ProteomeAccession	ScentificName	ProteinAccession	ProteinName	#NoLS	Positions	SegmentSeqs
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCP1	KLTH0B04664p	1	1-22	MSKGKKFRKIGKTSFQPPKNVV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCQ5	Histone acetyltransferase	1	200-222	EREITNPKKNKSRKAPSKIEYIY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEW3	KLTH0D10274p	1	1-24	MAKNKKKASKPKPEKMEPAKTDCE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF06	KLTH0D11264p	1	20-41	AEAKVHKSKVYKSKQHNDGSEL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF86	KLTH0D13090p	1	1-20	MPKIKIRKPREPEPNEPEPQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG99	KLTH0D03542p	1	687-706	NDVQAPPTRRLTRQRMKEID
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGQ7	Glucose transport transcription regulator RGT1	2	22-49, 352-376	AASDRRRSKTSRACDQCREKKTRCDFSD, SDGNHNGPRKQKRKNSNRNKPGSQS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGZ9	KLTH0E00176p	2	6-36, 41-65	KTACALCKAEKKCCDKKRPKCSHCTDENVAC, TLRWGGRPYKDKTKQIKIPKNTVLV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHM2	Required for respiratory growth protein 8, mitochondrial	1	14-33	LVALEKTKRIPKKPSCDASP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHM9	Glycerol kinase	1	639-659	RTRIFRSKSIDTERRRKWKLW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI06	KLTH0E08690p	1	36-75	FYEKTANGKTRRRKLPDYCSQREKKLWKKLQNRAWKDDRC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLA0	KLTH0F11264p	1	405-430	TLYKKDWNLFKKRKHRSTKSSSRDSY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMY1	KLTH0G12562p	1	665-691	VQTREAARKRLPKRRTLTKRENNVEVE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMY2	Branchpoint-bridging protein	1	86-114	VYDARGRRTNTREQRYKRKLEEERHRLVE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNI5	KLTH0G17336p	1	420-440	TSPYCDKKFYRRDSYARHVAM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNI9	KLTH0G17424p	4	69-89, 116-140, 252-278, 295-315	IKCINCSQRGHRKRNCPHVIC, GHYRSQCPHKWKRVKCVHCNSKNHS, EESSGARSKKSKKRKRDSDKNYSSSPH, KPSSRGNVLPTKKNKKSELRY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E249	Protein transport protein SEC31	1	1113-1135	QKAPIGPPPKHMKRRTHASNDID
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E263	KLTH0H02442p	1	279-303	RSDFKETRKHWRQLERQKKQKWVPT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2E6	KLTH0H04290p	1	133-155	LLKQSRPKTSSPQPPPRRKLTTT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2K5	KLTH0H05720p	2	10-35, 62-91	RSFTGCWACRFKKRRCDENKPFCSLC, KELVSWKKLRNLCKQPNRNRISRRRFQQMT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2R5	KLTH0H07106p	1	46-74	KPIFEKSRSAKKNRKRARSPRGQEPERRW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E385	KLTH0H11198p	1	57-84	ECSGNAQPPLQKKRKGKRLASNKFVQSL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3R5	KLTH0H15730p	1	7-27	RELARQKNLSKQKQQAKGKKE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3R9	KLTH0H15818p	1	1-23	MAKSKQRSAKKSKGSVAQGRKSK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBE4	KLTH0A01914p	1	1378-1399	ISLVLHKKPVRCKKNEMSYVNP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCP4	KLTH0B04730p	1	131-155	PSNSRKSERGSKKSGKSGKQSKPGL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCR4	KLTH0B05192p	1	117-136	VRERSFKKPRGYACKNCCMY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD87	KLTH0B09196p	1	1899-1920	EELMMVKRFQPRRKNNGVAISG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDT3	KLTH0C03608p	1	16-45	QDKERHSGEKGHKSKKKGEKPPKVSPEHIA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDW1	KLTH0C04246p	1	165-232	RPTGEDKRDKNEKKHKEDKKHKKDKKVEKDKKDKKDKKDKKDKKDKKDKKDKKVKKVKKGKKEKKVKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEX7	KLTH0D10582p	1	73-98	DVDWLYKGKRKAKQARRERSNSVSNG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF68	KLTH0D12650p	2	38-57, 1378-1402	HQPFKELRRIEKRVCKPLSS, NKAFYSLSRRKLRSRPSRKGRQSRI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF75	Double-strand break repair protein	2	560-579, 621-657	KVTRAPRSTNHKTRAREQHP, VEGSSDKKRTSRKNTQSRKNQPKAVRQKTPKTDMLNS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH24	KLTH0E00792p	3	25-44, 81-107, 589-618	GYQTHKLKARKPWSKEEDDL, DEIATKFDRKVRKPKDIRKRWVSSLDP, GKVSNRSPAAQPKRKKRRKGKDGSSEGNTP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHZ6	Telomerase reverse transcriptase	1	415-435	NHGCLRLVPKKKKKQFRVIFV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIN4	KLTH0E13882p	2	168-187, 1073-1093	LNKRAFTKILKKLDKKAGTK, FEDRMRLTRTFKKNNFKGNAR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIQ9	KLTH0E14454p	1	38-63	QECGYTYVVKKRQKPPTRVSNRKILA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJG8	KLTH0F16324p	1	133-156	VPKPRATGAKRGRKPKKAASVNEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJM6	Alpha-1,3-glucosyltransferase	1	1-20	MPKALKKRGKSETVKDTRKF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJW0	KLTH0F19536p	1	15-41	IPAKQPPPVNASKQRKTKKFILSKYTI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK83	KLTH0F02530p	1	317-347	GAGQSLRQSNKRRGKKDHSSPRPKAPKSPEV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKG6	Histone-lysine N-methyltransferase, H3 lysine-36 specific	2	517-537, 637-673	AEEYEKKKKQRIEFQRKELER, VKTLSSKELKKDPKKSPPPEPSKEKKAKVREFTKVYM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL71	Mediator of RNA polymerase II transcription subunit 1	1	349-376	ISAQRRSSATRRRRSSQKGRRPSMNESS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLU5	KLTH0G03630p	1	84-103	ALKEPPRDRKKEKNVKHSGN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLZ3	KLTH0G04686p	2	156-178, 343-364	IDNAPLARRKRRRTSKHELNILQ, ISPTRKSKCTFKAYQDTHKRSA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNA9	KLTH0G15510p	1	168-189	SASLRQDSKKYRRSARQINLEL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E226	DNA damage-binding protein CMR1	1	35-77	KNEAGAKDERKPKKKAAKQRVVKKEPKPEKVPTRRSRRLMGES
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2U0	Ubiquitin carboxyl-terminal hydrolase	1	714-739	KDEQWSCPRCKCKQPSTKKITITRLP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2V8	KLTH0H08096p	1	1-20	MARRRNFKKGNRKTFGARDD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC81	KLTH0B00880p	1	54-88	FESRSRQSRRSQKKGHRGGRRGPRAPKREKPAQPT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD24	Non-specific serine/threonine protein kinase	1	272-292	VDCIRRFFKKKLKFEPRVDES
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE69	Ubiquitin carboxyl-terminal hydrolase	2	1-22, 686-714	MSLRKWLTRSDKPSRHKPATQG, EERRGERKLSSKGLKRRSRIFSFKRSPKD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEK9	KLTH0C10098p	1	47-88	PDSGASSKPSTRRRRRKVIKSCTFCRQRKMKCDQQKPMCGSC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEP6	KLTH0C10956p	1	972-996	QPLKELLRSKHKHHKKRDTSAEDDS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEZ9	KLTH0D11110p	1	83-104	LTDKGFKMPKAPKKSKEEETEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF40	KLTH0D12012p	1	272-294	RQVIKPTPFRKRNKLVKDPINCC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF84	KLTH0D13046p	2	45-65, 1351-1378	QVAAKQQQKRQQEQQQGQQSH, TSMKSTKGVKGRPRGRSRGSRINGKAKN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG27	KLTH0D01914p	1	718-743	MSEKEDPRPKRKGWYKKPQVLYYPPP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG78	KLTH0D03036p	1	432-463	LKDQPAKKKTPPKKKEKKEPKAPKPPKKIYTL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHK3	KLTH0E04994p	3	63-85, 223-243, 378-405	FEKDEDFKFKRHKHRNNAGTASL, EDVAKKSQRRREKRSSLMAQR, DDTDILHSRPRKRRRQQPLKIPNEKNVE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHQ0	KLTH0E06116p	1	13-46	EKPAAMFTCKSCRQRKRKCSREKPACQRCVRLAI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIG1	Mitochondrial import inner membrane translocase subunit TIM50	1	85-109	QTSEAGGKRKRKRQTSADIKRERYA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIS2	Phenylalanyl-tRNA synthetase	1	420-443	IDDFTHPKTKKRSLCYRINYQSMD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIU1	General transcription and DNA repair factor IIH subunit TFB4	1	315-336	TTKLKKKPVVPGMIQKKRKRIQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJR6	KLTH0F18546p	1	2746-2767	TSQNKKRSSTVQGEKHNREKEQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKA4	KLTH0F03014p	1	1-26	MTAARSGKRKVGRRACMLCKLKKLKC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLJ1	KLTH0G01122p	2	63-90, 258-278	IRKNFRQLSKKYHPDKNQKYRKLYERLN, PSTSRAFSNKRATRNKGPGAT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DME8	Stress response protein NST1	5	32-58, 240-260, 663-700, 727-776, 798-820	EENMSASTKKKMKNKKKNTAKVAEAEI, VLQFKHNKQRQQQLQQQQLQQ, EAEEQKKREKEEKKQRKREKEKEKKRAQQQAKEQERRK, VEEAKRKKDEERRKKLEEQRRKEEEQQKQKKLKEEQKRKREEEKRLKDEA, EELKKQKEAKKLDQERKRQQQEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMG1	KLTH0G08624p	1	153-176	NNLPVRKKEFTRNHKRQFSKCIML
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMN4	KLTH0G10318p	1	728-759	EEVPSSRKPAPPKPKRPKKPSHLKADKIIKEA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMN8	KLTH0G10406p	1	552-571	APVFKQCKCGKNKKVRTLCF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN84	Translation factor GUF1, mitochondrial	1	601-626	ASDVSRRKKLLVKQKEGKKQMKSVGN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNG3	KLTH0G16764p	1	576-599	YGSVKTHPASPKPRNRNQTKHMIF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2P3	Pyruvate carboxylase	1	950-970	PLRSDVLKNKRRKLTCRPGLE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBN8	KLTH0A04158p	2	14-39, 320-340	EWIDKYIDYKKGKKKIKACRNTIAAS, LSSSAKDRKRKIERIKNLSLE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCR3	KLTH0B05170p	1	43-76	ANKKEPESESKSSKKKKKTKKKAPGPSYPVNEKG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCS0	H/ACA ribonucleoprotein complex non-core subunit NAF1	1	273-298	EKEAEFKKLKKNSRKRKNENATNVGP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCT5	Chromatin modification-related protein EAF7	1	355-374	KAPPAKRSSSRVANRRRARR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE28	KLTH0C05808p	1	610-629	EYVLRRKNVIRQPPLGRHHR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE72	KLTH0C06820p	1	605-648	DAVVTSTKKKGKSKKTTASSTLPTSQGDKKGQSKKKKDKKCVIM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEN0	KLTH0C10582p	2	3-28, 58-85	ELPLVRNTKRVRTVRKLRYQYINTLY, GDHNSADATSRRRRRKRRLLSVLGHAET
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF89	KLTH0D13156p	3	72-99, 1428-1452, 1676-1695	ASPAANDSQRPKKKKKTSPKAATGTKDA, EEDFSETKRSKKKKKSVQGVEDQTI, FERVVNRKLTRKQAKFFFGK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFJ2	KLTH0D15532p	1	448-471	IDISRLFTRKKKNKMPGKSFNFNV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG15	DNA-directed RNA polymerase subunit	1	1087-1114	ESALKYSKKALKHRKKTEKVPHYSQKVK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGL2	Transcription factor BYE1	2	2-25, 151-177	LAEGVRRSSRRNKGTNKYLQDQRT, NEYLGKDSTRPKKRRKLDSPKNITKAP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGS5	KLTH0D07876p	1	9-31	AYSQQPPQQQQQQQQPQQQPQHG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI31	KLTH0E09284p	1	1212-1234	TEEVDDKRGKKRPQIVETHKVED
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIX3	KLTH0E15884p	1	209-230	VRLRRQRNSMMQRRPNPPRRQL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJN1	Ribosome production factor 2 homolog	2	1-25, 48-72	MIRTVKPKNARAKRALDKKEPKLVE, DLSALKKPDIKRFNKKNEVRPFEDA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL88	KLTH0F10912p	1	34-61	RRNNPDFRKSLKRKLKKHAEEEKQAKER
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLE8	KLTH0F12496p	1	184-204	PLSSGRKKRKWSPSALPTFKR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN29	KLTH0G13684p	1	1-23	MTKLEKSRVDKRRRDKVEFDMPA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN75	KLTH0G14740p	3	42-65, 83-109, 614-638	DLPASRMRPKPYKKASSSRQVHPV, HLLHSLTPYQKQRRRMKKSFQFPNGES, DEYERSDKKFIRNRRKMMQTQNMAY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNC4	KLTH0G15840p	2	4-51, 713-738	KLTQRFAKSSRKPAKDNGKVITRNTHTKKRIVKPKRQTQSTRDEEKRN, EKDVILAKNKFKKQNKQLGKVQLRSL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNK3	1,3-beta-D-glucan-UDP glucosyltransferase	2	255-284, 1795-1819	RNMSLGKLSRKARKAKKKNKKAMKEADAED, RPPIYSLKQTRLRKRMVRKYCALYF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2H6	Ribosomal protein	1	54-73	RKGRVYVYCKSNKKHKQRQG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E339	KLTH0H10142p	1	147-168	DDKWNRKTKVESRRDRSQKCGV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E398	Probable metalloreductase AIM14	1	35-54	IGARKLIPVRQRNRSKWAKW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3H1	KLTH0H13530p	1	30-53	GSTRNYAKRTSSRKNDLKPVTFKI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3Q6	KLTH0H15532p	1	11-30	DDQSRPPSRSSRKQCWESRD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBC4	KLTH0A01386p	1	460-490	SIHSKSSSDDHRKRKAKVRRRIGLDRPNEVY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBC6	KLTH0A01430p	1	78-97	ALPPLKYKYDHKRLKRNGGN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBF6	KLTH0A02222p	2	50-87, 422-443	EGDRSESKTKKAKRDDLPEKRKRKKKDKPFDFSKYDTR, ESVNQKFREKKAAKKRNRMTTT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBG7	KLTH0A02464p	3	1009-1034, 1155-1184, 1187-1216	DNRLLVNIRKTRNRNKKKAAESMETA, EAVKHGPVRGQKNKLKFKKGTRAGDNDFSD, GANKSFKPNMNGKKVQKKKGGPKFRSNRKL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBM2	KLTH0A03740p	1	374-395	IFDAQGKKKKADHKRKDSTVKA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBZ2	KLTH0A06534p	2	35-54, 57-77	STLRKAGTPVKRGKNQHPLS, LSSPIRPHKTRKSKSDTPLIT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCJ6	Transcription initiation factor IIF subunit alpha	4	19-44, 257-276, 516-542, 623-642	QLRRDFLRSRLKKNGTPRPYVKKEDP, DGGGRFRRGNTKRKTRQLKL, QENGKSSRKGSPKKKSSRGSPSGPRIY, IKELKEKVAKHPSNKDRMKY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCZ2	KLTH0B06996p	1	236-259	SNWNAPGSNPMKKRKKKSQKCTIL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDU0	KLTH0C03762p	2	70-96, 1151-1173	VAQACDRCRSKKTRCDGKRPQCSQCAA, SAITMPTRPHRGPRRRWNSTTGA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF81	KLTH0D12936p	1	286-311	DFLDALKSNKKTRKPPAKQKLEHDEL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF87	rRNA adenine N(6)-methyltransferase	1	291-311	FTTVIKDKKFLRKCPKELTSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFF0	KLTH0D14564p	1	8-31	SGPMSKTINTRKFRRTVRDNLLNV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFU7	KLTH0D18062p	2	12-34, 37-61	AAKMPIPKKSRTIKTDRPRPFLC, CTRGFARQEHLKRHQRAHTNEKPFL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG74	KLTH0D02948p	1	132-152	CPAGAQCKKRHIKKTMCPRYI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGF3	KLTH0D04862p	1	457-486	GKWEDYPKRFAKCRRCKRTKYCSRECQLQS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGT9	Fructose-bisphosphate aldolase	1	321-340	ADKPNKKKYDPRVWVREGEK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIP7	Eukaryotic translation initiation factor 3 subunit A	2	183-205, 830-849	NRTMNFCLKYKRKNEFKRLAEML, AERMRKEREERARINKEKDE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIQ3	KLTH0E14322p	2	11-50, 555-583	LKDKVSSKLKENQKQPKNGKKAPKKQSKQRGKDAEKGTNS, PKNKDASYEKKRKKNFKRGKKGGKSVQND
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ41	ATP-dependent DNA helicase	2	492-515, 691-722	GEYAMKHKPKGRKKADRLKRLEQE, QAMLGKLKSKKDKKPKKGKAGKREKQAGKTFF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJR2	KLTH0F18458p	1	8-27	SKKADFKYKIGKVKQTPPVL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJX2	KLTH0F19800p	2	57-76, 546-573	LMQQRLRQQQQQQQQQQQQQ, KRTGDEEKGKTKKQRKTVKKAAPTTAAG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKI9	KLTH0F05082p	1	89-113	NLPAAKPMTNTRKRRNTPAPLTLSQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKJ2	Vacuolar protein sorting-associated protein 35	1	544-566	KLIRKCQLMIKRKPQRREKMSTT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL49	DNA polymerase	1	44-63	IPSDKFKKQKTVGYKPKDST
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLD7	KLTH0F12144p	2	639-661, 758-779	AEERAKLKKTKKEASKKLASLRQ, LTQLKSKRDKVSMKQEKLKKEV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLQ3	KLTH0G02596p	1	561-580	VEEWEHRKKNDWKRVWGTTV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMJ2	KLTH0G09394p	1	18-40	NDAQIKKGYRKQALKFHPDKNPS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMZ4	Midasin	3	764-788, 3639-3659, 4700-4727	DSDENSGNRKKKRKLDSHTRQILLD, AARLRKETPKVYNKKEKKLLA, IASQFRKDKIWLRRTKPSKRQYQIMIAV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNQ6	KLTH0G19030p	3	166-185, 671-700, 810-831	ISYRRETPSKKNRRSTSADS, SQIEVKQQPQKRQPQSRRVSRNSPRLPKPT, DSYNVDVQKRKQYQRYLRYVVD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E1Z7	B-related factor 1	2	289-308, 493-517	QPPSFQRNRAKEKRLRQKIV, SGNASVKKRGGPRRKRKAASDADGV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E220	KLTH0H01496p	1	711-735	LPGSGTFKWMKKKQERQTHAPEQTT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E247	KLTH0H02090p	1	17-44	STNNCMSGVNKKRDKRKVLKNLKGALKG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E296	KLTH0H03168p	1	246-269	GHTNKAVKSARRARKNKIRCILIL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2I1	KLTH0H05126p	3	103-126, 145-168, 268-295	RSAYQPVQQNKRQNRRLRREDVPS, SLPAEAPKPRKRHQRRKDSASGLP, EDETRRRGKRGPQRKLKSRSNSRPSSND
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2L4	KLTH0H05918p	1	559-591	TQQNGASDKKKQNARKEKHKSARANHNRKSGHD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3E8	1-phosphatidylinositol-3-phosphate 5-kinase	2	215-239, 2096-2115	CFSCAKPFTTFRRKHHCRICGQIFC, TKEPTVVTPRQYKNRFREAM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3N9	KLTH0H15136p	4	132-154, 1146-1168, 1223-1242, 1452-1486	LEKAFKLYERWKRQQSHFRASKE, LNTQQKKPTTLRKNSDRRKSSSA, FVTVAKSKRKPSKSSPATKS, NNIYSSGQPSRKKNVKKQKPQRPVNRKQAQAKTST
