHKRRTN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQM3	Cytoplasmic serine threonine protein kinase	1	530-549	EQQRLERRQQQKQVERQRLQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR52	Rho gtpase activating protein involved in control of the cytoskeleton organization	1	67-96	YEATTQKLSRREQRRQKKLEKQQMQQRQVD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRB9	Secreted protein	1	298-319	GSTTPNDQKRRERGRVRSNLLP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRU0	Gtp-binding rho subfamily	1	1-20	MGKKSKKKGIEKAHRSSAYP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSI3	Arf guanyl-nucleotide exchange factor	1	106-131	SIRSNSRTFKKRSKTVGPTDKQRVSR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSN2	Uncharacterized protein	2	1-31, 68-98	MQMRTKKRMGMKKKKKKKMKMKNENENENEN, GASPVEPKKSKKKTKTNKHAGEKQKRDKHSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW74	Cytoskeleton protein	2	130-150, 904-935	LILARREAKQRRKIEDSNRAN, SEELSGEKSKNKKSKKRRKKKHKAKKKDEAQD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWI5	Putative zinc ring finger protein	1	18-37	GEAVHRNKRRQSQSNAEHLN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX16	Uncharacterized protein	1	39-64	ERNIPESERRKIRKRKIILKHFLGKL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXP1	DNA-directed RNA polymerase III subunit RPC3	1	1-28	MSACPSREYSKPRQHKPREYYYYPKEEG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXS4	Wd repeat-containing	1	1-26	MSTLIPPPSKRQRREAQKPREVNIVP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYW5	C6 transcription	1	475-495	ETKMGKREYSRFRKRFQPKGA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZK0	Structural protein of scf involved in ubiquination	2	35-61, 417-436	EQTNKSPVEHHRKHSRHKKGDYVDAKL, CIVRIMKARKQCKHERLTNE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZR6	Mitochondrial import inner membrane translocase subunit TIM50	1	115-139	EFSRAKRRNNTKSTLDKKKERYENL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Y7	Telobox-containing general regulatory factor	2	1-25, 746-772	MKKKPLMYQKRKKKSEQTENSQITS, RINAVANKRRKIRQRQNRPTTFRRTWT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1P2	Putative fungal zinc cluster transcription factor	1	432-451	LGKGRIRKPRIKYSNIKCFD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1X0	Condensin complex subunit 2	2	139-160, 422-447	TIENIRKRAARNKKPKLTLQDS, KEERTLFRKGKKKVLRQKLDNKVCIT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K269	Heat shock protein hsp20	1	35-56	QTSNKRGNRKSLKPDDKKAVAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2D4	Duf1682 domain protein	2	221-244, 271-299	CRKAVFRPELSKKCKKTREIEYSK, LSPNQQEKLLKKQEKRKQRRAMNKQKVRM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2E4	Mediator of replication checkpoint protein 1	1	326-349	HSLASSFRKGKKKKARYSTTTGHE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Q6	Uncharacterized protein	1	800-820	EEDVNFEKNRKQQPKEKARYE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2T5	Glutaminyl-tRNA synthetase	1	190-220	LGPKDERDTQKPKKSGKKKQANAKKDKHAES
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2X1	Yfl042c-like protein	1	750-779	VSNKEKKVDARIVKRKKHSVQRRHSVAPTT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2X4	Ribosome biogenesis regulatory protein	1	163-194	EDIDPRKLNRMERKKLVKKNMLQQKRNRLNGD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3T4	SWR1-complex protein 5	1	205-243	SKNSADKPKSAPKRKLNSQRQHPNLRRKRRRPGLLEAVI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR17	Uncharacterized protein	1	105-130	AGNMVWRNKKDKKQQRCDEYNYKRGH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRT1	Doa1p	1	33-54	RDSTVKIWRNDPKQRTPNFDDC
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSH8	Histone H1	1	77-156	KAPVKKEAKKEVKKETKKTKPAHKKIVKKAVAKKPTHKKTSKRAPKKAVGTKKASTKKAKTTKKVSKKSSKKTKKAPRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSZ2	Uncharacterized protein	1	4-23	QMQKYKKKIAADVKKQRHTM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT80	Uncharacterized protein	1	91-115	SEQQQPWTRARKKPEEKQKIDFLKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTJ4	Putative amino acyl-trna synthetase complex component	2	102-126, 147-174	VELPREVKEKKKKGKKGAEKEAGKG, QRAAKQAKKAKKAKAKKQQQQQQQQKEP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUX9	Protein kinase and ribonuclease	1	508-535	GVQPNQKIKRRKRGARGGKKNKKNANAS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUY3	Uncharacterized protein	2	13-32, 340-374	NVPQKIKKIQPIPRTARPIL, QMWKLHIKTRQNNNVHFNRNRWKDQRYRTSFKGHI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV64	Uncharacterized protein	1	93-123	SVERSEKNCEKKKDCEKRKDNTPKHEMHFEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVZ6	DNA-directed DNA polymerase	1	209-231	LLSARKKAKKAMKAEKDPFKKQV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXN7	Myosin light chain 5-like protein	1	1-20	MSKKSKNSQAKNKLKESTKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYN9	Histone deacetylase	1	660-687	CWGNADKHTNAKKPRKKYGRVIRADCEG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0R6	Putative snt2p-like dna binding protein	1	1-29	MSKKAKKGKAKPQTRKRGRRDRSSVVMND
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K260	Altered inheritance of mitochondria protein 23, mitochondrial	1	242-284	KKQISKQEKKELKLKKKHERQEKLRQRTEKKRKEEMNLKKLQA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K279	Protein-synthesizing GTPase	1	16-54	LYGEKAKQQQIKDKPKRHKQIYTGKRKHQDAKRNPGCCS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2X6	Polyamine n-acetyl transferase	1	15-34	HQSNEQKPLKQRPQHLCIRP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K381	Nuclear envelope protein cut8	1	77-101	SRDKISKGYGRVKKRRNPEVGQRLS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K418	40S ribosomal protein S8	1	8-37	RHKRSATGAKRAQYRKKRKFELGRQPANTK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K452	Uncharacterized protein	1	116-149	WYDQMFYIKPNKRRLNKRIKNKKKRFDAGISNLL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQC9	Mannosyl phosphorylinositol ceramide synthase sur1	1	302-327	YLISKIRPRGYRGRPRKDSNILANPL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQG1	Putative helix-loop-helix dna binding protein	1	58-83	KLLNGATSSRPRKRRRSSQISSREEL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQL8	Protein that interacts with mitotic cyclin clb2p	1	266-286	TVETRKQRNKHTMQVRTIKKL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRB7	Trimethylguanosine synthase	1	16-38	GSMFPPKMRKYWRNRYRIFSKYD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRH5	Putative ubiquitin-protein ligase	1	1266-1285	VQLGRPVRHKFRYHVRNFSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRP6	Hap4_Hap_bind domain-containing protein	1	89-137	RTSKNWVLPPRPKPGRKPSLLKNKKKKERKHTSKKKSSKKDVTTGKLTR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSC6	Aspartate--tRNA ligase	1	47-70	DGKPMTKKAYKKFLKEQAKAAKKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSN7	Atp-dependent helicase	2	37-67, 264-308	SGNKGMGSGKRKKRTHKSVRNKARKAHSIDD, SNGGNYRARKRKSTRGSRRSSVKRKYSYRNPKKPISRNRSQDNTS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSS0	Putative mitochondrial ribosomal protein s13	1	101-121	GQKTRNNAKTARKLNRLDRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT31	