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBJ7	KLTH0A03190p	2	490-513, 613-635	EQQPAKRKPKVSRFKKDRNPSAAV, NLSSLQKPVKRRPAKEKLPELPE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBT1	Golgi to ER traffic protein 2	1	4-28	ISDAEKRRILREKRQQKFNKGGASS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBX0	KLTH0A05984p	1	188-213	IDASTPCDRHHHRRKSTAIKFRKALY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBZ6	Triacylglycerol lipase	1	1-23	MDDTKSLKRRTRFRIFKSHLGLA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCU1	KLTH0B05808p	1	367-387	PDLRTRTAPNSPVRRKPPPKW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDV5	Ceramide very long chain fatty acid hydroxylase	1	329-349	PSYMRKLKKYHMEHHYKNYEL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDY7	KLTH0C04862p	2	106-125, 490-511	VADAKFKPDKRKELMRRGFV, DADKQKQKELKQQQDLRRNDTR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE01	KLTH0C05170p	1	44-64	WCRFRDSFKRAQKRSVPQGGD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEP3	DNA topoisomerase I	2	56-99, 615-637	LSEVSKSGPKTKRARKTTPTKKSATKRVAKKAKKAVKREPSVEQ, EREKYVKKFSRENEKRKFEKQEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DES3	Phosphoinositide phospholipase C	1	723-743	AQLLPKPKTLKQKQSSYNFSV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF47	KLTH0D12166p	1	367-390	HETLMRQRRQEKHRARKLKEERVL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF59	KLTH0D12452p	1	253-275	DDARPGKSARPNKKRGRDEKTQI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFP6	KLTH0D16852p	1	127-167	VSDIYRKPCVRCHKRRKLCKFDLSRRTRRRRRESDTSVEAQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHH0	Ribosome biogenesis regulatory protein	1	179-203	RSLSRAERKKLIKKNELQHKRNMKG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHR0	KLTH0E06380p	2	1303-1323, 1512-1534	ASTSKIEKKLRRRDSEKSIDP, NTKNSKASSKQARIKKVNSHLAG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHU2	KLTH0E07128p	3	1-21, 125-144, 206-233	MSQHAQVKRKRTRTLDAAPQA, HYTAKKFKKQRTISLPQLPY, AAPKISKLVPSRKKKKKFFQTDKEGHYV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI60	KLTH0E09944p	1	535-558	QEIVKNRRHLRWRRNNKLHPVKLV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJK2	5'-3' exoribonuclease	1	103-122	GVAPRAKMNQQRARRFRSAR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK63	KLTH0F02090p	1	21-40	KYVSKFRKERLREIANKLAG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM66	Acyl-CoA desaturase	1	29-54	PQLSEASKITKKRKRDPQLVHLLKKV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNN9	KLTH0G18656p	2	428-453, 808-844	WNEDEHMKTRRKKNKRRKLYYVGLAT, IDEAQKKMSSRKKRNSWVPKWMKPKKAKWQEMCEETA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E230	KLTH0H01716p	1	528-571	SYQIMKNKGLTPRRKKENQNSRVKKRKKYDQAKKKLKSVRSVYS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E274	KLTH0H02684p	1	6-33	EAEQACDWCRRKKLKCSREHPICSNCFK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3G2	KLTH0H13288p	1	322-341	HSESSKKDPPQPKQNSSQGE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBB0	KLTH0A01056p	1	732-756	DNQLNHPTKSRARGPKRKLPKGVKT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBM9	KLTH0A03960p	1	84-105	TAPAKVGKRQGLRKKKQVDYIS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD93	Carboxypeptidase	1	70-91	LEFVTKPKFKTNRRPDSQWDFV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDB1	KLTH0B09746p	1	44-73	SNSLSASLQEKRRKRRARSSGKAWASKRRP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDW8	KLTH0C04400p	1	43-67	SSRSTNQSSSTRRRKRRTVTDNMIE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEA0	KLTH0C07480p	2	132-168, 173-200	SSNSNGKTVKRKYSRNGCTECKRRRMKCDEGKPTCWQ, NRECVYIIRTKNRKRRPKSTEASKESAQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEK3	KLTH0C09966p	1	139-158	ASSSKFWRSWRLKHERHGSE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFI3	KLTH0D15334p	3	13-36, 60-81, 190-211	VAVEPVTKNKRGKKGARVETEEEK, LLHENCQKRKWNKVEYDMKKIG, VADRKHKEVKEKERATKQQQAE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFN1	KLTH0D16456p	1	1-30	MAANGGRRRTKPCTNCKKNKVKCLYQDSLP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG68	Structural maintenance of chromosomes protein 5	1	277-301	QVKDHKVRIKQYKREYEKMRKQLKD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG97	DNA helicase	3	617-641, 690-711, 1047-1066	EESQMSEKERRQKKKREKDGFVTIS, RGNNGTSSPKKNRPRRNEGTLD, SAPSEVPKKKVKSEPMDKGY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGG5	KLTH0D05148p	1	458-477	QQQHQEQQHHQHHQHHQHQD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH43	DNA helicase	1	46-79	MGMTNASSRPKPKKQVRKTNQKNKKNNSSTNETL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH82	KLTH0E02090p	1	132-155	KDESKVKKLTGKERAKKRKLDSLS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHF1	KLTH0E03850p	1	964-985	HLSLSNRKRKRLEERGCSERPS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHN0	KLTH0E05676p	2	483-508, 590-614	YSLVKHKARRAWSNRPRFYRKRAGSD, GNETEKRPPLKPKSSKSFDKKGKKQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI26	DNA repair protein RAD5	1	152-173	RDYGARLFKKHKPTVRWRRFIG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIQ7	KLTH0E14410p	2	6-27, 78-108	RAKSQLKAKSVKRKNEFQKAAD, STSGWRDARHHNYKRNKKLNKSRKKGSFTKF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJY3	KLTH0F00264p	1	193-219	RFSLKEATGRVRKKKPTQTFALRSAKI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKB0	KLTH0F03146p	1	127-153	PMSSEDKNKTKSRRKIKLKLKRQETIS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKJ1	KLTH0F05126p	1	86-105	ATNSTKERRKWILRLCRENS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKN5	KLTH0F06160p	1	274-296	VTISVEKRKQRNKTTKQVRTIEK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLU0	KLTH0G03476p	2	64-88, 350-381	QDALIKRRRKLSKEITKLKKLKPVS, WGQLAKGYKTRRGKHQNRMKVKDRPRGKTGKA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLY1	Histone-lysine N-methyltransferase, H3 lysine-79 specific	1	127-152	QEAATKKRPSRIKKASHQNKRSFKLV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DML8	KLTH0G09966p	1	37-58	KGYRKWWKCSPKELKPDPKHRS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNE0	KLTH0G16192p	1	572-598	LSGTIWSKSSKIRKKNKARAAAWFRLA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNE1	KLTH0G16214p	1	272-293	HMNRGIKKKKPSKHSASLRHAL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNH1	KLTH0G16984p	2	38-82, 92-118	RPSTTCAHCKELRKNKNANPTGGCTCGRQQKKRLAQKAKEEARAK, CIETDKCTCHARRKNRRSVSSRSRTTT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E271	KLTH0H02618p	1	101-120	AESKTKTRRRWLPNVIKKGL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E318	Exocyst complex protein EXO70	1	587-614	YERFHGRYKDSFKNPRKHIKYTPNELST
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E364	KLTH0H10714p	1	78-104	QEDPLKLRKKQLRSANRNKIKQNNFLS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3R8	KLTH0H15796p	1	155-176	IYCHGCRNEKDHPKRHKEWFMI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBS8	26S proteasome regulatory subunit RPN2	1	800-825	VLSTTAKAKARAKKTKKDGKDTVEEK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC65	KLTH0B00374p	1	133-152	RSPSYGRKSLQKRRGGPGRG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDI8	KLTH0C01320p	4	28-64, 307-329, 371-401, 403-442	YYDDKTQDQWKAKKKTKAQSKLDKRKKLDPEQQNEES, SDLQRLRKAREKKGPSKNDIKAH, DDEKLLRKALKRKEAKKRKSAVEWRERKEAV, TAISDKQKRREENLQIRKENKGKKRNHREKMKRGIKGVAP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDS1	KLTH0C03322p	1	278-306	KMRMRLCCRVFRKRKPNKENNNSRSRKKF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDX3	Eukaryotic translation initiation factor 4C	1	1-25	MGKKNTKGGKKGRRGKNDSDGPKRE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDZ1	KLTH0C04950p	1	1-20	MSALNQKYKKPRLQQAETAG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEI0	KLTH0C09394p	3	1-26, 456-478, 617-645	MAPVISKKSGKKHSLNAKDQKTAKKA, EYSKATSKKPFEQRRKELLNKFA, LSKTENKKFFKDLKKVSKKINKDDESNKG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF34	GlcNAc-PI synthesis protein	1	370-390	SPMPRNKSWYKMLKNFHERND
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF62	KLTH0D12518p	1	262-284	VEVLDKKKRDQKRSQRRATKTSM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFH1	KLTH0D15048p	1	198-224	DSEFKPFVSRKNRRKNKTRIQEQVVDY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFK5	KLTH0D15862p	2	1868-1909, 2065-2090	LAPSTFNEKNRKNHRENGAHQNKRNKPKQQSKPERGEPKSGN, NGIPKRSKPASNPFIPKKRKLFSSKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG36	KLTH0D02112p	1	258-281	CIDIHVLKRPKRARTNRSQAHLDV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGC0	KLTH0D04070p	1	7-27	FVSQRSEKKNYGKPKPIPAYF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIC4	KLTH0E11418p	3	77-97, 528-550, 674-693	ALEKARKTKFKGRLLRVDIAK, EDEIAARKKKDKKQGVVRQAKVI, VDDNIKRLIGFKRKRKQARK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIV0	U3 small nucleolar RNA-associated protein 10	1	15-34	ATVALDRKKRQKLHSASLIY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIW4	KLTH0E15686p	3	100-120, 181-206, 303-327	FAPTKTWRKWNVKVNHNEKRY, VLKSKKMRAGKGKYRNRRFTQRRGPL, AGQPSQKRTHVLKKNPLKNKQVLLR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL95	KLTH0F11088p	1	174-204	GSSHVHKPAHRHPHNHKKLLKKVLRRKSGLW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLK8	KLTH0G01496p	1	1-34	MDPYALKRDNRKKFFDKEKLKRKHATPSDRKYRA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLS1	KLTH0G02992p	2	9-33, 239-262	QEPFDEQRQKFKRTQRRSEVTEMPR, PQPFVPKFLKRRITNSRRRAQARV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMN0	KLTH0G10230p	2	28-47, 304-327	NKKITSKQEHAVKKNRPTKA, IFELYDKKKHAKNGKKSQNAGSDD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN94	KLTH0G15158p	2	11-31, 109-140	TIAARSIKKNKLPPRPKLSTQ, LHEWERQGKRSKERKSKDKHVKHQEVRRSAEM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E228	KLTH0H01672p	1	13-53	PTKHDSGHALRPKRNRSRAGCFTCRLRRKKCDEVHPKCGTC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2F6	AP-3 complex subunit delta	2	775-806, 883-917	ELKHVSETSKKTKKERKKKKKKAEVLIDEGVP, MDEEVVIVKRKKKKRSKDKKHSKKKDVEHHSAHGE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2L3	KLTH0H05896p	1	38-57	TKRVPKTSSKLDPDNPNKSK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2M6	KLTH0H06204p	1	751-771	RINELNEEKSKKKKKSKKDKS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3P6	KLTH0H15312p	4	31-50, 101-124, 258-280, 541-568	KKDVSRTQGKENKREPNDKS, DWLTSVGTRKKPKRTLDKVYEEQE, FAPIKIKKRKKLKSSSLSQKRSR, GTHSNRRKLTKAQRKVEQRNQQNQHENF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBJ8	Enhancer of polycomb-like protein	3	9-30, 267-288, 703-723	AANTRFRHRKISVKQRLQVYKA, DPYVCFRRREVRQARKTRRVDY, IYNQRRIQKNSISQKHPRVNG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCH7	KLTH0B03168p	1	8-34	EAQKTHYTVCPKVKRRRISCEKGIDPF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCQ2	Protein transport protein Sec61 subunit beta	1	11-30	RTLQKRRQAQSVKEKQQKQT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDY1	KLTH0C04730p	1	36-71	ASVSSTQRKSRRKSSSCNRKKEPSRTNKQEKPSKPS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFD1	Elongator complex protein 1	1	1194-1227	GTAKTGASRRTAKNKRREERKRARGKKGTIYEEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGP2	KLTH0D06908p	1	214-234	SQSRIEKRKMLKKQGPKRPSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHT9	5'-3' exoribonuclease 1	1	86-106	DGVAPRAKMNQQRARRFRTAM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI10	KLTH0E08778p	2	1-24, 44-66	MNSEKSAYRVRKPRTSRACEVCHD, GLVCRLRDVKKVKRGKKVGGAAG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ21	KLTH0F12826p	1	695-717	RISKAYRKSVIGRKYRSKRDVTG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJI0	PX domain-containing protein YPT35	1	35-64	QGPLRTSTGRQRRPRPSRTRKMPQSIQFLA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJR9	KLTH0F18612p	1	185-209	SLMGKQNKTKKTKSSGKKKKKCVVL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJU0	1,3-beta-glucanosyltransferase	1	442-461	DPSPPKSPSKERERNSAPKP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJU8	KLTH0F19272p	1	32-52	GLTVTRKQERRNPNLEEKPTT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK73	KLTH0F02310p	2	400-421, 997-1035	ALQKMDSRKKWNKRSVMKDEHV, LHSTRGVALKKRKKATRKDNAKPKTNKQNSNPRKSEREP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKS3	KLTH0F07084p	2	1-21, 348-399	MAKRRQKTRTHVKPDAEEQKK, LEKKHAQRMKLKEERRKEQEANLARKKEAKDAKKQRKLERRKQREQAGEPAE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKS8	KLTH0F07194p	2	303-331, 786-807	QELPPVKKRGPGRPPKRRNHWAEKKREAL, LGLKLRESKRTWQRRKALFALF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL99	Protein arginine N-methyltransferase	1	31-53	HPITNSRYRERVKKVFQEYRAEV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLJ5	KLTH0G01210p	1	31-52	WKIYLRNRKLFHKLKNKGQSVP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLK0	KLTH0G01320p	1	295-320	SLKSDVIRKRNTKKRGKKADAAKDKD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMB9	KLTH0G07568p	2	332-361, 452-473	PDLSASKNKNAKQKKRKDRRKKGAMSDVSG, EVSKGKLSQRRLKERSKGGVDG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMM3	Conserved oligomeric Golgi complex subunit 6	1	609-631	LPEYHKSKFPQARKEKEVKKHLL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DND2	KLTH0G16016p	1	36-55	YPKVLTQYVKFRQNKQKFDF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2A2	KLTH0H03300p	1	1123-1157	DDDSPANIKVKQRKKRLTRNEKKVQVERRRLRYIE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCJ1	KLTH0B03476p	1	14-35	VSIVKLKKGKKKFEIACYQNKV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCM4	KLTH0B04290p	1	823-850	LASLHSRRLRVLKKREERRKSQESSTSL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCY1	KLTH0B06732p	1	476-500	ERNRVAASKFRKRKKEYIKKIESDL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD53	KLTH0B08382p	2	299-324, 330-350	EQNLFLKRRRPLPKPKTPPTPRAEPS, TVVKVNSTKIHRKNTKTSIFA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD84	KLTH0B09130p	3	215-240, 261-280, 973-993	ARQGRRSEISPPRKLRRRARSAYGSE, DSPVREKRSLRERTKPVNYT, MDLFKNRYKRFRKPPIDDALL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDJ4	KLTH0C01474p	1	1-23	MAPFKFAKKISKDKAKHEPAPAP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDR0	KLTH0C03036p	1	164-196	DHALKIKKSKQQLQQRRRKKKRAAELLDRKTRR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEJ0	KLTH0C09636p	1	4-28	LQQLEEKKRKLQELRERRRHVQVSN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEP8	KLTH0C11044p	1	28-47	LKDSNLKQRTKRRLYTWDEI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEU5	KLTH0D09856p	1	1-48	MGKVSKSTKKFQTKHLKHTLDHRRKQKHHNKKIQGRRGNKSEEEKRNA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHL9	KLTH0E05434p	1	65-84	RYTLWVRRIKLKFKRALEIE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHP1	Oxidant-induced cell-cycle arrest protein 5	1	6-32	TLVHSHLHWRNVKRKHWQKDLVAKVVE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHV8	KLTH0E07524p	1	220-240	IADFNKKHRRGSKYGKFKWVR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DID3	KLTH0E11616p	1	65-85	SHMFKTPKYSYKKKSNWLFSD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK85	KLTH0F02574p	1	17-43	KSDIIKCNKAIRPRSQRSGKSKRVTGL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKY0	Phosphatidylinositol 3-kinase VPS34	1	182-201	LTLQQLGKTNRKKRLPKGIF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLT3	KLTH0G03256p	1	158-179	LMYRSTKPPVPKKKNTNRVVAL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM65	KLTH0G06336p	1	26-52	EICKEHAHKYKCPKCSKKTCSVACIKE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM95	KLTH0G07018p	1	9-31	ESSECASSIRKKRFNSRLPQLGL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMD7	KLTH0G08008p	1	113-139	VVGYNEMKTGRRRRKPKPVKNTYDTFV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMQ5	KLTH0G10802p	1	455-478	EDLHTGKKRYTCKGKLKDGTQWGC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMS3	KLTH0G11220p	1	401-425	YTSSSQLSRRRSKKWKRSLASFVER
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN11	Non-specific serine/threonine protein kinase	1	714-733	TIFRRFSQKRHNQQSQQIPP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2D7	KLTH0H04092p	2	117-137, 156-180	MSSSSIKKKNNPSNSKRSTPF, TATPASSKAKRRIKQRNPTEKHLID
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2X5	KLTH0H08602p	1	114-133	ILYEIKRRNYHEKPEHKGTD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3N1	KLTH0H14938p	1	205-227	LQGYMLKKRRKKLQGFTKRFFKL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBB3	KLTH0A01144p	1	155-186	AGPHKHKAPRIMSKGRKFEKARGRRRSRGFKV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC28	KLTH0A07326p	1	56-86	EKYQKALYKGKKKPQEKKPQQQKPEESKPKQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCM8	KLTH0B04378p	1	19-41	KASPKATAKKPIRYRFNFMKHMD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDK0	KLTH0C01628p	1	139-161	RTGFSKVLKKWDKRSHSHTKDFY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE49	KLTH0C06270p	3	136-156, 165-192, 269-293	LDPRNPPMRRSKNSVIKRQSP, SYNKTPKKGGPGITKKQKKKLMNSFGST, NNPHQQHSAKRSKKLHKNTSSQFQA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEB3	KLTH0C07788p	2	550-573, 580-605	HMDGKAKAGKKKKQDSKDTINWTV, GTRSRIQCRYKWNKLLKKQAMSKIKS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF31	KLTH0D11814p	2	1-55, 110-130	MRAPPAPRKSRARFVRRKAGQVYQVISLRRLKKKYNLHRLHKIHRNNIRNGNPRG, LSRFWMSKRRFKLRRFNPGLE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFD9	KLTH0D14322p	2	1-20, 576-596	MGKSKRRSKASRSHLNPLGG, LPSMRKCFKFVDKNKDPELKA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG38	Phospholipid-transporting ATPase	2	97-119, 1249-1274	SQGIHRAPKKRSGLRNVFRKFNF, VEQFQKAIRRVRQVQRMKKQRGFAFS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGA1	KLTH0D03586p	1	47-75	NEHIRTSPSSRLKEKKKRAIKPNAHQYLP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGV1	Associated with spindles and kinetochores protein 1	1	172-193	DGSTLQRQRRKRKLSLLLQQQF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH32	KLTH0E00968p	1	538-564	FELPKFLKERKERKERRKSKSSNSFTS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJY8	KLTH0F00396p	1	80-102	KQIQNWMSNRRRKSRKESIDSLL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJZ5	KLTH0F00572p	1	2-21	DTHPGKSRPLSKRGSRSCPD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK88	DNA polymerase epsilon catalytic subunit	1	1210-1231	NKVGRVTSKKHQKRKNMIEEEQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DME3	KLTH0G08140p	1	475-495	ESSKKAQPPLPPRKHRTFPSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMP3	KLTH0G10516p	1	379-407	SATRIIPALQKKHKRRSRRFMRMLYWYSP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN38	Transmembrane 9 superfamily member	2	70-89, 512-533	YYYPKFHFCRPEKLEKQRES, GSLIARKKCKWDEHPTKTKQIP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNG2	KLTH0G16698p	1	22-66	GQGASTYGKDKKKKDKQKPKYEPPVQSKIGRKKRKGPATAEKLPS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNL1	KLTH0G17930p	1	38-57	PLSGKSKESRQKQSQTWDKL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E245	DNA-directed RNA polymerase subunit	1	1719-1738	YSPGSPKKENDNDNNNNNNN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E290	KLTH0H03036p	3	6-31, 38-62, 69-93	NELGFDPNLKKKKKSKKVAPEDVETT, DDLFAGLKKKKKKSKEAKGTNDIDS, EALGELKLKKKKKKSKEPSFDDFEK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E315	KLTH0H09504p	1	1-21	MLKLRQLQKQKQEQARQNGTI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3B5	KLTH0H11968p	1	398-425	VDSMNRAVHNHRRRRKSNKSESTGDKTV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3E2	KLTH0H12672p	1	1186-1210	DTGLNFVNKRRKRLSERKTSNIYTQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3G9	KLTH0H13442p	1	141-164	KLEKAEKKIAKKVAKRNNKFVKYE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC95	KLTH0B01210p	1	306-331	SPRALAVKQKRTKKAASFRRKIKRRR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCB0	KLTH0B01584p	1	406-425	DTDSSGSSRRTRRARHAGGR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCD9	KLTH0B02266p	1	28-51	AYPFYAFKRLGKQHPKKHDSNLKY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCX4	Protein IBD2	1	204-225	SDQPSQKQHGHQKHRRCRHGGD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEF7	KLTH0C08800p	1	698-721	GRWTKLGCWRYKPQRWKRVAWFIY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEK1	tRNA (guanine(9)-N1)-methyltransferase	2	21-67, 72-93	PEGMSKSQWKKVWKKKRFEETKDEFAKIRREKRQKAKETRRAKIQEY, EEVPEDLRRKPRKNQDQKDSGI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DER0	KLTH0C11352p	3	81-100, 194-215, 234-260	AKSFERRRCNHPPKEAKPPI, VSKNKRKGPKGPNPLSIKKKKT, AEPVDRSSSGRRRRRHHKRSSTEAGEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF25	DNA polymerase	1	1391-1412	RTTSCFNCKKEIREKTKDLCAE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFB8	KLTH0D13816p	1	72-92	APASKDPTKKNKKTSRPAFNS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFK3	KLTH0D15818p	4	10-57, 101-120, 472-507, 582-608	TSGSPGNKKFSHKEKPKKPASHRQHRVNSKPPKTGKHRDGPGKQRFED, AAGATRRRTKKQFQEHIHLH, AELSLRRRKSTWRKQREDKEKKRYERKLEREQQEFY, GNLNQNPSPRQGRKKKRMVTLLSSNPS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFP2	FK506-binding protein	3	89-117, 230-258, 260-293	QEEEKPAKKSKGKSKKQQKKEQEEEEEES, LVQQDEQKNKNKNKNKKRKQDEKEDGDEE, APEQPKETKKTKKEEPKKDKKEKKVEFKKNLEEG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFX4	KLTH0D00704p	1	207-232	SLSPSIRQSNKKQPHQPRNEARKESP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG71	KLTH0D02882p	2	43-63, 289-313	DETPIKVRRRGGKAQSKPSSP, RDEFWAREGARRRKKVNETSPRKDE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHE9	KLTH0E03806p	4	1-28, 66-97, 1097-1129, 1246-1269	MGLFSKKRKGSTKKGNKHEAPKRAPSTS, THFGSVKRRRSSPSPKRPKRRPSEIVKSKIGN, VSNAGKIKKTPAKRSPRPRGKRQRTSEKAPIVD, LPEDHSKKSARKRLTIHKRQELEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHH8	KLTH0E04444p	2	213-238, 314-340	HENHLRMSKTNKKRAKFKPLYQNFTE, VKLRRQLSMEQKKKRANKKTAEKLEST
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIE3	KLTH0E11836p	1	11-42	ADRPAGKPPGKSRARRGPRRRGERGERGERSG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIJ6	Protein transport protein sec16	5	1-32, 1750-1771, 2177-2198, 2213-2232, 2345-2371	MGPDAKKRRNQKKKQRQKQKKAEAKNEHSEGA, ISSNRSKTKKSQRLERINRELL, AKETKAREAKAKENKEKKAQEE, RKENNEKKPIKAKLGHKNAF, VSAPGSQPGTKRKKKGARGYVNVMNNM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJM5	KLTH0F17644p	1	1-24	MAESGGRKKRGRPPLTKNYANPMD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKD8	Protein SOP4	1	243-265	KDDRLEKQKRKYADQKRVGEQAQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKN3	KLTH0F06094p	1	68-87	VTTKTLSKKRAKKIERNMRY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKS4	KLTH0F07106p	2	1-20, 494-523	MGERREKFRRVKSMRCDELS, MELNRRNKEKVARGKGRRSRMHSRENMDKE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL20	KLTH0F09306p	1	8-34	LGSNSEVPQRPRKLKRPGGRRSEPEQD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL90	KLTH0F10956p	1	44-71	AEDPRSAHSKKKLIRRLKRSKASETESD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMA5	KLTH0G07238p	1	652-676	EGEKIREAKRQMKRKDREMKQAVDN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMT8	KLTH0G11550p	2	88-107, 675-701	DFSNRPPKYKRAHIRFLPGF, KPVMPTPPPQEKEKKRSKFSKFLRSKS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E216	DNA ligase	1	553-572	HYEPSKRSRNWLKLKKDYLQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E310	Aspartyl-tRNA synthetase	1	73-104	GQPLSKKALKKLQKEQEKQRKKEEKARQLAEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E312	KLTH0H09438p	1	279-306	GTSQTSTFKSKKKKKKGKSQNTSSNAKV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCG6	KLTH0B02904p	1	57-81	KVSPPCRGICTKKKNHKNAAAAKPS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDG0	KLTH0C00704p	1	299-320	GASPPLPRQRRQRLRSPFDVDD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDI1	KLTH0C01166p	1	278-297	LVICTLQQDRKEKRRRNNSM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDR5	KLTH0C03190p	1	25-52	TDGLHLKRASWKKPHRRHKATRQLVTDE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE35	Methionine aminopeptidase 2	1	30-59	SPDAAVSSGDKKKKKKKKKTNNIKNIALLY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF12	KLTH0D11396p	2	36-58, 191-219	LMQKEQLKDEKRKNRRGEAKGEE, VQKEKDKLINRAKGRKKPILKLLQLSKKI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFB3	KLTH0D13706p	1	222-242	GQRSRSFTGHRKNMPKLKKSE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG18	KLTH0D01716p	1	9-34	EQKRDAEFIKRHKKVCKNPVDESNGV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGM7	KLTH0D06578p	1	659-688	ELERLDRDKDRDTRRKRRQGRFNRRGVGPG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH39	Autophagy-related protein 32	2	4-23, 328-358	YITNPRQQSRQLRRNSPSGQ, YETEVGSRKIRKRRKSSKKRSPQITVNRWVI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH78	Phospholipid scramblase	1	10-30	WYSPLPRVVRHRPVPRAGRTT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHT8	Pre-mRNA-splicing factor CWC26	1	4-35	NEYLRKNYGSNKAKKEKKQKSKPTSNSSLKIL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DID1	KLTH0E11572p	1	213-239	LQPPQNNKKKEAKKETKKEAKKPSAEK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIT9	Exocyst complex component EXO84	1	14-38	KQISSPTKTKTRSRSPANGKFKSNP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ38	KLTH0F13222p	1	1-54	MKVRKRSSKRTSTRMREGIKKKAAAQHRKERKLAKKDPTWKSNKKRDPGIPASF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ80	KLTH0F14212p	2	85-110, 277-301	LEDRLDRLLKKPKSRRSRRDEDDLEQ, AVLDSAKSKKSKKRRTEDDVSGKSA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJW9	KLTH0F19734p	1	983-1025	DEDAAAGKKKKRAKRAKKTDDAKQTPKQKKRRTKAVLEDEEDE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKA3	KLTH0F02992p	1	263-282	TSSRRARSRSPPRRENHRSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL64	Protein farnesyltransferase subunit beta	1	416-435	ILKCCQSKERPGLRDKPGKS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLH3	KLTH0G00726p	1	24-47	VQIGSSKKRSRSDHQSSSKRRIVD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM44	KLTH0G05874p	1	24-46	AKTTRGRGRRALRRAARRARSGS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM61	KLTH0G06248p	3	415-440, 478-497, 1103-1123	DDVWGSKKEKEEKKRRKDANNQQDIL, GSVKRKGSLKQRPTQKKNDD, ADEKNPKSYRNSIRNKFKSAS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN07	KLTH0G13200p	2	11-40, 73-96	VAGKGLACQSCRKRRRKCNLESPCSNCQKY, ALVADLKSKKNQKKTSTPNAPAPG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNS4	KLTH0G19426p	1	637-660	RLFSAKESLRRRERQNIQNENIKR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E217	KLTH0H01430p	1	137-165	ERLREERELKGRNRRPRRRKNSDSYDDDM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2B6	KLTH0H03630p	1	290-310	ELYFIGLKKKHKVDKLKVFSE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2C8	KLTH0H03894p	1	19-40	EAYKRGNQYKWTKARKADYEET
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E327	KLTH0H09768p	1	1-23	MGWVKSPIHKRAHQNKRYNTATM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E345	KLTH0H10296p	2	16-37, 132-155	DVLEKHISQQNKKPKNNQYGAL, FTLPLARTPSPRRKNNQPGFNDKL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCD3	DNA-directed RNA polymerase III subunit RPC9	1	36-58	ELAAGNNRKRKRRPYNHPELQAI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDE4	KLTH0C00352p	2	80-99, 513-533	TWSQKEERKVRWKNDWYVTF, FAKFYYIWRNKQKDNKWSTLS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDH4	KLTH0C01012p	3	15-39, 127-151, 241-265	RLSSSRCQRRSTKGACKYKLKSISR, IEPHPDPTKRHHKFRRWLNTPEKEF, SAPCARSKNRSGKRKHTILRKFRST
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEG1	KLTH0C08888p	1	54-83	SQKSANKVYTVKKSRRSRKQILAQEHEIKS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEQ7	DNA ligase	1	646-668	AHNYHRYKRKVHQVSPRRKRNVH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF38	KLTH0D11968p	1	175-201	VIKKTDLKCCYCKKNFKNRFSELKLHL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGW1	KLTH0D08734p	1	591-610	NAKQRKATSFSKPSRNSKSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHW8	Actin cytoskeleton-regulatory complex protein SLA1	2	359-379, 576-600	SKAPAKSKKASSKSSNRKQGK, SSSARDKERDRRRRLKEQEDREREL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ44	Altered inheritance of mitochondria protein 21	2	399-423, 509-528	DAPQVPQRPNKRPPPKKPSSKIAAF, APSGPQRRARGPKGRKLPAH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJB9	Crossover junction endonuclease MUS81	1	106-130	GESPESGSPKKKRRYVPKRRSGAYA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJM2	KLTH0F17578p	1	163-187	LLHAPKPNKKWYCCDKCRRQATKKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJN4	KLTH0F17842p	2	192-216, 513-538	RTEQIPSPPSKKRRKSSRRESLFHP, ITNKAPAKPSNKTKKLFKKPIVGDLG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJN9	KLTH0F17952p	1	174-199	IKQSWHPKRVLAREDRKKRKELWYRA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJQ6	Putative transferase CAF17, mitochondrial	1	397-421	LSPFSSSVIPRKQRRQRPAGSLLCF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK39	KLTH0F01540p	1	434-464	NACTYKSSAPPNDRKKRRNNKKLRIHLDQIA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK42	KLTH0F01606p	1	78-98	PDDSSKHKTLKQNIKPRHVLM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKW7	DNA topoisomerase	2	22-41, 526-550	SGGRCSRRDSPNKYIKNYDF, IEKIQQRDYIKKKKVNKQTYLIPTT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKZ1	KLTH0F08646p	3	84-105, 479-498, 674-697	NVISRINKKFKVHKLKEQIFAS, PGPIRRPRRMPRTKSANNVS, QEKGPEPAKPKPAYKKPKFTLDLY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL38	KLTH0F09702p	1	8-33	VKSKNPCSVCTKRKVKCDRLVPCSNC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLW2	Transcription elongation factor SPT5	1	181-203	DDDEAGPRKKQRRERNRFLDIEA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM71	Non-specific serine/threonine protein kinase	2	1497-1525, 1594-1617	LIKQQKYSAPSNKRKYKPLKVKKLGSELD, YIPNMATRAKKSNKKDKWVYEDSA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMU7	KLTH0G11748p	1	502-531	VPAKPAGGMKRKRRKLRNRIKKDLFRSRTN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN12	KLTH0G13310p	1	619-651	ELTQVRAKQRKDHLDRERRKKQKEGRAAKPSAP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN15	KLTH0G13376p	1	183-204	QSSHNFKRKAVRIKQRMWWQNV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN24	KLTH0G13574p	1	87-112	LARAKSKQGYKVLKRRREKGRWYLTH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E1X5	KLTH0H00418p	1	89-113	VKSYHPLPPKKLQKRLPVPDRPVDS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2R1	KLTH0H07018p	2	82-104, 934-955	FDIPGFKKVAKKRLKINEQDVDP, VYPCHPRYFKNSQNHSKCKLPC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2X7	KLTH0H08646p	1	509-560	KFAKMTKREKEALKKGKSRPERKQISTVPNVVKKKRRQREQMVEASKKRKEQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBC5	KLTH0A01408p	1	152-176	WWDQYSRYCIRRKRKWQDLLEKSGL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBF2	Nuclear pore protein	1	48-77	LSVNEIKKRAHDLRKKAKPKGDHTRAHYLL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBQ2	Isocitrate lyase	1	25-49	EIEKWWSQPRWKHTKRIYSAREIAA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCE3	KLTH0B02354p	1	230-254	REQELVQKKLEKKKKQERHEAAVIE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCT1	KLTH0B05588p	1	144-171	PSKNGIKGVIKKKKSKSNHEVPENRDHS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCT7	Adenylyl cyclase-associated protein	1	352-380	TPSARTPPPKPKKPTTLKTKKPARKELVG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCZ3	KLTH0B07018p	1	373-401	VEKKMAVKRNLSKKNTKNDAKGRTKDAKG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDF3	KLTH0C00550p	5	34-67, 99-118, 146-171, 198-226, 257-287	DCICDDRVIKRPNRKTKSRTKSKRRSLCKELLDE, TVSSSKKKSRREGWTNKIGD, DVTTESNKKKKVKRNRTRNGASKKAE, AEKDAAVKKGKNKKKKRKGQADDENKLKG, SSSKSGPPVHGKRSSRKKTKSASSSNNDQSC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEG2	Phosphatidate cytidylyltransferase	1	23-55	GEVSKVKSHGNQKRKNEKDTKDTKDTKKYNFFV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEP9	KLTH0C11066p	1	693-735	LEAPSNNVRRPKKRFDPYATLAAGPPSVKKRKKTKGLQKSFRG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEZ8	KLTH0D11088p	1	322-341	KKTGCTKSPRSRQLHSNRQN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF90	Cation-transporting ATPase	2	1286-1307, 1440-1471	FMSWSKPYHKLVKKRPSANLVS, RYIPQMCKGAFKKKQSSKKYKKLLKSESSAHV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFF4	KLTH0D14652p	3	202-225, 434-464, 563-588	GMPTRDAPPRPRAKRRRSELETPV, LERIRKERRLARGSRKRRTGRKKSRSTDAAA, SASNAKKTGRRRSKALSEQEQNKQIE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG21	KLTH0D01782p	1	125-144	DFMRTKRYTHPNNKTLRKTR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGS6	KLTH0D07898p	2	18-51, 104-127	QQDTGRPRIRVRKACGTCKRRKVKCNGQQPCAGC, SPWQRFSPGKYRFHRRHQNLVPYY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DII1	KLTH0E12694p	1	15-39	STIAEERQKRYTRWKKNSKLYYDYL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DII4	Mediator of RNA polymerase II transcription subunit 8	1	187-212	QDTYQRAPSSKKPKKPFDANNVLKMI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIK2	40S ribosomal protein S6	3	79-100, 178-201, 213-232	KGHSCYRPRREGERKRKSVRGA, LITPQRLQRKRQQRALKVKNAQAQ, AKRLHERKAEKAEVRKRRAS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIR6	DNA polymerase alpha subunit B	1	110-129	PKTPTLKKRRVDQTPTQSNI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIR7	KLTH0E14630p	1	860-883	VSGTPQKSEKSSRKKIKGVLSPLG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKE1	KLTH0F03916p	1	117-136	NDPAILRKWRYKQPPDPALR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKF7	KLTH0F04312p	1	118-140	QVNKAPKQRRRTFRAHGRINKYE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKH1	KLTH0F04620p	6	15-39, 69-99, 274-296, 308-333, 338-381, 384-406	QIEKEDKKEAVKKDRKSKELEKLND, EYQSQALSRKERRKLKKQQKKSHPTEDENND, ASDRKAREDARKQRQLKKFGKQV, KRETLEKIKSLKKKRKHNEIDDSAFD, EAATEKGYDKRQKPNGKRLAKDAKYGKGGMKRFKRKNDAQSSSD, GFSSNKMKGKPSRPGKSRRAKRF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKT1	KLTH0F07260p	1	64-84	LLPAAYKPSHNKKQPLNKMHG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKX9	KLTH0F08382p	1	633-655	ESNEKFDNKRFRSPNRGENPRID
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLC6	KLTH0F11880p	1	46-69	ESDLKREIKKLQKHRDQIKTWLSK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLD3	KLTH0F12034p	1	379-409	TKALPVPEDKPKKKRAGKRFRKYKEQFQLSH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLU9	KLTH0G03718p	2	14-36, 39-63	SQKYRRGYKACLNCRSRKTRCDL, PDSPRDPPCVRCKRERKECVFLENS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM37	KLTH0G05698p	2	401-423, 463-482	SGPSSSRNHRHMRKSQQRTYQSP, PLSTKKSKTRWHFGIRSRSY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E242	T-complex protein 1 subunit delta	1	5-24	ASTNSTFKNREKPQEVRKAN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2D0	Signal recognition particle subunit SRP72	1	523-550	RDTSLGKVAKKRRVHKNRKFPKDFDAER
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3C7	KLTH0H12254p	1	353-375	IESFVMKFARRRRQGKRVTVSAR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3P7	KLTH0H15334p	1	448-511	SEAEEKAEKKDKKKEKKDKKDKKRKREEDSEEKDAKKSKKDKKEKKEKKEKKEKKDKKSKKDKN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3R0	60S ribosomal protein L13	1	7-28	LPILKNHFRKHWQERVKVHFDQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBN6	KLTH0A04114p	1	25-49	IKGIKKLESLPWRRRRKLTVMLEEF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC42	KLTH0A07634p	1	66-87	ISKFYTRHSKKVKSIQIKIDAC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCB5	Translation machinery-associated protein 22	1	177-197	VEQMDMKKKKKPTTTTPTPAA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCI2	KLTH0B03278p	2	33-59, 679-739	TLHPETSTKTKSKKKKANNSNPNEDIH, IQALSKGKKTVNSKKRKRIEATEDRSRSYKKTQKDRGSDQQRTYAKQKAKKEMKKKKQARK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCY4	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial	1	420-442	DKELVTNEKRNRRTKPHTCYEAT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDC6	KLTH0B10142p	1	24-43	SLKHKRCITLDRPKINKVKL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE31	Mediator of RNA polymerase II transcription subunit 19	1	166-189	DGSGNTLKSRKRKNKSSGSSMATP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE97	3-deoxy-7-phosphoheptulonate synthase	1	1-21	MTDLQKKKFHRHIRRDAAVLL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEJ7	KLTH0C09834p	2	88-120, 253-284	GERELQQQERKKRKLSQKKKIPVVKKRPNIETA, RQFWEQQLSKRHKKKKKYTRRKKDKSTEAVSE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DET4	KLTH0D09592p	1	452-474	IVRGCKPQWKPYKTKRARDVIRI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF56	tRNA dimethylallyltransferase	2	282-301, 391-427	RMKVRTRQYAKKQVKWIKKM, GEKSWNIHLKSRRHRSNLSRIKKRENLELWKKKKAKE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFD5	KLTH0D14234p	1	11-34	KNGHKAFKSKHASKGARKNMYKGK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGF9	Protein SSH4	1	477-507	GAEEVRPLKPRSNKKKNRKKNRKRGAKRGFK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGG9	KLTH0D05236p	1	38-61	IRTSRQWVLPPRPKPGRKPSADPA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGZ4	KLTH0D09526p	1	97-116	KEPILPPRSAERRRNAKNLS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHE2	KLTH0E03652p	1	473-494	GIFNKSSKHRGHRNRRPSSNGN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHQ3	KLTH0E06182p	1	142-167	QLASEPKPVKKQKRRLRPRKALISLT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ67	KLTH0F13926p	1	278-313	EKELHRKRYPDYKYIPRKSRAGKRQRKDGCEFCKRG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL93	KLTH0F11044p	1	24-45	KYHFNCIRRWHYHSKNLQCPTC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLU3	KLTH0G03586p	1	588-612	LFSGKKRPASSIKQNENKKNSQSKS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMF0	DNA topoisomerase 2	4	317-345, 1172-1213, 1347-1373, 1387-1412	SDQIVKKITEHLKKKKKGKTIKAFQIKNH, IPDAASTKQKGKRKRAKADDDDYKPKPKKKAKTASAAKPKTE, VAKPKKPVTKATARKPSRKNQISDESD, ESTISQPPRKRAARAKPSKSYKETID
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMI4	KLTH0G09196p	2	1069-1094, 1181-1203	LEDAINRKRRSRERRQHSKELKDSEP, QPQTSAPKPKSKSKKVTTCEFTP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMI7	KLTH0G09262p	1	827-848	ANLFHILRRQQHRQFRKPLILF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN65	KLTH0G14520p	1	8-37	IAIVNDDKCKPKKCRQECKRSCPVVKTGKL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNA2	KLTH0G15334p	1	492-514	ALLKDAKRESKQQNKKNARLIAA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2R2	KLTH0H07040p	2	1037-1056, 1124-1150	SNIHPRFPPQHARQHPHTRV, GGKLHGAYAKKREDRKKLHDTIKNGTF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E397	KLTH0H11506p	1	90-111	GASGRRKVLLRRKKNNSSSSKM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3G1	Protein-tyrosine-phosphatase	1	359-384	VTLEEYRRQKRSKRSLKKLVEQNNSD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBC0	KLTH0A01298p	1	153-185	RWSAIRRKTSQQRLEGKKIKSDKKKLRRKVTDY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBL3	KLTH0A03542p	1	63-88	KSKIVIKMLKPVKKKKIKREISILTN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC86	KLTH0B00990p	1	6-27	EASAALRKRKNLKRGINFTLMV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCV9	KLTH0B06204p	1	336-361	GYGHPNPPNDKNRRHRNKYAQGQGMD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD56	KLTH0B08448p	1	262-285	SSSGKKRKSIFSFLKKKPRKNSSL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD90	KLTH0B09262p	1	11-38	AERAARACLNCRRRKVKCSGQSPCANCR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEG0	ATP-dependent RNA helicase DBP10	5	63-86, 390-410, 809-834, 893-915, 946-972	EEEARAKAAPQKKKKNAHEGGFPA, DAKAKAKKQRKSAIRKKLPSA, QNHKQVATTKWDKKRQKYVNTQGLDN, GGRFKHNKVRAPKLPDKHRDDYH, TQQIYKERVAKEKKRAKNARPAKKRKF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEQ9	Kinesin-like protein	1	202-222	GSTSGTKRRIRPNTMYKPSRS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGM8	KLTH0D06600p	2	13-37, 299-320	VHCIQITKRSRYKHKAPACCKRSEH, KSIYDYVKVKRKERRYLTQEQV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHA9	KLTH0E02794p	1	218-240	LALARRQKPWKFSKKSKMESDAF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHD5	KLTH0E03476p	3	67-91, 105-127, 188-212	VEDASASRRVRRRQSRRETIPEASC, ELECQMTNKKYKRQSPAIRELSA, EDEAENRRTKRKRPRVNLIVNIPKQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIP8	Vesicular-fusion protein SEC18	1	649-671	LQVLKVYLKRKPPKDRRLLLIST