Ubiquitin fusion degradation protein 1	1	229-255	SFKGEGHTLRHSKKRKDKRKSHLPKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUT3	Uncharacterized protein	1	369-391	GNQGETRQMRKRTGRQDNEQLTA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUX8	Putative glycerol-3-phosphate acyltransferase gpt2	1	599-630	NKTINRDRHYHHHHHHHHRRRHLLNRLKLEKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWF7	Putative phosphatidylinositol kinase	1	21-48	IDYFREWVAEQKKKKRHQTGRMYEESKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX32	Uncharacterized protein	1	174-195	QPTIEKKISQRRRHTNKSTTRA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXN3	Dnaj domain-containing protein	1	1-23	MYNRQQEVKKDVKQRKSKITAEY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY09	Adenylate cyclase	1	1276-1299	FYQEFQKLQKQHKLKEKKLITDVY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY25	Hst4p	3	1-48, 93-116, 424-451	MTVVRRNKVSNKKVNVKLEKQSRIGDSGRVKKEAGRRKIKKEPLDTIA, EIPTTDLKRKPKLRYRPPNGTILD, LVSLYDYVYKPKKRRKVNTKVETLKSEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYR2	Uncharacterized protein	2	436-458, 548-569	NVQPSHNHHRHRHQRHKANEEDF, ASNLKSNKRSPKSTTNKNDNDE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ61	H/ACA ribonucleoprotein complex subunit	1	67-88	LPKPKDYGPKPKRKRGPKGAGF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K001	Protein of the mitochondrial outer surface	1	49-68	GGRRSGRAGKTKKRIFRSPL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K200	Globin, putative	2	299-324, 327-360	HTNMSKIYLKPRRKPVPKKELPATPE, ISPPEASPKKGRRRGLHSKKGRWRLRHHVRFFIW
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K314	Vacuolar protein sorting protein	1	301-323	SSSWIYRQRRSKGYTFKWKCWHD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQW8	Glucose repression protein gal83 (Spm1 protein)	1	29-53	NSQQQQQQQQQQRQQQQQQQQQQQP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRC6	Uncharacterized protein	1	15-40	NIPRCEILQPRKRQSKKLEKFLREHD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRT0	Uridylate kinase	1	7-26	LQRRMYSSNKEAPKKQRRSL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTI2	Uncharacterized protein	1	11-35	DYTVKYVNSNWRKKRKIQDNYGLPI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU33	Cysteinyl-trna synthetase	3	1-36, 406-434, 471-497	MGTRRKTGRCTSTRNSTRRKTTPRKNQPWSKHDLAL, VEQQKEKQQQLEKRRKQAQKSINEQKMRE, EELSKSARKKLAKQWRQQQKLHEWFLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU95	C6 transcription	1	410-431	AISKGERKNPGRKVKSNSFERS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUB7	Rad17p	2	67-101, 463-493	VDPETRSMLRPKDRHRRNNRQKSKRSNDQSMNSNS, VNRDNDSKKRRDESDKRTKGKGRKEGINVSR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUU3	Ldb17p	1	262-282	QNKPSAKKLAPPPPPRRKTAS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUV6	Ymr295c-like protein	2	2-27, 158-187	GLFRNQSKKSGKYKVKLTRDDEKRLK, MSVQQGVYKRQPKKQEKKKKRGFLGFGKKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW37	Ubiquitin-conjugating enzyme	1	1-21	MSTPARRRLMRDFKRIQKDCS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWB5	Xanthine dehydrogenase	1	1-25	MLQIQVKKRKLTKKCDKSASNDMEI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWU6	Putative chromatin remodeling snf swi complex subunit	1	600-630	FESIQKLKKEREREARRKKRGQTRVGRRGGV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXZ4	DNA-directed RNA polymerase III subunit RPC9	1	31-55	FTVPETKTKSGKKKKRRNIDSLIDL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZA2	Putative nucleolar ribosome biogenesis factor kri1p	4	267-314, 399-426, 501-529, 540-575	