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJJ6	Decapping nuclease	1	476-499	QTSNTKLVKSSTKPRKPRKAIVEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJZ1	KLTH0F00484p	2	105-126, 956-981	GPTNKPNYPKDKRRVSSNNSTV, ARKLNAPKKVAHQQSRKRGHKPAAGF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKG3	KLTH0F04444p	2	299-323, 375-399	GPLLDKCKQCCRRRRSENTTKVVSY, DYLLPNEKSRREKRRRNGTGGDLES
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL09	KLTH0F09042p	1	479-499	VYYALMWRRNRTRNQKYGELT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL35	KLTH0F09636p	1	110-133	VRIWFQNRRAKHRKTDRIAKPTAV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLZ4	Endopolyphosphatase	2	444-480, 547-571	SRMGKVGANKKKGKKDKKKKKKKKKHPKDTSVERYSI, LSSILRGSKKKKVDKTIPKRMPSNL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMI1	KLTH0G09130p	3	2003-2022, 2375-2402, 2448-2476	VDSLAKKKFRSKKDFVSQTV, FEGILRNPHRTKKKWQKQQHQQQQLLAQ, LREGTKNKGYQPKPKTQKHHYHIPHFSSR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMN3	KLTH0G10296p	1	386-426	DVDAVSKDQDEKRKRKHERRSKDKSKSKTKSSSKDHRYQPY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN89	KLTH0G15048p	1	113-132	ASHFLKRVNKREKYGSKKTL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNN0	KLTH0G18458p	2	66-86, 107-131	QIAGRRSRPRQRLTPNSRWLS, RKIGCWRRRAKICCRNNRRRARDSH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E1X8	KLTH0H00506p	1	93-113	QFETRKRSRGRGKNFCYNKNY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DB84	KLTH0A00484p	2	6-36, 41-65	KTACALCKAEKKCCDKKRPKCSHCTDENVAC, TLRWGGRPYKDKTKQIKIPKNTVLV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBP3	KLTH0A04268p	1	28-48	EAPKHPKTYRSVKYPYRNITF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC44	Nucleolar GTP-binding protein 2	1	1-23	MGTGKKEKQRRVRQNDTRDGNLR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCN9	ATPase expression protein 1, mitochondrial	2	23-44, 112-131	VIPKNPNKRTRDGSFRKFKRVA, LEPFRKMRRKSSPLKLIENH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDU2	KLTH0C03806p	1	503-525	IEDWWTRRRERSVRIKLDEKHQE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE42	KLTH0C06116p	1	1-25	MIRDPLSRKRTPRFFKKTPTIQFLK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DED8	Small nuclear ribonucleoprotein Sm D1	1	107-126	NRLRRTGKVTNDHNKKRRMD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEF4	KLTH0C08734p	1	641-661	GAKKGNKKTKKEAAAIKKRIE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEM1	KLTH0C10362p	1	3-25	GRQGGKLKPLKSKKKGPQELDPE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEP7	Palmitoyltransferase PFA4	1	73-98	IHQWKNYCKKCDNYKPERTHHCKTCK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEW6	KLTH0D10340p	2	11-37, 266-288	AYHSRFQTPFRRRREGKTDYYQRKRLV, AAESKKYRQTKLSKEERRARVAA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFY5	Eukaryotic translation initiation factor 3 subunit B	1	633-653	LLTNGEKKKVRKNLREWSAQF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG47	KLTH0D02354p	4	107-126, 210-232, 325-350, 456-485	LTRERLRRIHSQKSSRSWAW, QLEPSTRKRRKLLRADDPNRDPS, QEIQKQQEKKKSSRRGQQKKDGDKLL, YGSRRTRHSGRGRGRPKHKNVKFFKQKPKL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH90	KLTH0E02310p	1	494-514	LRSKLAAKRRRGENASRSRHE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHB7	KLTH0E02992p	2	989-1009, 1013-1033	ESFPSVKSDKREARRIQNLDQ, LVDSLLCSKRPRKQSRKTHNE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHB8	H/ACA ribonucleoprotein complex subunit	1	126-152	RFLPKPKVAGPPKPKKKRAPGAPGGRG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIE4	KLTH0E11858p	2	92-112, 124-149	DLKLWSPTRGRPPRREHAIFR, VDAARAIPREKPRHRRKPQSLSHALL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIG2	KLTH0E12276p	1	172-193	SDAVKPQRKRPVKKRVRLEYEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DII9	KLTH0E12870p	2	220-241, 341-364	MAAMAKRKRKIQAKTTTKKPVD, AKSVARIKGKSKKENNIRNRRALE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJA9	KLTH0F14938p	1	190-212	TGARAKAPARKRKPAEHGEDNKL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJK9	KLTH0F17270p	1	30-56	ASASRVSKKTGSKKKRKDKCFADKCGS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMQ1	KLTH0G10714p	1	1-25	MRAWTSKAARPKRARKRGLFVCLAL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN47	KLTH0G14102p	3	87-106, 108-128, 959-983	IYLFANKKLRRRVRMAGEYA, AIGHRSKRKVVRRAALSPKNV, DRLSCLSKYWKHRKKEDSRTMWDVK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E1Z6	Protein SDA1	1	676-730	SRGTEHSTTNREKQRKKNFVMMIHKRSVKGKQKMSLRDRQKVLRQHITKQKKRGF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2D2	Aurora kinase	1	339-362	EDSKEMTYKRIKRRDLKFPDHISS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2Z8	KLTH0H09130p	5	22-48, 573-597, 614-633, 644-666, 669-693	SRSLPDWIAKKRKRSLKHDLEYQNRVE, LAKQIAVTQRRKREKEKADKFMNQM, FDRKVAQLRREEQREKRQEP, EFSFVPSKKKPAGKKKVTFDSDG, AENKKDSGRSKPRFQGRRASKNVFR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC48	KLTH0A07766p	1	1-41	MRVTSKRSRGGCRNCKRSKIKCDERKPKCGHCIRKGKDDCT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCG7	Nucleolar complex-associated protein 3	2	1-22, 351-380	MGSKKRSQRVAEDKASKRRKEQ, FTKVKVKKKDRAHLSKKQRKVRKEMKKVEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCI8	KLTH0B03410p	1	402-422	PEISRISRHRHVPKVVKKAQE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCS9	RNA cytidine acetyltransferase	2	64-91, 1019-1038	LGFTSHRKKREAKIKKEIKRGTREVNEQ, GTVAVKSNKKRKTENAEDIF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCX0	KLTH0B06446p	1	2-32	VNVPKTRRTYCKGKQCRKHTQHKVTQYKAGK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCY7	KLTH0B06886p	2	45-68, 342-374	LNQTVPLSKKQKRLLRRGKVTLEE, PSTSAPPIRERKPVKKHREPSYKDKNNRLKSSV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDW6	KLTH0C04356p	1	454-476	VITAVMGKKPKRSKKQTTFKMRQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFT1	KLTH0D17688p	1	47-73	ERLSLAARAKSRRKGKKPDSPTPSRAT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG67	Glutamyl-tRNA synthetase	1	24-43	FTSKKSILSKKPVKDIQPKT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGW8	Chromatin modification-related protein	1	243-268	GSASADSKKRKRKTASREDYSQRPKT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH99	KLTH0E02530p	1	3284-3307	FEEYIKRLRYWRNRLENKLDRAPK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHN8	KLTH0E05852p	1	29-48	SCGGRDKRKGCERGARFRGR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DID4	Alkaline phosphatase	1	1-28	MEKASLMGKRPIKRRNKYRKLSHYAFAL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIQ1	KLTH0E14256p	1	977-996	VSRLPTRNQKHDKKLMWRLM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJR5	KLTH0F18524p	1	282-303	GSNFTQKPSRPERRPKDEPELD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK03	KLTH0F00748p	1	16-39	LAPGDCTPSRRGHRHKRSFAISQD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKT5	KLTH0F07348p	1	29-48	SYLERRLRTRHSSKKSDSLF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKX0	Ubiquinone biosynthesis protein COQ4, mitochondrial	1	302-327	PPDLRAIRRERAQQRKQFKLKYERHE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKZ9	KLTH0F08822p	2	1-24, 334-373	MTMNQKPERKLRPKTPVPANQDEL, EASSPVKKTPSKRRSSQPSPKKTRKRTKTHVRGHLDKTLS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLB9	KLTH0F11704p	1	266-290	RDEAAKKQKRHLRRLRTKLVNKGLS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLJ9	KLTH0G01298p	1	523-546	ASEGDKRPRRGSPRKVANQKSNLD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLM3	KLTH0G01826p	1	16-43	DMCGKGFHRLEHKRRHIRTHTGEKPHAC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMW8	KLTH0G12276p	1	767-788	ALKEWQKKKSGPHPGRPQPNSI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNN4	KLTH0G18546p	3	26-45, 185-208, 247-273	TEKELKKCYRKLMLRCHPDK, GSFERWTKNRKKYLRALQKKLAKE, ISRLESQAKSKNKRRKHAEPDDEEFEK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2M8	KLTH0H06248p	1	15-41	RGGFGGRNKGRQQRRGRRDQEEKGWTP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCZ5	KLTH0B07062p	1	79-101	KTAAKSSRKYRQYVNRKSKKLVQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDQ0	KLTH0C02794p	1	142-162	AQADPERKIKKPRNWSNRSEP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDS9	DNA helicase	1	764-789	DDNNERSPTKSPRKRQRVRNATAAAR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGE7	KLTH0D04708p	1	375-398	CYDSVIKFSRKNKKLRFNVKDFMD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH93	Exonuclease 1	1	81-107	DAIMVKKDTELKRKQKRAENKERALAL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHB2	KLTH0E02882p	1	42-61	SGSTKIVKKRRDKSVPEFVP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHS1	KLTH0E06666p	2	16-65, 122-146	LEDGKIYKIQHRRQRKILSCVPCHKRKIKCTREQPSCSKCLKRNWDCSYF, LLELNRKQKREYPRRKQAWETDQPV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHV0	KLTH0E07326p	2	805-834, 876-900	IPPSIKSSQHSPPKARKLRGRSPRVSSQSV, HVPTLSQSQNSQRQRKKKKRLGGFG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIE6	Very-long-chain 3-oxoacyl-CoA reductase	2	2-21, 340-359	AFPWHLSKKQRPTKAEEMSF, YTFHKSIRTRALRKAARQAK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIX5	KLTH0E15928p	1	269-292	LIMCHLHEQKKRNRGKNNPFSAAN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIX7	KLTH0E15972p	1	247-267	TKGYPKYETRRNKRANRAGTR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJB1	KLTH0F14982p	1	183-202	LKLIKRRSSRYQASARKRST
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJG0	Serine/threonine-protein kinase RIO1	1	486-540	EWLEKSKEIKGKKHEDKDSKKQRKTDAKEAKREKRKTKVKKHIKKKLIKKTKSKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJG3	KLTH0F16192p	2	46-78, 366-393	PSNQVAKRPNHNTTRAKRKRRKGKGPWASWSSS, AIYAFSMKPKYRRNPKKRFEGHKCAGYG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJP6	KLTH0F18106p	3	74-93, 165-194, 212-231	QEALREKRRKQDLRFKQQQE, SQEIKQQLQKQKKKTLRQLRKTSMKRGPVK, DTTVTNKREKWLKRKALARK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKB7	KLTH0F03300p	1	2-34	DDKGNSRKALRSCVRCRKNKIKCDLQEKRPGSC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKP0	KLTH0F06270p	1	391-414	LSIRISIKRAVRLRRKKSQASILG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLC9	Valyl-tRNA synthetase	1	98-122	AASKQAAAPKKEKKKKEVEPIPEFV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLY5	KLTH0G04510p	1	456-480	LPQGAIRRKYKRYSRTQIRNQNEDE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM34	KLTH0G05632p	1	721-741	GIVVGTPHKKKRSRFFGFVKP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMJ5	KLTH0G09460p	1	17-74	DEFQAKKSNKSEHKGKSRSEDVDGKKHKSKRRAENDTKSGNKRSKTERVEKTKSKEPE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN77	Ribosomal RNA-processing protein 8	3	16-48, 70-89, 246-268	VSYDSANAKKENKKKERKDRAKRANERRLEAIK, DEERKPPTPKAEKKAKIEDS, FAEANKKSKKHHKKNCVVHSFDL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNB0	KLTH0G15532p	1	381-416	EQDASSKRREHKAKAKGKGHCKGAKKMHAKQRMHNN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNG9	KLTH0G16940p	1	333-356	QLSPMYWIKNKKKQEISEREKDEL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNR6	KLTH0G19250p	1	680-703	LLLYRKPIFRGLKRQNSKIRDPTS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2M4	KLTH0H06160p	2	32-54, 520-544	SSDWSKMTSKRPSGKISKRQASS, DENLKFYKVFEPRRKRPQGVCDGES
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2P7	KLTH0H06688p	2	144-163, 468-487	NSKSTTKKPASKRNTESTKK, SVASPKKKSHPMKGRSLIGK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2Y1	KLTH0H08734p	1	397-421	NEVMLSKKTPDRRPKSRSKLQESIH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E358	KLTH0H10582p	1	259-278	SPEARKRRFRLRRSANAHGS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3J9	KLTH0H14190p	1	349-371	ISPKPNHIRIKLRPKSRRLFHIY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBC8	KLTH0A01474p	1	44-73	MQQYQRETGKKPSKRKLRKVSKVKMGHGGT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBJ0	KLTH0A03036p	1	1-24	MTERKEDARSRERQCQKKLQEAIS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBP0	KLTH0A04202p	1	2-21	AQRVTFRRRNPYNTRSNKIK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCL6	KLTH0B04070p	1	1171-1192	CYPVDKSTRKPIKDPNHPIIKR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD44	KLTH0B08162p	2	1-28, 73-114	MSGKKPRSQNQLYRRRKVQDARNIRTEA, SSTRVFQSLPRKLRRRTASHNVKRIPKRLRNRALREMQKSDQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDG3	KLTH0C00770p	1	302-323	IASIKKLKSYKQRKEQWKEVRE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE95	Ubiquitin carboxyl-terminal hydrolase	1	71-94	FLLKVSKIRKPEQKQPIEKKLKLE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEL3	KLTH0C10186p	1	137-157	EEYPERCKRTRKWFSFKEAKE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFA4	KLTH0D13508p	1	42-63	DWIWNDRCKKRWLKSDQGDPLA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFD4	KLTH0D14212p	3	19-40, 85-109, 368-392	DQQRYHMKTEWHRYNLKRRISQ, EVDLSKLQRRRNRKLREDNHERSVS, GGVTDKTMKKNDKKSQQIERQIMNR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFG7	KLTH0D14960p	1	1-20	MTESYKKRKVPSKEDGARSF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFH0	Ribose-phosphate diphosphokinase	1	89-110	IPQFPYSKQCKMKKHRGAITAR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFN6	KLTH0D16588p	1	1-23	MRAFKARHRSSRRKSGLSRQISS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGI1	KLTH0D05500p	2	531-559, 743-765	RPESIRQDKKIKPKSRTRPQQTINDKRAF, EEGDTKKKSSFGKKLKKIFGRKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH84	KLTH0E02134p	1	6-32	CTKTLKFKTSLARKVRHQRPNCKLGMQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHF8	KLTH0E04004p	1	48-67	GPPSIKRRSNRVKYSSPEKI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHY9	KLTH0E08272p	2	478-497, 688-711	NAAPRGRKRKQLKTEVNDNG, RSNSGRRTKASRPSKKPVKKLNAG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI63	KLTH0E10010p	1	410-437	KSSPEVPTQRRSKTKKLGHAPHRRKLIA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI98	Ribonucloprotein	1	29-54	SKKLNKKVLKTVKKASKAKNVKRGVK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIR1	KLTH0E14498p	2	151-172, 296-317	SDITRRIRRLRVRNQTPRENRS, IATQKKTIRKSQTMKNLRQESR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJZ3	KLTH0F00528p	1	15-35	DVSKGVIRKHQKIRTKLKVEQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKJ9	KLTH0F05346p	1	130-171	ADAEQQTPKKHKKDKKDKKDKKDKKEKKDKKDKKDKKHKHKA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKM4	Potassium transport protein	2	138-162, 401-429	DGIRDWSKKNFKVRRTKTLIQREMT, KLNTRIMKKLTPRNRLRKRLRKTASNTDE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLB5	KLTH0F11616p	1	19-38	QQISIPKRPLKKIRLGKARP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNG6	KLTH0G16830p	2	81-102, 225-244	PTPPNMSTKKTRSNKRCSLRSS, RFRAPGRKCREKPKEFSFRL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E224	KLTH0H01584p	1	410-439	RSQGDREFRHWCKRIKKWLKEDKMLRREEQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E233	KLTH0H01782p	4	20-45, 86-107, 742-765, 795-814	GQTNVKGSKKLKRKAKEYDRDERTKA, GEEQRKQVYEAKKKSKNRLGGL, NKMKAQLKKERKFTMKEIRKDTRF, EEGMEKGKYEREKKLRNSKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3T8	KLTH0H16236p	1	12-71	SIISCQQCRERKVRCSRHIPRCRSCDKREYVCRYPQTHRKTSTKLTKKRRSENTRFYGFS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC02	KLTH0A06754p	1	1-25	MATLVPPPSKKQKRQAQQPRQVDLI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD33	KLTH0B07920p	1	484-515	ATPSNPRPKVPNSSKPRPKKRRQSDLSPLSTG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF29	KLTH0D11770p	1	62-82	DQVKRFRAKFAPKKSKLLARR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG69	KLTH0D02838p	4	169-199, 214-238, 365-390, 446-473	KADRKNRELEEKKKKQEERKQQQWIKKQEKE, STDGAKKPVKRRSRKEDTTQQRSRS, AGGTAEPRKKRKYTKRKNVDTPVEPE, HNRKELEKYKEKRKKTLDKKAKPEKTAE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG84	KLTH0D03168p	2	135-157, 367-386	STRPNPKESSKKASKTRKVQSLT, LKKQQRNMRRWEKLERERHG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG94	KLTH0D03432p	1	116-147	LEKTKRPMRVREVTKRRNRKVRHAVSKPDLTV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGF4	KLTH0D04884p	1	179-202	RKIEEARVRERSKKERKTVVKTLD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGW4	KLTH0D08800p	3	10-44, 325-345, 587-607	APLLGQSKARKAKSKKSGSKKRKRKSAFKGSAASA, MKTGRLRPKKITPWHLRRKGS, EENEKYKRKSGDRRRPRGGEL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH92	KLTH0E02376p	1	163-182	GGPGCSKVFKPKRERTSHNV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI96	KLTH0E10758p	1	31-50	LKPLDKYPLKHSQPKPHSET
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIE7	KLTH0E11924p	1	239-258	LPDFKPKFPKWHPKDLQQVV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK86	KLTH0F02596p	1	36-55	RRNFRQQALKHHPDKNRQVS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2J2	KLTH0H05434p	1	1-45	MGRVASSKSRKQRHDPLLKDLDSAQGNLRKAPKKREDQKDEDDQE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E301	KLTH0H09196p	2	1-27, 69-101	MSSTDDTKGNKKRRSPNSGPDSPRPYI, DELTRHKRIHTNPHPKGKRGRKKKTETQSSGAD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E311	KLTH0H09416p	1	1501-1528	SKTDLGKKLEKKSRFMKNKKRPTKLVSL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3L4	KLTH0H14520p	1	354-378	AAPASTPQQSKKRKQQSLMSFFSKR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBJ1	KLTH0A03058p	1	212-232	AKKTSGAKGHYRKVREKRNKM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCH5	KLTH0B03124p	1	857-876	EAMRNHYRRARKAIPSPIKF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCM5	KLTH0B04312p	1	17-36	EYDSRSSYRRDTRGPRRFDR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD95	KLTH0B09372p	3	435-461, 822-844, 916-955	GTNIVFSKVKTRKRKRDKGKDVRELFA, VVNKTNKKVKSHRDDNKVLRIIR, QLAKLQKSQERRQARKLAKEKTKDGKVTKARNTNRRCATC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDA4	KLTH0B09570p	2	281-309, 334-365	DPRIKQFKEAEKKEKEKKKWEREAGARAE, AKVDKKKAKEAAKAAKKKNKRAVRNAPKDADY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE14	Protein kinase C	1	815-839	APQTGGRHKRKAPKRRKISLDDFVL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE22	KLTH0C05676p	1	48-74	PRKPHLPCKVFRTHRHHDTRIEWRRRS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEB4	KLTH0C07810p	1	15-43	KQPHIFTNPKTKANRRTKRWYKNVGLGFK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEI5	KLTH0C09504p	1	2-22	SSTYTLRQRRQQCAPNKGKAG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF09	Trimethylguanosine synthase	1	8-40	ELEHFVHLGKRKYRRERRALKKLFRTNEHRVEP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFH5	KLTH0D15136p	2	419-441, 445-465	SEACQTKKTTSPKRTSNRTCISC, DSPCWRPSWTNKKQDQLCNSC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG30	Mitochondrial DNA polymerase catalytic subunit	2	124-143, 1112-1131	TNIPPRPKTWLRKSGWVRYA, KVQRCTSAVAKRKRLRKSVF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGB6	Phosphatidylethanolamine N-methyltransferase	1	1-22	MIKERKPSKSRAPGKGHKQIPG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH97	RING-type E3 ubiquitin transferase	2	1-27, 600-619	MSTQPQQKRNFRRTQGAQSKPKKDLGK, ASPIHVKKGKQKQLLFHIGI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHR6	40S ribosomal protein S26	2	1-26, 83-111	MPKKRASNGRNKKGRGHVKPVRCVNC, IVRVRSRVDRRVRTPPQRQRFNRENRVSP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIQ8	KLTH0E14432p	1	393-424	TYYMMQSRLRRERRAKAKVKRDEERRSRGSRG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ64	KLTH0F13860p	1	306-333	QSFSNRWRSNLHRNVKKKYSRRLIIIRA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ97	KLTH0F14674p	1	795-816	RDLRNKTKLKAVRKQERQLSKG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJT5	KLTH0F18986p	3	276-301, 408-441, 505-540	ATLRRSTSNSRRRKRDEEKREKTAEK, EEGPARKKSRRELKEEKRSKKKDKKKVSEMVETA, FAPYRAKELRAKDRRKVTKSRRMREWKKKVFGSEEG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJZ9	KLTH0F00660p	1	7-26	APKNSIEHSRKRKSNASLKA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK14	KLTH0F00990p	1	35-67	RSYNRSETEAARKPRKKRKTYSCEVCRKFKTRC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK76	KLTH0F02376p	2	1332-1351, 1905-1926	FDRYPRPSKKLKQLHWEKID, AQHQRLSKLRARRKNDSSSSGS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLD0	Multiple RNA-binding domain-containing protein 1	2	97-117, 119-141	PQPMREKRREALKRLREREDQ, LEEKTAKKLQKQKRDSSKPGIDA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLP7	KLTH0G02442p	1	76-98	GRVNLLRYKKWQQSKPQRVSDAA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMN5	Histone deacetylase	1	657-681	WGNDGNENKKPRKKFGRVLKCDSDG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMS7	KLTH0G11308p	2	79-106, 498-518	EPGSRVRTKPFGERKRRNSSPKWPVNSQ, ETPALRRERRRSEFRVRRYST
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN35	KLTH0G13816p	2	491-516, 570-600	TTAELQSPAKRPKHRNRRIEGAKLSK, DDFGKKSMGHFRKKRTFQKKKAFVQWVERIS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNM0	Eukaryotic translation initiation factor 2A	1	522-552	GVAKESKAAAKNKKKRESKKKETTPDATQPD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNQ0	KLTH0G18898p	1	67-87	SQRSALIKCLHRRKAHKDVVL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2B0	KLTH0H03498p	2	215-239, 594-622	SSNYLKKVNTKHSQKYKRQRQSMGG, EVYGNKWRLKKNVKTFARRKRLYKFIING
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E356	KLTH0H10538p	2	560-587, 645-675	QRQKLLRHLRVHTRYKPCKCPHCAKTFS, SSNLSKHMRTHERKYKCGKCKRSFDLQEQLE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCF8	AP complex subunit beta	1	20-43	QQTNIKKHRASATKRKDALRKIIA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCG8	U3 small nucleolar ribonucleoprotein protein MPP10	1	530-562	DELSKDDKNRLRRALKRKRSKRLENQSGLSQKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCR8	Histone-lysine N-methyltransferase, H3 lysine-4 specific	2	10-43, 752-771	DSPYQRYSRGHNGRRAGRRHGGRPPKRESHQYGY, PDKLKNCYLPHRRKLHQPLN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCT0	KLTH0B05544p	2	53-80, 597-619	GSERSAQQRRTGKRRKAHGRMRNFVYNQ, IRETTKQLRPLRERKLNNKPASM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD68	KLTH0B08734p	1	32-53	AKPVCERSPKRRESFKVTKSKR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DET6	KLTH0D09636p	1	346-371	EFFAMGTKSKKNKKKQGSSSQSPASS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEV4	KLTH0D10054p	1	407-429	DLQKANKKQQRKLLKRRRQDFSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG72	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit	2	15-36, 614-633	GSSSSGQKKKDKEEAKKTSSGT, TSVKETQRRKVEREENWHRL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGX8	KLTH0D09130p	1	329-354	FNSLKLKHTGKKLVNKFKFRRSSSGS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH27	KLTH0E00858p	1	301-324	YVCPIPTVVIRRKLKRSKKKGFEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHD0	KLTH0E03344p	1	1-23	MRNQSKCHSLKIKKGRLNQTIID
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHK1	KLTH0E04950p	1	122-146	NPLQVIRNRKIKKKLHENPKNEIAF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ60	KLTH0F13772p	1	385-405	RAERLRKKKELEQEDRRRRLT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJW8	KLTH0F19712p	2	158-177, 427-460	KVYKCRKNKLWGYERKKGPR, NRAAWTKEMKSKKRDAIRQLKRKNFKAKGNGILI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK56	KLTH0F01936p	1	79-100	FEAEKERERKTQTQKQKELELQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLB7	Diadenosine tetraphosphate synthetase	1	137-163	ANAQEDADKKKRKKKVKEIKAVKLDDN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLM6	Clathrin heavy chain	1	135-155	GDTSRKPSKLTQRHANLNNAQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLN9	KLTH0G02266p	1	493-512	NQYIKITRRRKPTPEDRLLG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLQ4	Pre-mRNA-splicing factor SPP2	1	9-34	KAGKVSKKTASSEKKKKRANIFNDAD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN17	tRNA (guanine(26)-N(2))-dimethyltransferase	1	69-88	QAKQEKSRGKGKKRGLEHGE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNH8	Calcium-transporting ATPase	1	916-938	IADELRKLYYRKKRANDSYYYSA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2G2	KLTH0H04686p	1	672-694	AQTPPITPRPRTKQPSKPLVLTK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2N1	KLTH0H06314p	1	393-414	SMIMKHRKSISSKNRKVPHVFD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2Q5	KLTH0H06864p	1	44-64	ISQAKRPKHSGRAVRERERDV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E304	Uricase	1	12-34	GKDNVKFLKVKKDKTNPKVHEIM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E332	KLTH0H09900p	1	301-324	APSDCWKVSKPVKNGKSKPSKVHA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E353	Mitochondrial import inner membrane translocase subunit TIM54	1	56-76	IVYDKQQQKKIVKKWCKTVEP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E367	KLTH0H10780p	1	295-314	YMLICKFQIRQWRKSCQKKN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3B0	KLTH0H11858p	2	464-488, 539-562	NVHSLASKKKKRYAKHNFKRDSSLL, QLRLNSSTIIKRRKNKDEVTVPAT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBQ1	KLTH0A04444p	1	84-111	VTAAVQSVRRNRKRSSKSKPSNPQAQES
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC32	KLTH0A07414p	2	11-32, 107-131	GFPFTWPKRHSRGIKLSQRYYG, ELTQGSPRKRYRKENIKLSKNQPPS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCE7	Phosphatidylserine decarboxylase proenzyme 2	2	1-21, 342-371	MGIIRRRSRRARLTLRVHAIQ, KESRYVRMIQTRKRRPRRPRKGNASAKFEL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCM9	KLTH0B04400p	1	385-414	NQRRRVLGKFKDFKKYKKINNRPYSELPTH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD69	KLTH0B08756p	2	78-105, 1002-1023	GGAPALKRRTIQQRKERRQGRRDNAVST, IKLGKRIKNASGKLKMKKQRTE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE33	KLTH0C05918p	1	2-32	AASLPHPKIVKKHTKKFKRHHSDRYKRVSEN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE70	KLTH0C06776p	2	28-48, 97-116	GGSARETKRKNVKSEELRLPN, VTSCTHCRQHKIKCNASDNF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEW7	KLTH0D10362p	2	71-97, 210-237	LGAALRCWERKRQRKRNERARRADGDS, GETHRREAPARRVRRERRMERAARQSGR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFL6	DNA-(apurinic or apyrimidinic site) lyase	1	364-386	IEYSDTGRPKRKTTKRVEYRFKG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFY2	Mitochondrial Rho GTPase	1	420-446	ARLALQITKSRKKRRRNGKFYRALVTD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFZ0	RNA-binding protein VTS1	1	255-277	SSGKPVQKKSPTQPKPNPHNGLS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGF1	KLTH0D04818p	1	7-38	ASKFKFGRSKEEKEKEKEREKNKDKEKHGLFH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGL8	Poly(A) polymerase	1	521-557	VEGEERPVKHSKRKKLGKDSKKSKRPKSNSLKAEEPT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHL7	KLTH0E05390p	1	315-334	LISEQLKKEKARRMQRFSVF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHP8	KLTH0E06072p	1	1-20	MPPRKRRTHNLKGLRGSQDQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHV6	KLTH0E07480p	1	293-314	ESSSKPKSKRPLRQINAPKKPL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHX3	KLTH0E07854p	1	7-42	LASGVIKKKRSKVSRACNNCRRRKIKCTGANPCLNC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI02	KLTH0E08602p	1	377-399	TEDSFSKYTRRRRWIRTAELLRG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIV4	Phospholipase	2	114-133, 1211-1233	QAFRRFSKLTSRKNGRGEHA, GRDGWKKVSKKFKQNVTEKLRAW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ00	KLTH0E16500p	2	21-46, 135-167	TGCWTCRSRKVKCDLGKPTCQRCDKS, FRGTDKVKTKHVPRRKKRRKQDQQSRSPKIRSE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK01	AdoMet-dependent rRNA methyltransferase SPB1	4	231-250, 357-383, 763-788, 811-830	AKIFNPEKKVRKRQGYEEGD, LQEKQRLSQKREKRKKNEMKQKELTRM, DEIAKLMRKVTKKQKQKPKVTLVVAT, VLKNEQRALKRIAKKHHKKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKB8	KLTH0F03322p	1	187-206	KLLRSSTKKGIKRQNAFNCP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKR1	KLTH0F06776p	1	576-595	EEESRRTSRRSQRRMAPLGE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKY3	KLTH0F08470p	1	5-24	GRNKIPCKYFQQGRCKKGNS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM09	KLTH0G05038p	1	220-246	KFEARALPREHKKKPKQEKHKRSSILW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNB6	KLTH0G15664p	1	251-279	GVLTRDYRHVERKKPGKKKARKMPTWVKR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2A1	KLTH0H03278p	1	578-599	MDEYMQERRRKRKTMPSSPTSM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2Q0	Genetic interactor of prohibitin 7, mitochondrial	1	23-43	SQSRSPPRSLLQRQAKRRGEA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2X3	KLTH0H08492p	1	309-333	NDLTSMVKKRKSKPEKDTASKKQKN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E337	KLTH0H10032p	1	458-498	ISSISAKRKQQQQQQQQQQQQQHFFRQQRQQQRQPPPAPND
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDH9	KLTH0C01122p	1	27-46	VERSLQMQKHKEKKEIKLLL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDS8	KLTH0C03498p	2	35-54, 118-140	APKPKSQHLGAKKRNWCWNW, VQSFYKSIKRRRKPAANKTQPAP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDX5	KLTH0C04554p	1	212-231	VYEGHYRKCKRREDLEEWFL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE43	KLTH0C06138p	1	1-24	MKSFANKSKSRRPKFLFNLKINEL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEB7	KLTH0C07876p	1	20-48	VKRQEEKQAGSKRKQFRKWLHSLKEHAPS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DED6	KLTH0C08338p	1	133-157	ILEVKGRKYMKKLEKRKEEKRPRWF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFS0	KLTH0D17424p	2	1383-1403, 1607-1631	LIAMDKMKWHHRPRYRIARIL, NGLVKGKASTNRKRVSKKDAFDKIS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG81	KLTH0D03102p	3	143-164, 219-260, 730-751	RESKHNSRKSDHSEQRPKRSWP, LCSNCHPRKLDVKRAKRKQQERLNPRNNKKRRKSSQGEESSG, NSRHTLKKKLSFADYKKKMKPI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG95	KLTH0D03454p	1	1097-1116	SDARRNSKTRSLGRKNTKMW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGF7	KLTH0D04950p	1	606-626	MRQQHRKSLLHTKKQHQREND
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGH3	DNA replication regulator SLD2	3	44-69, 283-305, 338-381	KLELKRFEKQFQRKYKRLPARDDVRA, EAMLIKKPKRKHILRPAKNALAA, ASDAKASNPKTRRGNRKYNLVSNNFRRLKLPKAKGKGGKRWGRR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGI7	U3 small nucleolar RNA-associated protein 11	3	2-24, 187-211, 221-243	AKLVHNVQKKQHRERSQVASRSR, PETLERKRLKKLRQLQQHQDRERQL, EREGMKKGSKKKIRDAHGNTAFK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGJ1	KLTH0D05720p	1	240-263	APAAIPQKIRSKKKAKSNALGVIV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHP2	KLTH0E05940p	1	428-449	LGFILWYRRRRRNEEDFEKRYN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKA8	KLTH0F03102p	1	28-47	KGVRVPKRTKFELYRNKKSA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKU3	KLTH0F07568p	2	282-304, 317-358	NELPHEPRKRGRPKKQRIVGEGD, EKEVVVKRKRGRPKKIIDESSAEIKPKRPRGRPKKDAPIPIT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLA6	KLTH0F11418p	1	222-244	GTLLCRVKKRLGRKTWKRVNAVL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLF1	KLTH0F12562p	1	2-22	VELRRSTRKKSSDAPKRAPEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLK7	KLTH0G01474p	2	16-49, 312-334	AAGKNKSSQLQKPEKKQTRSTRKNRTRQEASAAE, GASGSKKPSKKTRTSGKLGRGGY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM04	KLTH0G04928p	3	97-136, 145-165, 636-657	DENARPRKRKIEEESTGRKKSGKKSKKRASAEPARAKKQE, LVNKLRSKSPSKKSPLKPLAI, KTVTFKLRSHFKRQQRTEALTQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNG0	KLTH0G16654p	1	10-33	YIDTSSRKVSKKRSCRALLRTMAS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E214	KLTH0H01364p	1	63-97	ADSVMRKRRLKMKKHKLRKRRKRQKAEKRKQSQGK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E236	KLTH0H01848p	1	450-477	SITKRLQPPPPPPARKHPHRLGSGQKIA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2J8	KLTH0H05566p	2	21-40, 81-104	DPESNKKRYLIKGQQKSEFD, NPSGRKGSKGSSHQDKRRRKTETE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E317	tRNA ligase	1	19-44	ATLLPKRGRSYKHKCQIKNTNKEVFS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3T1	KLTH0H16082p	1	1-20	MKIVKQSRVTRKFKGPRGLD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBE8	KLTH0A02024p	1	42-68	DLPKGKYPAKKHALKIKKNFLSKKGEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBW7	KLTH0A05918p	1	143-162	DLNRKQQLLKRKPAQNGEKE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBX3	Biotin carboxylase	2	437-456, 2112-2132	FSSKDSKQIQRKPTPKGHCT, WPEARRFFFWRLRRRLNEEYL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDN4	KLTH0C02420p	1	135-160	QDSGNEKKGHRNRNSRNGRRGSKFSK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDQ7	KLTH0C02970p	1	444-463	RDEPDPAQRRQRPPPPAPGK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDR9	KLTH0C03278p	1	10-37	DSVGSTPHRKQNHPNKRKPFSKMQLLGS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DES0	KLTH0C11594p	1	291-316	YEDKASEPAKKKRKKSSEERHQQIKF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEV8	KLTH0D10164p	1	441-469	GDLERDEKSKQRFKNKTKKQAPTKTIGNV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF97	KLTH0D13354p	1	1-30	MPQKALKVTKKTKDPRRVTKKQKNLRAAAP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFK6	KLTH0D15884p	1	374-393	GPLSTRQSPRRPYKERGGTL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG32	KLTH0D02024p	1	225-254	SLLLTGQKKKRMRRRITNDHKRSKRVRFTD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGP7	KLTH0D07040p	2	31-64, 216-243	DYNLKKRRIIPSEDARPRKNRPVGRPPGRPPGRP, IATPKDIYRTKRQYRKRSAEPRARHFPT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHQ5	KLTH0E06226p	1	643-662	GINYKKKLDEYKKRGNYPTF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI28	KLTH0E09218p	3	15-38, 75-101, 219-243	GQMAKLKELKRVRNKQFLRHLDDG, LFKPQESKISRIKKKRLDKFIEHQLKR, VKVVNKAKPASKKRYNWRQRLEIED
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ45	KLTH0F13398p	1	17-41	AKSIDIKKAYRKKSVQEHPDKNPND
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJG2	KLTH0F16148p	5	21-64, 454-504, 537-559, 594-621, 627-646	ENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLKG, EETTLEKVRRKEKERKKMRKERIKELKKQAEDDKKQKLKEARRKPEPSATD, IVRSEKEKGKKAKFQDKNRIVED, MKQILQERNKRSQKGKNKKREANGDIAE, DLKGLVNKLKHSSKNKRQRR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJJ5	KLTH0F16918p	1	209-232	EDERHARERRIRKRQQEYERRMAQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJV7	KLTH0F19470p	1	36-62	EDDEEKPAPKPKSRRPKETPFTQQRIA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJV9	tRNA wybutosine-synthesizing protein 4	1	15-34	LTPRQARQAEKLERRKKYAD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK32	KLTH0F01386p	1	300-319	KQDQEKIKEMKSKRKFNPYA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKM6	KLTH0F05940p	1	37-61	QGLARKNKGGSRPWKHRRNIAVIVC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKY5	Protein acetyllysine N-acetyltransferase	1	49-75	FPELKKLSSKARKPPLRYRPEKNTVFD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKZ5	KLTH0F08734p	1	73-106	LRGGGKKRKKKVYTTPKKIKHKHKKVKLAVLNYF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL76	Altered inheritance of mitochondria protein 3	2	32-53, 710-738	KTGYKAGKQHYNSSKNKREGNS, ASAHLTEKGKKRPPKPAKKQSLMEQPNKT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLK5	KLTH0G01430p	2	102-127, 146-166	AKDLRPDKRIKCKNMRKAPPSSRHCS, ILQFSRPRKNVVRRVPRAHGG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMG8	KLTH0G08800p	1	175-200	LDKVCKWSRYSKRAQKRPQRTPSARS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNB8	KLTH0G15708p	1	1-20	MMRGWRRAPRRISRGKAFGE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNR9	KLTH0G19316p	1	426-453	YVNTGLQKARRTRKTRWTKYWQYKAGVP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2B2	KLTH0H03542p	1	63-88	LSKGKELLRGPKKNKQTSKSEVRSSF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2D1	KLTH0H03960p	2	43-63, 534-555	LVSTIKKSPANRNKKDEPSSQ, IDKKTKSWAKAVPKIVRNNKTL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DB90	DNA-directed RNA polymerase III subunit RPC3	1	211-231	LSDLKKRTEAKQKAKKQFYQL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBH2	KLTH0A02618p	3	1-23, 357-376, 449-473	MPNLETKTGSKRKRTENYFAPTH, QTEVREKRQKKRELVPKLTN, RGYQGVRRWMKKKKVQVEKLSKIFV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBS1	KLTH0A04906p	1	39-62	HEVLRKSRSQLKRIEERRRLDLKN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD57	KLTH0B08470p	1	397-419	SGSALPQQHKKEQQKPKPLGASA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDB6	1,3-beta-D-glucan-UDP glucosyltransferase	3	96-120, 462-482, 1667-1695	FQNLKLHGKARKRNLKHAKERGVSI, FESYLFKGRKKRRYTSSQTFT, LISNKLAYTKKQKLRRRRIVQKYLPIHCL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDY0	Altered inheritance of mitochondria protein 39, mitochondrial	1	69-88	EASIKNQRRRRGKQVSSALA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE39	Serine/threonine-protein kinase Tel1	2	17-37, 404-424	FSFPSRQYPSLKQNRRHVTLF, QMVRTYFTKRGKQKPEESLLF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE99	KLTH0C07458p	2	99-119, 155-176	VEARLARKRVHKKLDVEKASS, GDITRRNKRQRLEMQNERKSYA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DER7	KLTH0C11528p	1	1-46	MAKKNKKDKEAKKARAELKNKKNLEKAEVKDKKRSKKLNSEDDDDL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEZ6	KLTH0D11044p	1	698-728	WLSKRGRSPVGRRGRPPKRNISRKLMNHSSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGD2	KLTH0D04356p	1	439-469	FDGWHEFEAKRHRRKEREEQKRREKSESQGS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGG6	ATPase synthesis protein 25, mitochondrial	1	11-30	QSDKNTKHTRVRNMLLRRAA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGH6	KLTH0D05390p	1	79-108	SFPKVHRLPAQPRRGRPPKRKNVADNNLTA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGN9	KLTH0D06842p	1	388-439	YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHP3	KLTH0E05962p	1	119-165	KPFACSTCTKKFKRPQDLKKHLKVHLEDESVIRRRRGPKPSLKKVYK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIC3	KLTH0E11396p	1	80-99	GTYGKVYKAKRKLQNPSSST