QATMRREKMNSRKKDRKKEQDKRRKEKQDVQKQLKQKKQKKINMVMDR, DEETVVSKRKQKRVEKHAKKQQKEQLKQ, VEEDKMKFGKKKRLSEWRKKVFHNPEGPD, KIPSIVNGGKHKHRHKHKHGNKKRRAEDAQKSDGKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZL1	Uncharacterized protein	1	118-144	MKGLRKLKLPPTKPKKHRTVSKNIADE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0C3	Uncharacterized protein	1	1-27	MHLKLNKKKTRKPNKSSSPSRKEHHTH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K109	40s ribosomal protein s18	1	113-132	IEKLKKMRAHRGLRHSWNLR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1E5	N-acetylated-alpha-linked acidic dipeptidase	2	176-195, 751-770	KAKSRETNRESNKRAKRQPE, YYERRFLSKHGLRNRPWFKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K220	Uncharacterized protein	1	86-106	NEDKCEYQRKKRKLELSIKEG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2W9	Uncharacterized protein	2	81-102, 109-132	QRSNDDKKSERHRKHRKESIGE, LPRQHRNVRRALRRYQRRRHSLFD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K305	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	1	277-304	VKYGSNKQAKVHKPRSKNRDRGFNPFGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3F8	Uncharacterized protein	1	238-265	RKTRPEKDYGYRDERKPRKRTERLRLLQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3G0	Formin (Bud-site selection polarity protein)	4	983-1005, 1234-1254, 1643-1664, 1686-1710	SKDISPIKRRHIPRRKKIASNIE, FDMLPRPKKKLKQLHWEKLED, MQRFNEQKQKQEKQEKQESKSG, TSAKIKEWAKKHSARKKQAESSSSA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3J6	Uncharacterized protein	1	132-194	LQAEEKLKKKQKRKRALEIPQIKPLEPSKKKPKVKKSNIAPPAVPRRRKYSTRKSTVKKTEAV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3S5	Serine threonine protein kinase	1	196-218	QLDYAKIRPRKRSPKHPLELYTR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTK7	DNA-directed RNA polymerase	1	92-112	DTAGRYSKKYRKSLQAQRTLP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTN3	Uncharacterized protein	2	428-451, 485-542	HTSSKNPFRRLKAKYKKLIDFKGS, AEVEKRWNAKHKHWYEKKASHLKEKAIRKHERLAKEKRQQDKKWKKLMEKVNKHNIEM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW32	Putative oxysterol-binding protein	2	39-62, 125-149	WVQAFDYIKKKNRQQRLLQQPGGA, VEAHWAKKKMDKRERKEREREEIVQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWC8	Microtubule-associated protein	1	21-50	PSLVVNTQKVHKHKKKNKGTEQPRMVCNKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX53	Uncharacterized protein	1	271-291	HQEEEFRREWQCRRRKKKKKV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY56	Protein required for daughter cell multiple mitotic checkpoints and chromosome stability	1	23-48	RYSLRTETIRVRKLRRRSPSDYSPGS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYC8	Ribose methyltransferase	1	16-56	DKDEWFKKYAWKHSLQKKAFKEKGYRRRSKGDDKRHYEQNV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0E5	Protein-tyrosine-phosphatase	1	835-856	LEETFIKKRKANGNLKKRLVIS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K187	Scf complex f-box protein met30	1	321-346	ECKAIEKCRQVKRQRRTRPWKAVYSE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1H5	Nucleolar protein	2	2-36, 414-469	MRRSTLSQKIMRKSRQVKKPRVKKNRQEKYCIFIR, REVREGKSRKLEEKKNRELEKKSKKSKKAGKVTKPKDKKKHEKSVKSNKRFEMKLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1P5	Protein involved in bud-site selection	1	219-238	AVQKKEKRVVQKEAENNKKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2P8	Protein-tyrosine-phosphatase	1	760-779	GLGRSKSKEGRHRRSETIGC
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2X0	Ygr053c-like protein	1	95-116	GKNGDNKEKHINKNKLNRKANL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K311	Vitamin h transporter 1	1	251-271	LCGTIKRRKHRFFPNKVHQLF