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DID5	KLTH0E11660p	1	201-220	AEWILVRLRRNKANKPPQYK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIE0	KLTH0E11770p	1	616-638	VMRNQKEQQRRHQEKLKRKSNLE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIR3	KLTH0E14542p	1	47-70	EDIRSRSLFKRRKNETQQERMVRG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIS1	KLTH0E14718p	1	25-46	EYAPRFKHVSKKQKGRVPVRVG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ33	Nucleolar protein 16	1	1-31	MASVRRRKMAKSSVKKATRKLKNSARKVNIT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJN6	KLTH0F17886p	2	17-38, 288-310	EDEKRSIDRRAQDNRKPSKKYM, IQKGNRQLKKAQRRSGKSAKLIV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJR8	KLTH0F18590p	1	186-208	GKATLKQSKAGAKQKKKKKCVLL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL13	KLTH0F09130p	1	20-42	QQDRSNARRRPHHSNYVRPRTRG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLT6	KLTH0G03344p	2	39-60, 194-233	YLTGFHKRKLERQKKAQDFIKE, KYAKFLGMDEKPKKKKKFRYLSKAERRQNQKKANDNKRRK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLX8	KLTH0G04356p	1	206-238	DANTAKKNPEPEQKQKKRRLTKKRIQRVDSDGE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMS5	KLTH0G11264p	1	190-211	AEPTKVKNVKSKQLKSKQYLDF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN59	Phospholipid-transporting ATPase	2	61-82, 138-172	RGGSIMRKQGQKKRTANRIMFA, LKRMRWGTKRTKKGTPSVGRAKTLRWAKKNFHNPF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNR3	KLTH0G19184p	3	8-27, 114-136, 531-551	RPFCRRIASCRPLYKNVPKF, DDAIEQIKRRKERKRALDFPVIP, QLGNGKKIKTCKPTNIPKLLE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2L5	Ribosome biogenesis protein NSA1	2	108-130, 402-428	ARLLSIHKSSKKRSRPRDGFVAL, IDVPQLNENKKRRPKHKDDKAEAEDDE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2Y0	KLTH0H08712p	1	100-183	KQEQKLQKELKKEQERKDKELKKEQERREKEQRKLEEKKRKEEEKKERERRREEEKRSRELKREQEKREREVRREEEKRRKLVE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3B9	H/ACA ribonucleoprotein complex subunit CBF5	1	433-479	DEDKEESGKKEKKDKKDKKEKKEKKEKKEKKDKKRKAEGEESADKKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3G3	KLTH0H13310p	1	560-584	SVSSTHYRPAYKKRLPRQNMPPASM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBG1	KLTH0A02332p	1	243-266	CTDCDKSCPKLKPLRRNHCKVAGL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCR9	KLTH0B05302p	1	81-101	LDNKSIKRSNRGNRTIKNSLP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDF6	KLTH0C00616p	1	379-407	LKSIMLGTNKKKSKKSRSKKNKKVKVQLE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDK9	KLTH0C01826p	1	515-539	LVDDAFKRRRLTRKVLRYASPARKP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE06	KLTH0C05280p	1	310-338	LTKKQGKVTKRAPSSKDKKRNRRVKDIEL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE60	KLTH0C06512p	1	70-90	SGSRPSPQRRQQNEQRHRERE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEE0	KLTH0C08426p	5	9-36, 38-64, 244-273, 295-320, 333-391	AEQNLKKHQGRKQAGKGHQTPKKPKPEA, GLNTSTNSKSKKKYRKSKDAAVRSSAQ, GQVAKETTKAKKKKKKKKNKAATEGTEVKK, AAGRRELQRRERIKKKSEIKEKKAAA, KAASVKAKGKAAKKNKNKRPNSKNKKKNEAKDKTADASSDKSVPKTKPKPKPQKKESNE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEY3	KLTH0D10714p	2	132-151, 814-840	FYKYIQKKRRLKESAACRLF, QRSASLKKAAKPTQTRKKVNRSSVMVS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF10	Altered inheritance of mitochondria protein 44	1	259-282	VRKKLFTYKAKRLAKKNKKQTTSH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGF8	KLTH0D04972p	1	113-132	IQQAKPSKPASGKKKKNKKR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGG3	KLTH0D05104p	1	364-393	RNEQLAKFDKKKTKATKVSKKRANNGTDIS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGK1	KLTH0D05984p	1	364-386	NYGTSGKPRGRPRKSKTTNSASS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGY0	Phosphoinositide 5-phosphatase	1	1084-1107	APINKPSRIPPPRPAKKPTLDNLN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH88	KLTH0E02222p	1	186-205	AQNRNAQKAFRQRRERYIKD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHF2	KLTH0E03872p	1	634-659	SQDLPLNTRKRPRKHKIDENTVTDKS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHJ9	Tethering factor for nuclear proteasome STS1	1	23-42	ISTCKVTKPRVKRRFAGEEA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHS6	KLTH0E06776p	1	1094-1122	YEGKRETKYDSKTRPGRKPTQNRGLEGRY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIZ9	KLTH0E16478p	1	133-158	LPQDNEKSRKQKEPARKKKKKGNAGD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK82	KLTH0F02508p	1	114-148	IREANNFKVKRKNKAKKKKESVGKAPKRNVRERVL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKC5	KLTH0F03498p	2	291-310, 378-397	ATVKAKKKNKMKIRAAGETR, QNIKRLSKAPPTQAAKKQKF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKK0	Transcription initiation factor IIE subunit beta	1	234-263	ATVKRGSSRVEVKKRKQRKGKITNTHMAGI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKU4	KLTH0F07590p	1	356-382	VKFGTKCSKKFVPKDVSKKVRRAAKPF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLL1	Mitochondrial distribution and morphology protein 34	1	376-402	GTAIRRRKIKMGKKSKSKKAQSQDIEN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMF7	KLTH0G08514p	1	778-803	INNAEVKTPERKRSLKRLVSLPNKSG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMR0	Ubiquitin carboxyl-terminal hydrolase	1	152-186	ESEKKLSESKTKPKKKVYGKRKKRLTRNAEKDALD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNL2	KLTH0G17952p	4	39-118, 255-276, 307-332, 980-1004	GDDRFATKKRKQSSQIGRKEKRKQQRMAKKQTRQGHKQESERKGQGHESKGHAKVKNNKNAKKPSKLTEKKRQAAPAKAA, AALKRAKEKKLQQKHAAKADRR, TMEALKQAKEKKRKQSKGHASKDSKD, LLSIGKKCEKKTKKGSQRIYTYEDG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNL6	KLTH0G18150p	2	158-184, 1483-1509	LKMQEGEQSTRPRKKRRFTPAPAGFTR, VLEEREASRKQKRTQNFKDRTFKAKSI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNN5	KLTH0G18568p	1	9-53	PVDFKSTLPPRKRAKTKEEKEQRRIERILRNRRAAHQSREKKRLH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2B3	KLTH0H03564p	1	678-700	LAEKLKRKLSFKRTKSTKSTSSR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E354	KLTH0H10494p	1	34-57	ASSLQFRSPKQCRERYHQNLKPSL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC07	KLTH0A06864p	1	89-110	LRGPSSSKLKKIKEKRFKIALS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCH1	KLTH0B03014p	1	224-243	SNPHLLKTYKNRKKDQNFLF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCT8	KLTH0B05742p	1	77-97	AAKRTDAKKKPMKPRQGLKTT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCU9	KLTH0B05984p	3	293-322, 613-636, 673-694	FRELPTYRTVPRRRRRRRRKRTNALTSSGG, SCEVKWHPPRKEMSRRRYIRDSLR, LGGGKPGKSKAPKFRNFKTDKG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD49	KLTH0B08294p	2	20-45, 540-562	RNSGGKPKGAAKKSHKRVNNANHTPV, QDKFSTRKAKKASKKLAKQDYIS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDI9	KLTH0C01342p	1	214-240	QYVAPKKESKKETKKETKKPAAEKPKA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDU1	KLTH0C03784p	2	717-742, 929-957	VANKNSKYFKKVKKASYNIRLRKQQK, YNDIRSQDSKKPLHPRRRKSKAIPGSDVM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFW9	KLTH0D00594p	1	4-34	QPKRKRSVHGCLTCRTRRKKCDENKPVCGGC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG22	KLTH0D01804p	1	25-54	PLLSQKRLACSNCRRRRKKCDMGYPCASCV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGS4	Spindle pole body component SPC42	1	9-42	LFAVLKNSRARPRPRESRLRRRVHKQMNISPTPK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHN4	Vacuolar protein sorting-associated protein	3	298-325, 341-362, 2869-2892	TASKLHWYQKTLKSRKHRPNFPVSEDPK, EKNYKWSWDYIKWRRDRRIEYI, DAQFQERRRLEQRKARNNKSINGF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHU4	Glycerophosphocholine acyltransferase 1	1	39-70	SQYLPRKYLTRARRRLKSARPRQKLNQLKTTA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIT4	KLTH0E15026p	1	1053-1072	LECSKSKPLLKKKPASCQSE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ79	KLTH0F14190p	1	7-28	RGLNAARKLRVHRRNNYSRWAE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ91	Kinesin-like protein	1	25-49	SPNGPSSPKFKKRSASPRPPSVSAS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJH3	Chromatin modification-related protein EAF1	2	95-114, 703-727	VDSARKEREHIKHDRDERNF, FEAMRKCFKKRENAPKPNPTQPRKP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJZ0	KLTH0F00462p	1	387-411	NTTSAKLLMPPRKRKEKQAAHGSCS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKD4	Elongation of fatty acids protein	1	295-318	YIEVYKRRGTKKSRIVKRVRGGVA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKG7	Protein LST4	1	97-117	FGSPVRAKTRHKCDKFRVVAG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLQ1	KLTH0G02552p	1	312-342	HSWLDKAFKKLRKKTTRNKLRKKKVEADDEM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMR9	Chromatin-remodeling ATPase INO80	1	260-283	IARMVNKNKNVKAKKRRFTNSTII
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN55	General transcription and DNA repair factor IIH helicase subunit XPD	1	107-130	GLTSRKNLCLHPRVRKERKGTVVD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNP2	KLTH0G18722p	1	4-27	FNSFKGFTRSSKKTKNQNVGTTAN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2C0	KLTH0H03718p	5	1-32, 178-201, 806-830, 1060-1086, 1102-1157	MDQSNKEHRKKSEKATAKKKLHTQGHNAKAFA, KSQSTLRATKKRLKHRFWTEVYQG, KFGILKARMRRHRWHKKILKTNDPL, KTLPFKSQIHQMKPQKKKTYMAKRAVV, FTISNAKDEKKKAKKQDERKERLKKLAKIEETKTEKEKERKKKFFSEHGKKRQFDS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2G0	KLTH0H04642p	1	353-377	GGSRPGKKSSSMRKRDKLKKKCIIM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBK3	KLTH0A03322p	2	295-316, 753-778	SVDDIRKKVKQRKYKTFQLFQQ, QARRLGKDQVPKRKRTKGEVLWFKGP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCR0	KLTH0B05104p	1	202-221	IQWHDFKKLSRNNGNKQHVK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCY6	KLTH0B06864p	2	121-162, 865-892	TQAPQKAQPAPRSNKKSKKKRIQIKRRIRRNKKTGERTVLSE, AASSTSKPAEKEKKKKKGLFSKIKKIFH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD88	rRNA-processing protein EFG1	1	26-45	GSNKIKRKIRDIERLLQKKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDB8	KLTH0B09900p	1	549-596	SESLTRSRTSVRRRSRTPTRRRSRTPTRRRSRTPARRRSRSPNTRFGP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDU6	RNA polymerase II subunit A C-terminal domain phosphatase	1	584-606	EELEEFKKRLDKKKQSEKALSES
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFF6	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	1	60-88	ISTGAAGKKGKQKKRGQNKNRNNIQVKEQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG83	KLTH0D03146p	1	28-50	TLDKARLRYKRVGRGNKVKVVDK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGV4	KLTH0D08580p	1	399-418	AKSWNSQNRRKSKTRSQLLE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH91	KLTH0E02354p	1	246-267	ASSLDKKFQKVKRVERAQNGLI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ32	KLTH0F13090p	1	124-145	IEVTKKRTNLPGIRRKPYKKNS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ66	KLTH0F13904p	1	45-74	GSDGNNKRNSDKRDNDKRDKKDPKDEDFKS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ77	KLTH0F14146p	1	174-196	RDGGRSIRKDGRKHRCFPHEVRF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJK6	Enhancer of translation termination 1	1	5-31	ALGIGKQNKTAKKQKKSDSPTPEPTPA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJS3	KLTH0F18700p	1	482-514	GDNGASKKSKAKQKPKQKQLTSKQLRNLQKHEH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK20	KLTH0F01122p	1	304-329	TSQFIVPNPTHKRKQKHHKVAAATSI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLC1	KLTH0F11748p	1	242-264	GTSWWRRVLKRLVRGRARPRTAA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLL9	KLTH0G01738p	3	22-44, 189-208, 893-915	LPSCLKSSEKRRSSPYNHKHSTS, LPPYLSPDKKTKRRESMIYD, SNLEKLRRASKERSNSPDRRLRE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMD8	40S ribosomal protein S7	1	96-119	RILPKPSRRSRQLQKRPRSRTLTA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E273	KLTH0H02662p	1	2-26	SANSWRQWLKLTKRQLKQIRQTLDD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2A9	KLTH0H03476p	1	344-363	DSYGSKKDKKDKKSSSYGNS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBF1	Type 1 phosphatases regulator	1	119-150	KDLDRESRHNARKERRKRKLAQKRSTSPNAYE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBT4	Threonyl-tRNA synthetase	1	22-44	KDNKSSEKGNGKSKNKQDSKQSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBZ7	KLTH0A06644p	2	1-28, 546-565	MAEKSSSKVSKPRKLKKNGQRALKACDS, TWYHRCYRARKMHLAKRARV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC25	KLTH0A07260p	1	19-61	QFEVDGRSKKRRKAIKQCLFCRKRKLKCDKKKPMCTTCVTRGL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDW5	KLTH0C04334p	1	268-289	ISDYVPQKKRPQHRLKFLIGKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF53	KLTH0D12298p	1	376-402	QLNDKELTKLRKERKWKDLYHKCDPKD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFC3	KLTH0D13970p	1	149-173	SATPTVPRRRGRPPSNKNKKPVANL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI04	Transcription initiation factor IIF subunit beta	1	153-180	REEEMRKKQQQLKRRNNRRRFQNRVMTD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI73	KLTH0E10230p	1	1-22	MVLGIHRKPQKKPDLSRYDYHY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIK5	Nucleolar GTP-binding protein 1	1	598-621	MRSKADRLAKIQRRERNREARAGE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ36	KLTH0F13178p	1	62-87	KTSPGLSSFKKKPNKAFKDHIKPLLQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJM9	KLTH0F17732p	1	87-107	GSANKDKSHHHVQKKDRYFTD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKU0	KLTH0F07480p	1	1155-1176	KVPFGKTKYTTNKKYVQKKLDF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL61	KLTH0F10274p	1	604-625	LIFVRYMKKRFKGERMHHAAEF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLV2	KLTH0G03784p	2	12-32, 40-62	TPPADLPKRKGSKPGRKPLDT, AQNRAAQRAFRERKERKMRELEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMG6	KLTH0G08756p	1	421-442	RDSYRKRQARGQSASSKRRKYA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMX1	Anaphase-promoting complex subunit 2	1	570-589	INNYKKAYTNVKKGRKLRLH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN08	KLTH0G13222p	1	56-79	TTSFSIGCQRNKRQPPRTQRLLLS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E246	KLTH0H02068p	1	347-367	ISDAKKLKKEQVAKQKKSLSK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2C5	KLTH0H03828p	5	4-23, 573-597, 601-620, 840-863, 1120-1139	ESDASSRRRAVRKINYNEKD, TPNGRRIWGNYKGRRKNQKHANSAS, VSSFGKKSRIRKPSKTLRED, MQEVRKKEKKAKAVKNKVKTSKAK, KPRVCRKSSKDEIKLKNLQW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2F7	KLTH0H04576p	1	497-518	RDLLKQEKRKFLQNIRNEREKD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E351	KLTH0H10428p	1	228-251	ADPSRKISKKPKVRSFLRMRPKNK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBA1	KLTH0A00858p	2	157-182, 618-640	IKRYRSPSIKTKQKARKHSCTCHLFP, TEQLKKTPPSKVRSSNNAQRGKH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBJ5	KLTH0A03146p	2	459-479, 520-540	IKLPNFRKRNFRKQGTQAELT, DSRPASARRFQRRYPRERAGV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCJ7	Tyrosine--tRNA ligase	1	356-384	GYPVVSTEKVKKQKKPKNKGTRYPGGQAP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCL5	KLTH0B04048p	2	210-237, 242-268	DTTHRRRPVRGTRQSKRTRARTNEREPE, QDEPAPKKARSHKKKQPQKVEVEKYKF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDG8	KLTH0C00880p	1	131-150	AEKPCDHCRRRQIKCVIAPD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE52	KLTH0C06336p	2	826-848, 861-882	GKTTSAKRVKRLKKMPSANNLGT, LEAKNSKRISRAKPKKSSGVSG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE91	KLTH0C07238p	2	67-88, 104-131	QDLESSPTRKRQRDPEKTPMAE, MAPESPTKRPSKRGRPRKVKTEPTENID
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DED0	Kinase	2	106-126, 639-663	SDVHHKSRRGSLKERNTQPFH, GVSANKFKRLSQNKKCRQTTSRKLG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEE8	KLTH0C08602p	1	454-483	SASHQLRTAPHKNKQKAKRKREMRSFDIDT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEY8	Ribosome biogenesis protein NOP53	5	2-32, 65-89, 300-329, 359-383, 421-442	AAEKERPSQYRQSSRKGKKAWRKNIDISDIE, GDEVWKQKLIKRKQIKKNLKSSEIL, LNKPSANKKKTKYQRNKQRRHQEKLSLQKE, AEKQTRVGKEKPNKKHKLGTKHSVI, KIETRIPVKKGRRYAPRITEKW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGH5	KLTH0D05368p	1	563-582	VYSLKRPMKSIKHLNAHKDG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIY9	KLTH0E16258p	1	683-708	GMKQDPMYKKVPKKVKQAMSNVVFRN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ25	KLTH0F12914p	1	69-88	RNPPTFLKRRKIPFKIHLLS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJG6	KLTH0F16280p	1	154-173	TINTDSRSKRRRRSDASLEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK28	KLTH0F01298p	1	53-73	EAARCLRKKLKYGNRLQQARA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL02	KLTH0F08888p	1	10-30	SSLVSRFHRKVKSRGDQSLNE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMA0	KLTH0G07128p	1	526-551	DTFCNDKSSKFKRSKKDKCFILKHYA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMW7	KLTH0G12254p	1	668-697	AKKFSNVVIKKSPRRRGRPRKDGTFSVNNS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN46	KLTH0G14080p	2	34-53, 863-894	TTPRSSRSRRWGQGLTKTPK, DFDEKFKKRTTEKPEIRQKQLKRSSKFINKIC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNJ1	KLTH0G17468p	1	310-330	SQNSRFSQTRRSRKGPQNPSL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNP0	KLTH0G18678p	1	74-95	KYLKYLTKKYLKKNQLRDWIRF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNQ9	KLTH0G19096p	1	1-24	MGRYSVKRYKTKRRTKDLDVIFDE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNS5	KLTH0G19448p	2	779-799, 1462-1486	FTHSTLKKMKKERTKKSQDLE, FLYWLARVPKKKNRVADERDPNAKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E1X1	Autophagy-related protein 2	1	1096-1116	FVKGSSKKTRLRPSRDFKVRI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E203	KLTH0H01122p	1	266-294	TSNVGGSKSKKNKKNKKNKNKHVLTHHTD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2E4	KLTH0H04246p	1	124-145	KVVFKCKASKRGRASRKQAGCG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2F2	KLTH0H04466p	2	35-81, 516-535	AESTAVKKDKKEKKSKKEKKDKKDKKEKKDKKDKKSKDKSKVDDAVA, PEELKKFGTHTKKKEHSAYG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2U4	DNA-3-methyladenine glycosylase II	1	206-232	LMSKRVQGKTKRSKIVHKKKNWKIYDE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBB9	Polynucleotide adenylyltransferase	2	8-47, 521-552	KNERAGPKSSSKSKPLKNNQRRTKRLRKSSLSKAQRNFAV, IYTVEEPAKKKPKKAKKAKKAKKETKASSSSV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBL1	KLTH0A03498p	1	10-56	IIDNDAAVRRRRRKIIKSCTFCRQRKLKCDHKRPKCGSCLARKLPEC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC34	KLTH0A07458p	1	441-462	NEEPRRSRRLRNKSFSNKFKEV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCB1	KLTH0B01606p	1	11-31	ETRRCFSNTRNVYKKLNKYSY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDV3	KLTH0C04048p	1	597-625	TVSSSQSPTKKQRKEKKFIQLFKRNRTTS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEL6	KLTH0C10252p	1	344-365	QEQSEDRSPSRKRRKFGKLRIE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEP4	Serine/threonine-protein kinase	1	42-70	LDHNNDQHRQPAQKKKKEKLSALCKTPPS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFM2	Origin recognition complex subunit 1	1	22-47	ILPDDLSQRRARRRGQRQGEKEHVVI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG41	KLTH0D02222p	1	20-55	RSKKSRLRLSFVCRNCRKRKIKCDKAQPKCGRCAKL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGB4	KLTH0D03938p	1	27-47	VSDAKTRYNYAKRSRFRHACA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGD4	54S ribosomal protein L31, mitochondrial	2	15-41, 109-131	LLWKIPWRMSRPQKQRQRHRLQDVDSV, YRKGIHKLPKWTKITQRRNPAFF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH45	KLTH0E01254p	1	1-23	MENTPRREKTKDRHSLEGKREEF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHP5	KLTH0E06006p	1	168-199	GDKKLSSKKRAKETGSKPKRQKTQEDRSPPSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI01	Pre-mRNA-splicing factor CWC24	1	1-20	MFKKRAIKCDQASSKRQKFT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIB7	KLTH0E11242p	1	3-34	YVTAGYPSRPHKRVKKQERRVYYDRKRLKVNE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIG0	KLTH0E12232p	1	60-82	DSDNTTSKFKRKYRSLLQNYGGN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIJ3	KLTH0E12980p	1	355-385	TEANKGATKKKSKANKKYPPHIEQQRRIKRG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIJ7	Elongator complex protein 3	2	1-24, 46-69	MARRGPKTNKQKLAPEKERFIQCC, NGLITKFSKKYKLKQQPRLTDIIN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK69	Transcription initiation factor TFIID subunit 2	4	291-314, 772-798, 1321-1344, 1351-1390	NIVGATQPRRHRRNPNTPGRDNEH, DIQYNTKYKRLKRRRKINKTAKQEGKD, KINLAPKIKINSKRKPPVSTKSSS, LPNSKKSSTPSRRQSNPSVNSSPLPRKKQKIVRSSVTKIG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKW3	KLTH0F08030p	1	1038-1063	EVYKYFKRCYFKNKGKARNPENDLES
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKY7	KLTH0F08558p	1	573-599	FDPKVIRGSHSKKPKRQSYNKSTVFVI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL08	KLTH0F09020p	1	224-250	DEGNGGSSEKKKKKKKKDKKKDKHSSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLA9	Autophagy-related protein 14	1	71-95	LAMLRKTHLKRRTNKIRSKLQQLQE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLV1	KLTH0G03762p	1	239-258	LENAMKRKRGTKKNKGVGAS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMA9	KLTH0G07348p	1	306-328	PALKRSERTQHHKGKLKRTNTNT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DML1	KLTH0G09812p	2	166-193, 196-232	REQLRELKIKRRRPGKKQRLAKKAGSER, ERLEKAKELKKLAKKKFHKRGGKKNKKTESDGPSKPR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN23	KLTH0G13552p	1	35-60	NATSKLSKDQLKKREVRRFAQKKAAA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNB1	KLTH0G15554p	1	299-319	MSSSKAHKKYRPQSLKGSDIT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNQ1	rRNA-processing protein FYV7	2	1-20, 96-125	MPPRVQKHTRESKVRDIQKS, QKINEAKEREKQRNQRSKKVTQRTRSGQPL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E1Y8	KLTH0H00726p	3	101-130, 227-254, 536-562	EELKERKREWISSQKKRFRQSSSKCARGKT, SAAWIAMRREKRDRRHFKRMRFPPFDDE, NELKSSKLGKQSKKKLLRSLRNTKFFQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2J0	KLTH0H05390p	1	63-83	GPSAKNKEVKRPRLNPYLPRD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E350	KLTH0H10406p	2	58-84, 881-900	ATAHDSAKRPKNGKKILEKKKKSEVVP, LDDLRRRKRVLRRLDFCTPN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBG3	ATP-dependent DNA helicase CHL1	1	129-148	YLSEDSPKVKRKRNLPHTTV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBH6	Structural maintenance of chromosomes protein	1	1039-1061	FKETEKCKTKEKKVNEQFAKIRR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD62	KLTH0B08580p	1	12-42	NGKRYESYSCSRCRKLKKRCSKESPVCVSCA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDX0	KLTH0C04444p	1	148-170	CIPAFIYKVKNQKRRFRMEFKPT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE78	KLTH0C06952p	1	1310-1329	LLRKKTLEVMIRKDKKKRKS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEC7	KLTH0C08118p	1	615-638	IEHTDNHKIKKKCYKDQVLPHGAG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEI1	KLTH0C09416p	1	846-866	LVQKHIQKHLRHLKHRDQIIA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DES8	KLTH0C11858p	2	3-22, 32-55	ITKLARCKSLKQLRLCSFKD, SNLNPPIKATHPRRKEFRKASVLT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFE0	KLTH0D14344p	1	4-26	LCLQRLQEERKKWRKDHPFGFFA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFP5	KLTH0D16830p	2	1-24, 140-161	MTQLPRRVIRRRCIVKHPYDRPLH, LDLKRHWSKTNREKKSTRVRKI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG14	Eukaryotic translation initiation factor 5B	3	69-133, 215-257, 275-301	MSALRQTKKKADKKEEEDVKKPVIKSKKEKEKEKKEKEKQKKKEQAAKKKAQQQAQKEKNKELNK, AEEARQQKREKERAKREKLKAEGKLLTRKQKEEKKLLEKRRAA, GSDSKPKKVVYGKKKKKTQQEKDAELA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGC9	KLTH0D04290p	1	34-56	GRPKRTPISKQERELRRKQRELE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGS0	KLTH0D07590p	1	1228-1254	NSSGTAANRKQKPSKKQEEPNPELANK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIV5	KLTH0E15488p	1	92-117	SDSSGDQRKKEHKKRKAQDSRELHAA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ72	Transcription elongation factor Spt6	3	63-91, 102-127, 1337-1357	EEGRASAGRKRSKKHKRRTREDEDDRLSE, GVKRAPSPDKSKAKFKRLKRAGDDSE, ITSNEKFKKGTKREVTKFIED
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK25	KLTH0F01232p	1	1-24	MLRNCTRKPAKRLKVDTGRQKSVM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK53	KLTH0F01848p	2	366-391, 494-515	RKLASPSPEKTHKRKNQQKVSPLSAE, GRSNLRSCRRVHKQYFWKKPAK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKN8	KLTH0F06226p	1	31-53	QAQTQQHQRTQRQERRRPQQFAV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKV0	KLTH0F07722p	2	14-36, 137-164	SGIPMGLKKQRKRETMNSIVQCF, LDKKASERRDLDKRKKKKLRGDLDEERF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL81	KLTH0F10758p	2	19-40, 244-272	SSSTPPSEPKRRQASRARDDIL, IVMGRPGNRITRRKRCRATVGNNHKTSKE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM02	HECT-type E3 ubiquitin transferase	2	2-21, 2429-2448	VTLTKLEKFRKEEKAKGFKP, DESPDSKKKKPEKIYFSPLV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMC1	Nucleolar protein 9	2	539-558, 648-670	LQVKRVDKIKRKRLLNVFCT, GDAGTKRKGDKPSYNRPEKKFRR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMH0	KLTH0G08844p	2	4-30, 267-288	ETRSKSASGKHQPSKSKEPSNDPQSNS, DASDAQKRKKNHKRVAQPTRSA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMQ3	KLTH0G10758p	1	40-65	SNTLPAISRKDKRRHNFESKVRKVSQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E205	KLTH0H01166p	1	458-507	DSEEDQKPAKKDKKDKKDKKDKKEKKEKKDKKDKKEKKEKKEKKEKKKKD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E256	KLTH0H02288p	1	178-206	ETSRYRFRQQSEKPRRRKNYKGSTNRTAQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E275	KLTH0H02706p	1	1377-1403	GTKPAGSQSKARRGRKSKWHSKSWSKR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2L1	KLTH0H05852p	3	4-32, 66-85, 164-190	VSAEEKKRLLLERRNKWKQKKAEFDALKV, SKPVGKRSSKVKKRAFEESD, AEFMRLKKLKSKKRVKRLNTQTQKLEP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3B2	KLTH0H11902p	1	1005-1040	ISSGTKKKKLSSAELRKKKKERMKKKKEMGDAYVSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3D7	KLTH0H12540p	1	63-87	LLAVPKKKVSHQKKRQKLYGPGRKQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBU7	KLTH0A05478p	1	18-42	LEERRLHENKTRKKYWLKWGPYLSE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBX1	KLTH0A06006p	2	16-36, 1353-1377	DSPKAHKKRSVSEYDKKHESS, SCNVTPPNRSGKRVKNPKNLQLHGT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBX8	KLTH0A06182p	1	219-268	EELAKTKRDRRKEVESNKVYINRKKELMRKRGRKVAKDSKFTGRKRRPRF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCI4	ATP pyrophosphate-lyase	3	319-343, 383-411, 415-437	ITNISDKKPKEKAKLPPKSRSQTPV, DEEVGKPLPGKKNKRRVHRHHTSNTTSKI, RAGGATKKPGRPKQKENTPKLGS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDQ5	KLTH0C02904p	1	35-60	HQLVRARDAGKRRKGRRDYQVCAATE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDZ5	KLTH0C05038p	1	63-86	AYYSIMYRKRSTKKHKTWDGDGTA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE64	40S ribosomal protein S8	1	11-37	RAATGAKRAQFRKKRKFELGRQPANTK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGE0	KLTH0D04554p	2	956-983, 1007-1035	RKGHPATSKSHPKPKKKSTYQDYAPQHR, KQAPAKPPAPKIRQKKPAPPPPAKKQSQP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGJ9	KLTH0D05940p	1	1-21	MAKKVVKRLRVADKKARSETF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGN6	KLTH0D06776p	1	35-58	RIDVAPKEAQKRKRARWTLLWSML
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGX7	KLTH0D09108p	3	474-497, 612-638, 680-702	SHDNQQPQQRQQRQQQQHQPQQQH, ADEKRPTGSKTQHPKRKMKEQEMEGSI, SVRRELMKKIKDDKKEENKMSDN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHC8	KLTH0E03256p	1	1-29	MPPEKVAKERKRSKKACQRCSAQKVKCLG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHD7	KLTH0E03542p	1	2-31	AKKKTLKQQDFQKKKLKVGKPKQQASNVTS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIH4	KLTH0E12540p	1	693-718	QDEPSTVIKRKLKKIKSVSKFPFWKI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKJ7	Oleate activated transcription factor 3	1	3-45	QDRASDVPPAKKRRRPTVVCTNCKRRKSKCDRLKPVCGNCLRL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL54	KLTH0F10120p	1	12-46	LEEARRRVQELKNKKKKKDKKKKTKGEENESEVGN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL85	KLTH0F10846p	2	41-67, 69-96	PLSNKELKELKKKEKAAKRSAKKEASG, SIEKQQQQAQQKREKKQVQRDQQQNGGS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM28	KLTH0G05500p	2	437-460, 526-550	SPSKAAKKSTKHLKKLYNRDDFKD, SSSPEMDAKKRHKPAEKKVRPDAIA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMT4	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	1	135-156	NAENCLKLRKRQPLPKRPNALT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN21	KLTH0G13508p	1	2-21	FDKWQFKRLIKLPKHRGVVW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DND9	Repressor of RNA polymerase III transcription MAF1	1	336-355	DGDKGGSKRKQGRRLTIDHE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNI8	KLTH0G17402p	1	211-230	CGQLQQRTSRRRKKTVVIAP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E283	Signal recognition particle subunit SRP68	1	24-50	DFDKYHQKLNRKLQKLRHHCRLTTKDT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2W5	Apurinic-apyrimidinic endonuclease 2	1	473-492	NAILRTSKTKNNPGKKFWAC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3A5	KLTH0H11704p	1	8-34	AGGSCLVCRRRKVKCDRTKPVCLACIK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3P2	KLTH0H15202p	2	1-24, 109-133	MGKSVKSRRRQKAKKSSCLEKSSA, ITTDEKTKVSKKKLRKLSKPALSEL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBH3	KLTH0A02640p	1	628-650	DEATEHHSRTRKRKQNPNFLNVL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCE8	KLTH0B02464p	1	91-115	VKWDSHFKLKNRKVVKKNKVLDIQA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDL8	KLTH0C02046p	2	694-714, 1818-1838	STFDYIKKKARSKRLSPRAEL, SIDRKKIIERKTQYRRFIQEA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDZ6	KLTH0C05060p	1	2-23	LSKSSSVRRIKTDKKRHSMVLT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE57	KLTH0C06446p	1	12-45	IRPSYRGKSKSKAEPSKVKKNRPPKTQNLEECFE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEH9	KLTH0C09372p	1	564-589	GFNIKASKTLAKKRKQQLAAQKNSSG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF60	Cap-associated protein CAF20	1	45-67	YQQFHRRRSSHHHGRPKIKHTKP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGH2	KLTH0D05302p	1	18-45	AEAYPVYKVNKKRKRNRELWTKLHKFVE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGZ3	KLTH0D09504p	1	58-77	ASQLRSSPWKRAKLDKFSSR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH38	KLTH0E01100p	1	958-991	DEFNPDSKKNRKVKFKVSKNNKRKKSHSSSSGQN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHM4	KLTH0E05544p	2	309-331, 982-1003	NDQKIFKLKNQKLKPKHDPYLLK, LGSTNHQHVRKHKKNVSFGSLN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHN7	KLTH0E05830p	1	1683-1702	ESNYKKQRVSTDVNRKSRKD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI29	KLTH0E09240p	1	434-462	QTLLELKEMKRKRVKSKKVSKPAAKEMEL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI67	KLTH0E10098p	4	13-33, 64-86, 404-444, 755-804	AGKQPSNLKKLKNRNVGGKSA, LESHKKTGFKNPHLSKKSKRGVG, NDEKRRNLDKKQTKKREREELIRRRKLSRKLDKERRQKSAA, GSERTRRKIDKMKELQKKKSEERKKLKKKKKLLKIKRERERLEKEKERND
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIN3	KLTH0E13860p	1	527-546	CYEVIHRLKRKLKNKDESFL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIZ0	KLTH0E16280p	1	182-209	LKRSNLTHSGKRSKSKKREAPAIGNSNT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIZ3	KLTH0E16346p	3	10-38, 393-420, 778-816	KEDSQKLMSRKSKTKSSKKRAQNALEIAA, FREERKAKRIKKIKSKAYRRIKKKEMLR, AGAGSAPNKRRKLKKVKGTVQKDKRKDKNLKNVIINEKV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIZ8	KLTH0E16456p	1	478-499	FQDLKLPTKKVTKKASKNTLGG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ46	KLTH0F13420p	1	211-233	DDVKNGKPLKPSQKERRAVLKNL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ50	KLTH0F13530p	1	180-205	TEASARFRIRKKQREHEKVEKLKQLH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ75	KLTH0F14102p	1	306-325	LTKLMRRLFRYIKANRRARL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJC3	KLTH0F15246p	1	80-108	PLKSPSPSLPLKRRRHRRRSSLRPRALPT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJD7	KLTH0F15598p	1	117-147	ACHERLLEKRKHYEERKRRLKKQLPLIPDNS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJZ6	KLTH0F00594p	1	75-96	TPESSSKRFKSRQQQTLNRFLD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKB9	KLTH0F03344p	1	612-641	DWNNMEKHQIRRFKNKTKNGITKNLQKHGL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKQ8	KLTH0F06710p	1	337-363	LSSTPSFTRKKKYPSRRKSSNATPSAP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKS2	KLTH0F07062p	1	251-276	FHYDCIKSWFRKKSQKLKSTTGKSVS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL67	KLTH0F10406p	2	2-28, 89-123	LEEGGFIRKTRTRRKRKVDYKEDSDGE, ASPAKGAKKGAKGKKKSTAKPKKPKTTPYERNTAR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLD1	KLTH0F11990p	1	458-477	FVLRLPKRAKWDSKICHQTQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLM1	Histone H2A.Z-specific chaperone CHZ1	1	1-32	MAETKKHELKDQPDKKRVKRRRNYDDYDKEVA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM12	KLTH0G05104p	1	351-371	FQGASKTKKNNKVSPKKPEVA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN63	DNA mismatch repair protein	3	8-27, 35-54, 187-208	KSSKRSFKGSPQSSGRKNLK, FSKHKTPSSTPLKNKKVSLF, DGNIVKTGKKRRKQLSSDEEEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNL4	40S ribosomal protein S25	1	15-42	AAMAGGKKSKKKWSKKSHKDKAQHAIIL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNR0	KLTH0G19118p	1	1-30	MARRPARCYRYQKNKPYPKSRYNRAVPDSK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNR5	KLTH0G19228p	1	1-23	MAPATPPRSRNRRGKAVCPSSPR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2H9	KLTH0H05082p	1	177-203	GQSLRARQQPRSRSRQKQNTSSNRVYD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2V6	KLTH0H08030p	2	20-43, 108-133	RSILAKRVQDHKRKPERLRQLELL, GATPAAPKHAKKKKNKIPCSYCHEAG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBF3	60S ribosomal subunit assembly/export protein LOC1	2	1-25, 165-193	MAGKQTKTAKRSNKQNGKREVNPEV, DELKKKASVARTLRRKNKRDQYNESKAPA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBP9	KLTH0A04400p	1	166-197	PASAAPKSANRPRSRRRKANPQSKSTKHARSN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC17	KLTH0A07084p	1	19-38	EEKVRASKPVVPQKRRAESE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCH0	KLTH0B02992p	1	182-204	LHNAWRGNRRGRVRARGRGKRFI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCP5	Eukaryotic translation initiation factor 3 subunit J	1	51-70	KKPTAPAKKPAAKKDKKDAA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDB3	KLTH0B09790p	2	161-281, 293-313	YPSSRESKRSKKSKESRKSDKKKDVSEEDKETVKKGDKSRKDKDKKLKKDGDTKDKKEKRVKKEKKDKKDKKDKHKMKKTEDKKQKHKKSEKDRDEKHKNKKDKKREYKSSKSNKVSRESM, ASRLSVRSKWIKQKRAAVMDA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF93	KLTH0D13244p	1	4-39	GQQREQREQREQEERRRRQKRQEQRLPPPRNGRVGS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFG0	E3 ubiquitin protein ligase	1	36-56	LFRAINKHRCREKSLEKQLET
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGF5	Alkyl transferase	2	13-35, 305-331	VIEKELKQTKERFKPKAPPFPYV, LLKWSFFTSVQRRRNSRRLLRLHTACH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH18	KLTH0E00660p	2	7-37, 47-74	ASGSQLKDGKRRRDRNMRKPKNSPKSGQVNE, DTKNGDVKKRSSQKRSRPERKITEDSKH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH37	Ubiquitin	1	93-128	KSVCRKCYARLPPKATNCRKRKCGHTNQLRPKKKLK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHB6	KLTH0E02970p	2	32-51, 263-291	HKAVKFLKAQRKRQVNQAKQ, ILIKDSKKVADQKRRDLRKQKRSARRAQL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHL5	Pescadillo homolog	3	33-62, 522-554, 558-603	RRLCIFKGIYPREPRNKKKANKGSTAPTTF, GIPYSDAKDKKEVKKKSKKPEKRKATEEDEEKD, IMMSNKQRKLYKKMKYSNEKKDDRVEKLKQKKKAIAKAKSKLEKTN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIS7	KLTH0E14850p	1	1-26	MSAPREAKKRTTRRKKDPNAPKRALS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJP0	KLTH0F17974p	1	85-113	GVAMKPRPPKKSSQPPRRKTRILNFETEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJQ9	KLTH0F18392p	2	16-41, 60-85	DINAGLRKGRRKKLACVECRQQKSKC, QCVLQKDFRRTYKRVRNEVIEKRFKE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKP7	KLTH0F06468p	1	170-190	ELSLRSSKRRNRRFVSSRFNL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL12	ERF-3	1	649-678	SKLLHKLEKGTNRRSKKPPAFAKKGMKIIA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLA4	Signal recognition particle 54 kDa protein	1	91-111	DGETEPFQPKKRKQNVIMFVG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLV0	KLTH0G03740p	1	601-631	EEALYLKKKVEKFKRKRLTKRKKNEPNCLLM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMI2	MMS19 nucleotide excision repair protein	1	989-1011	AVALDDKKRRVRKTCIDTRQAYF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMK6	Protein-tyrosine-phosphatase	1	17-39	DGSTGPRSPRHVRNRNTKNLSLS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMN2	KLTH0G10274p	2	277-301, 423-442	AIKAKQETRKKRRILRARARENFKP, FPYRTRRQIKAKFVNEEKKH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN68	KLTH0G14586p	2	6-25, 54-78	KLSQLRKKPATKPGEKTMDK, DPAIRRLKELRRKEQLKNAPKNKPG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E238	Coatomer subunit alpha	1	280-299	WDLDKRTPVKQFKRENDRFW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2H8	PAN2-PAN3 deadenylation complex catalytic subunit PAN2	1	434-453	RNVMRPYKSLRERKKKLLIT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2S7	Ubiquitin carboxyl-terminal hydrolase	2	78-102, 544-564	GSVPPPSGQKKKYYNKVENNGKTEA, EVSSTSKKGKKTKTAAKRTVV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2V9	DNA replication licensing factor MCM2	2	136-158, 722-742	DEMGLPVQRRRRRRQYEDDDDLL, EEPMSSRQRRLQRDREREEEI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E396	KLTH0H11484p	1	146-171	NPVGETPDRKPQRKQSLKREEHSKDE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBD9	KLTH0A01804p	1	308-331	HVKAYVPREQREKRKEKWYSFLFN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBI6	KLTH0A02926p	1	6-30	YVAPSQRLYRARHKITRKDLWKSYT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBM0	KLTH0A03696p	1	7-29	GGLLTRFARMRKKPQQPLTDLTE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBT5	KLTH0A05214p	3	270-296, 304-325, 356-396	EDTASSRRNSERKKRNKPDFGARPSQG, VSEPFKRNPPGRRPQKSFRASS, NKPSQRSSKFSQRSNKSSQRSAKPSSPRNAFPFKKRKKGPG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBU4	KLTH0A05412p	1	203-222	VENHKPHPRMRRSSDNPSAS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCJ2	KLTH0B03498p	2	12-34, 486-508	GAYRPRLHKLRTRGKQIVRWSKS, RSQPASHHKCKNADHKRSFKSLW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDC4	KLTH0B10076p	2	1-30, 626-648	MPRKKMMKACIKCKQRKKKCSGQLPCDYCV, VASPRPMSRILRKRGNNPPKDFE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDQ8	KLTH0C02992p	1	22-42	SVSPTNWKKRSQQSSPLRDVA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEM0	Glutaminyl-tRNA synthetase	1	179-205	GPKDERDVVKKEKKKKGKEAKGGAPAE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF05	Serine/threonine-protein kinase RAD53	1	767-791	ISLSQDPNKKAKRARLDKADKGGAN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF26	KLTH0D11704p	2	1-20, 98-119	MPLSKSLSKIQKNNKSQGKN, ELEELKKKRRTNRPPSTRQVVL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFC8	KLTH0D14080p	1	29-52	LHDGEQRPSKRQRRFAPMTQHDSQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGY6	KLTH0D09306p	1	735-762	KVTAKRTIIKASRQKKDQKPNPIAEKAE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH80	KLTH0E02046p	1	31-53	IDDVRERRMKKGGKKYNQVQPVA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHS9	Ribosome biogenesis protein NSA2 homolog	1	10-39	HIKQHGRRLDHDERKRKREARESHKVAERA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIA5	KLTH0E10978p	1	389-420	EMQEPNKVRKPRKPKVKKKSKKDLEREMKYQQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJN5	Thymidylate synthase	1	20-39	TEQELKKQKLEKKNAEEQQY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKQ2	KLTH0F06578p	1	161-180	AHEKPKRKVLHLKRFFKKIH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMP2	U3 small nucleolar RNA-associated protein 25	1	14-34	SNEYRSSKSGRKQLRTIRKAS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN95	KLTH0G15180p	1	30-62	LLKDKKGRSRSCLLCQRRKRRCDHKMPSCTACL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNH3	KLTH0G17028p	1	937-959	THETYHCKRCKNGKQMVKSNAML
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNK5	KLTH0G17798p	3	542-562, 578-599, 676-702	GHFWTRGRRNHEHRHTQQLRN, QILNKCQRAKNKLKDLAQKLSK, YSDHYEHRPRRYENLRRKKDRFMFLFF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNL3	KLTH0G17974p	1	143-163	SNDVMRTRRIAQPRKKRQLGA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2R8	KLTH0H07172p	1	701-720	SYNNCLKKIRKAKQALSGAD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBL5	KLTH0A03586p	1	329-354	ERNRIAASKCRQRKKIAQQQLQKDVS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBW4	Inheritance of peroxisomes protein 1	1	20-46	QKDPANGAKPSKKKQQSPFKSIKNTLL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCU3	KLTH0B05852p	1	82-106	AFGWGNKTRKRVKRQEKILEERLQE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD37	KLTH0B08008p	1	166-187	HSKTSKFKFKHSRRWYKFWDGQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DED4	KLTH0C08294p	1	76-96	LDEPVRKKRKRAAQVKADSDA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEK6	KLTH0C10032p	1	8-40	ELSAFKFRKRVPKACDHCRKRKIKCGAVNPITG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG56	Endonuclease III homolog	1	327-348	ADQKLLQKVRNPKEERKSRGNV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGP8	KLTH0D07062p	1	1210-1244	VSRLYRRTNVHKPLVQKRKNPESSSRPRKRAQASV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH85	Ribosomal lysine N-methyltransferase 4	1	476-498	DMVLKRKQTAEKGSQKQQKRLKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHC4	KLTH0E03146p	1	464-485	MIFDNHRRNKRQGIKLTYKDVP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI93	KLTH0E10692p	1	72-97	PGPSRLKPGIWRKRTKSLSKSESKPF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIB8	KLTH0E11264p	2	619-644, 839-862	AHHPHQFKTTSRKNRRSNMPNLRHAS, VDTGRKKSKFGLFGKKDKKKKGKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIQ6	KLTH0E14388p	1	159-184	ADARRLKNRAARERRAQRANEKREAL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIX6	KLTH0E15950p	1	282-301	MYLWAAKKNRRYGTKRAFLI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIY6	3-hydroxy-3-methylglutaryl coenzyme A synthase	1	2-24	TEQNQLKKQKTVSQPPRPQNIGI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJB6	KLTH0F15092p	2	241-260, 558-579	AQRLKMKAVRHKKRLTRDIK, ETEHHSRSRSARRNSWFQRLRS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJD1	KLTH0F15466p	2	11-38, 168-203	EIIGSNKKPIRKINKKAPKKVSKQIVGG, ARGPNKKVAAVKKQKREEKKKQPKPEKKSLEQLDQE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJF2	KLTH0F15928p	1	283-307	EKKQGQIIRERRKRQLREQQEREGM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL07	37S ribosomal protein S24, mitochondrial	1	257-285	LDTRHTTARNLRRKTRGYKFPEEWKRPQD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLL7	Cytoplasmic tRNA 2-thiolation protein 1	2	4-46, 281-303	TPPSDPKKPKSIKVSQLCELCHSRKALIKRPKNLQKICKLCFF, SGESLRLKPKRTKRAPPAGHVEV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLW1	KLTH0G03982p	1	48-70	LFKEAKKRKVAERKPLDFRRTFK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM13	KLTH0G05126p	10	170-230, 341-370, 553-595, 657-698, 715-737, 748-778, 895-919, 1222-1241, 1325-1364, 1440-1464	TKSHDEPKVKHKSKSKDTHKDKSKEKKSKKKDAKKPTKKKSSKKKKDSLKKNKEAPKSSSL, SASSSKKKSSESSKKKKSSKGDSRRKEGYN, GSTKAKKKAAKASKKKDATEKSSSKLQSPKKHSSKSKKHGVSN, AAKARRQRMDRNKAQRSKMKEERRIARQDKQLKKKERQEKEE, PPDLRLTKRGRPKKPFRRYTAEE, IDTESSKRVKKDRKKKERKPKKIPLSALRKI, VDGSLRKSSKDRKHRSKSKGANFVS, IPYPKVKKRYTKTPPVLNLE, ELTKLKKCITNERKRKWREANAKKNKNHDLRARLKKRANA, LILADKKPTKKRTTAPTRKPIKIDA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMD2	KLTH0G07898p	1	31-59	ISRSIAACKRCRVRKVKCDQKFPSCSRCV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN26	KLTH0G13618p	1	26-49	SRSQSFMKNKSPKRAEARRPLASK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNF6	KLTH0G16566p	1	72-98	LEDAPKSRTKKKKGKERDPNLPKRPTN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E255	KLTH0H02266p	1	56-81	VYLKDCFQKVQQQKRLLKKSQQDIEA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E371	Protein-tyrosine-phosphatase	2	6-25, 180-199	EPNGPGQPPNKRRKGHSEEQ, HSVGKSSSKHDPPRNWKQPG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBL8	KLTH0A03652p	1	45-65	ECDLKREVKKLQRLREQIKSW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBS4	KLTH0A04972p	1	580-604	LDMHSYKPQKIRKISASKKTLKSVW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBS9	KLTH0A05082p	1	28-52	SKRTNGYKTKDKKLRAGLKRIDDQY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC45	18S rRNA factor 2	1	78-100	QEKLERLKKLRASKKSKHKTGVV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCV6	KLTH0B06138p	1	208-227	GEFTGRPKVKPERKPEPIEV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDQ9	KLTH0C03014p	1	596-617	NNPLWTKQKSTDRQRNEIKDNG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFL3	Lysophospholipase NTE1	1	850-875	KTKPEALERKNKKRHLRDSSKVRAIR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFX5	KLTH0D00726p	2	380-401, 437-461	SSVPNTAKKTTRKQPKFQIIVT, TTSASSSRGKTKRQKLSQVHNFSLD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG39	Protein MAK16	1	266-291	FTSGKGKKGTSAARKKRPRVEIEYEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGA2	KLTH0D03608p	1	1540-1563	ISGKLRPYIKKTKAEKKIKIDEEM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGJ5	KLTH0D05808p	1	1025-1054	GFSSSKSNPLSKKKGKQSENKSDNKQGFKL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHD3	KLTH0E03432p	1	703-730	RAATRWSIKRVFSRRRRGSQSVVRHQNA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHR1	KLTH0E06424p	2	157-181, 774-794	HEDTKRSKLSQNQHRKRIRQSILQS, EDIRKKQAKKNAPSRKLSKEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHY3	Replication protein A subunit	1	28-48	IYQCVRTRKNDPSNHANRKNL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI09	Nicotinamide-nucleotide adenylyltransferase	1	48-68	APIHPRTYKKHSKAGRHVSTA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIF4	KLTH0E12100p	1	369-392	PFLPLRLQKRRIQKRLNITKKALD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ24	KLTH0F12892p	2	2-28, 91-111	RSIRKSGESTCPKKRRNYQFISIKQTS, QVSMRKLHRHYRRIIKRREVL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJI6	Protein BIG1	1	295-320	LQTIQLWRGKPKQPDKTKITTEKKLQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK08	KLTH0F00858p	1	32-63	PEKVSSWKVRLQQKNKQKRTSQTSKRERDTPA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKA1	KLTH0F02948p	1	355-375	QKEWAEADKRKRPARKVSSLG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLF6	KLTH0F12760p	1	242-264	NTEAARRSRARKLQRMNQLEDKV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLN1	KLTH0G02024p	1	15-37	ETEGSKCCVERKPRAQHQVTWAE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMC6	KLTH0G07766p	3	1-21, 654-682, 711-735	MAKKGKTSTAARKQLRQKEDA, DVEDKKLAKAKRQEKKRKRLEAMRREAEA, SDDDEDRRPDKRRRFPERIEESEDR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMI0	KLTH0G09108p	1	2-35	SDLQNKRRRVTRACDECRKKKVKCDGQQPCIHCT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN36	KLTH0G13838p	2	1039-1058, 1134-1159	VFPLKDTTRKQKRDSSSKVL, PSPSGSSPSNLQRKKKKIDRGFIVLI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN60	KLTH0G14410p	1	102-125	AKPADPPPTKKKSSKSRMLKIFSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN97	KLTH0G15224p	1	562-596	GFVPFHSAKNLKRKNKVYKKNNKRSGKLDPLKNFK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNC5	25S rRNA adenine-N(1) methyltransferase	1	15-37	VERPPAIKPSKARRIIRRFHLLI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNP3	DNA-directed RNA polymerase	1	1187-1206	MKVTDLKKKLSQKLGRPFTL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E1Y3	KLTH0H00616p	1	123-145	MVALKRKMKSGRRQELRNKISRP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2L9	KLTH0H06028p	2	119-145, 336-362	KQSDNCSQSKRPPPKSRMANTKKWVET, DFEEKYKTKLKKRAKRVARKNMSSRTA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E391	KLTH0H11330p	3	21-43, 61-109, 672-694	VSEGTNSKSKPKKIQLTFQDFKN, MLESNRRRSRRVVPKRPVDEDDEETSRAAPKKKKKPAVKSKEPNINREA, EIESSKRTLRRSQRNRATYSKDD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3Q8	KLTH0H15576p	1	64-88	NGNGNPYKRKSTKDKEKMEERHVKQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBY2	KLTH0A06270p	1	361-409	LAQEKKQDVEREKRRQMRSKLSGQEQDKIDQKMREKRERRMRNRQKVRM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC87	KLTH0B01034p	1	35-54	QRSANMPKSRRPTWKRYVVW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEG3	KLTH0C08932p	1	409-432	WDSDGPKQKKKKAGQAKTTSYRAH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF01	Histone acetyltransferase ESA1	2	87-114, 407-431	AKEAEKDKSSSKKQKQKKNTPASRSSSH, EDVVQRYEKIKQKKGRNIDPAKLIW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHA2	KLTH0E02618p	1	15-38	RDSPSPIGVTRKNKRPNRAFHSFA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHQ6	KLTH0E06248p	3	30-50, 62-84, 277-305	PPTDRSPGSRHVKRQQKADDH, RSQGKGSTPKKRSQKFQHDGESE, HRNADGQWRKTKKRKSSSRSKRSNSSSRT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHU5	Mitochondrial group I intron splicing factor CCM1	1	21-45	VVIPASSKARRRRRDVGGIRKNVSV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHZ2	KLTH0E08360p	1	809-830	IEVRKFIPSLKKKRFHRPLFLI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI81	tRNA (guanine-N(7)-)-methyltransferase	2	8-33, 41-61	DDPSSKRQAYRLKKEENRKELKHVKI, KMDLPRKRFYRQRAHSNPFSD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJF7	KLTH0F16038p	2	349-369, 590-611	DAPNLRNKRKRANRQIQPLNS, LTNPQWARRKNFKKFVKLWPSH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJG5	DNA-directed RNA polymerase subunit	1	137-162	RMGILKKVVDQCKKQRRCLRCGSLNG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJI3	KLTH0F16654p	1	236-256	LTPSQRYRLRKEKNKTALQNS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJL2	20S-pre-rRNA D-site endonuclease NOB1	1	131-164	QEKEVLAKSKKKRRRGGKKQREKRQQQEQEQEQE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKB1	Cysteinyl-tRNA synthetase	3	24-43, 685-710, 747-772	SSNVKVNQPKWRQPQEPEGA, IMEKDQRQKEKEAKKKEQARLREAKE, VDITKSMLKKLKKQWEQQKKLHEEYF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKL4	KLTH0F05676p	1	56-88	DDGPVVVKKQNKPKKVKLRRYKPKKVDETSPLG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKM7	KLTH0F05962p	1	117-139	EVTRHTSQYIRRKERRNLNLNIQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL47	Phospholipid-transporting ATPase	3	55-80, 258-285, 1560-1602	AQRVTDWVLRRKREKHTKAGRVIPLG, DSFNNWERLRRRHRIKIIQKKWKDIKVG, LPSGKLIKRCKPASNNGPEDRPLTQKLGKKLRFKIKSKEEDVD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLD2	KLTH0F12012p	2	157-178, 422-442	GKETGILRKRRLKPKNKDFEMI, YENLRCWKHVLRRPRCDNGRY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMD5	KLTH0G07964p	2	76-97, 120-144	LPVQRLKILRHKQYLRRLNDNR, VTLRSLKRRANGRPTSKKVPPKSVL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMK7	KLTH0G09724p	1	789-813	AEESYRQKRLLNKKKKEQEFLQKIA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMP5	KLTH0G10582p	1	95-120	GSQEPVEKQKHRRQKKVASRVDRYSC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMW3	Structure-specific endonuclease subunit SLX4	1	81-125	PSRAATPPAKATKRKKSTKAAGRTSTGTGKKRKRTPSSIKSITQF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN62	KLTH0G14454p	2	133-154, 763-793	KSPSPLKSSKVKLKNPDSFPRE, SGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNK2	1,3-beta-glucanosyltransferase	1	356-384	REEHTRKQGSDPRRKKRRECPAISKTWKA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNP6	KLTH0G18810p	1	147-173	APASAPAKSKRQTKRDKNADKIRYKYK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E231	KLTH0H01738p	2	16-37, 40-71	KPSLKFKPKALARRSKEEREAS, KPAPEEIKKPFNNKKKYSKRENGPNGQRRIPK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2K9	KLTH0H05808p	1	98-122	AQTLYMSQTPRRRNNNNNNNGRRGQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E320	KLTH0H09614p	1	3-30	EQITHKRPIRIKIDKDKRKQLQDFYKLR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBH0	KLTH0A02530p	6	74-98, 486-505, 842-874, 897-925, 960-982, 1037-1058	SGFVVKLRKHLKSKRLTTVKRVAND, VSNIKKDRNDNKKKEKPSID, SGSNKETIKKNVRGKKGKMKKMQKKYADQDEEE, EEAAKLKEREQKKFRRERQKKQQSLMFGS, WPALTKYKYKVKVQPGNAKKTKS, QNEVKSKTKGTPSSKGKKKGKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBN5	KLTH0A04092p	1	231-250	SSGLRRSKRYQRLRSKGAEK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBV6	Vacuolar protein sorting-associated protein 27	2	39-69, 229-259	VIRSRRVPPKECMRCIKKRIMSSRSNPNRSL, FDDYETKKQSDKKRKKKKKGHGKSSSVRDQE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBY7	KLTH0A06402p	1	134-159	EAPAKRFKSQQEKTDKRERKSSKRKN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCF9	KLTH0B02728p	2	51-79, 197-217	DETAKQPQSKRQKKLAKSKVHQKKLEKLE, LKAPSSKDRQAKNKGKKKGDA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD13	KLTH0B07480p	1	278-300	ASSPTKFKYFKRIRRYQAPAAPP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEW4	Replication factor C subunit 1	3	15-40, 71-107, 827-850	KQPSKARATGTSRKRKEQPVNSASNP, DEEPQPRKRQRATAPAPKAKASSPKKSPKSKIQSAEA, DTDFKKDKLIKQGKPKVASKRAGS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFL5	54S ribosomal protein L4, mitochondrial	1	10-39	VTARAWARTKYTKPKPKPKARLNVRSPMQI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG60	Nucleolar protein 12	3	89-114, 363-391, 425-456	EEAPAQPKKLSKRQKRKALDADNENL, NGTGRKLRVTRCKNMKKTQPSSQKHPKAL, ATKGASTPILKKKKQRSKSGRVTKRSTAFKKA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGB3	KLTH0D03916p	2	1-27, 77-119	MAKQVAKKVSKKDVKSKKQEKEAVAAK, EEQEVKKDTKKDTKKDTKKEAKKDSKKDSKKEAKKETVKEAKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGR8	KLTH0D07546p	2	88-108, 145-166	EETSNKWKNRSKRSHEEEEDE, VDERLCRKRTSKRQKISNAIAK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH35	KLTH0E01034p	2	43-67, 532-558	LRDRLEQKASRKKAQRQSLERVEVP, NVSLAPSKAEQKKRLLRREQVWREHFD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHG9	KLTH0E04246p	1	86-109	NGKAKKDSRNTKVKKKRKVSESSN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHJ6	KLTH0E04840p	2	51-83, 147-168	VLVFKPSKSSKPKKSHKSKGKKAKNPERSVQRK, EPELKAKLKSRRKQVIHEIQSN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHS2	KLTH0E06688p	2	312-334, 341-364	AGVVKKKRLGFPKTRGRKPSPIL, ACDFCDRRFKRQEHLKRHVRSLHM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHT5	Chromatin modification-related protein EAF3	1	89-112	ASNAKKKAVSKPKKIEAKKKRSAA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHV7	Dolichyl-diphosphooligosaccharide--protein glycotransferase	1	710-730	RGSSRGIKKRVAKKPLLDVRV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHZ8	KLTH0E08514p	4	64-88, 216-255, 324-350, 437-456	QSPIQRVRSLRKRTAIQKKPYSLDR, ALNDSRQSKRQLPKQERRSGKGVAKRKKQKVNQRQDDSLF, STISADSKRSKRSKRPRQPSTSKLDKS, GKPGAFPKYRRPPHQKLIEF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI61	KLTH0E09966p	1	360-381	SAAKLKAKKKLRGGPQVHQKYV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIE1	KLTH0E11792p	1	140-161	FVKAVRKIYRHRRRSTSHEHAS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIX0	KLTH0E15818p	2	65-86, 409-431	LEDPARKLLRKRRIVRNTLSGA, LWFIEAKRKLRWRWRVNGLIPQF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK84	KLTH0F02552p	1	3-23	NAKLRGKRVGRFLKRHFPCSR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKW5	KLTH0F08074p	2	543-592, 609-635	EPFLTPSSPKEKPRRKNNSGSRSRTGCWICRLRKKKCTEEKPSCHNCLRL, TSKKNEKLEEIKKKTKEAKRMAMRRKP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM18	KLTH0G05236p	1	138-169	ADSRSHTLSTRKKNKEPRSSVPKKKRCAQTTR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM33	KLTH0G05610p	1	191-216	PKIYLVKREQKKIRRNRRKLLQEEHE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMJ6	KLTH0G09482p	2	59-83, 463-482	SHIFTNRISRWRDRRKNRNLTFIGN, LIKTRKEKLKIKNDMKDRKS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN09	KLTH0G13244p	1	308-329	FEEKLRIHKHAHKTHQRLKWVS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN22	KLTH0G13530p	1	555-574	GIPTKWINFVNKLKKNKKRK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E1Z9	KLTH0H00968p	2	13-50, 57-76	SVTACAKRTHRKTGCVPCKIRKKRCSEHKPVCTDCQRL, LPEKCPKEKVQYYREKVEKQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E229	KLTH0H01694p	1	412-435	QAIFEKYSERRHRRSSQVVARWIA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E393	Glycogen [starch] synthase	1	571-596	DYMESFVKKTRRQRINQRNRTERLCD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3P0	KLTH0H15158p	1	81-101	LSEKRSQDSRHYRKSEKEEDA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3T0	KLTH0H16060p	1	12-41	QLHLAYRNSSKQRRFSYKRNAQKISQKRLQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3T5	KLTH0H16170p	1	1-39	MHNKQTKRNRRLHVCDACRIRKLKCDKAKPNCSRCAKHG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBF7	KLTH0A02244p	2	510-558, 571-595	KKTKEISDKKKLKSELKKKNAAWSNKTTSKETRKERKVKLAEKRKAIEQ, GEEDWKDLVRRNKKAKTCSQIQGDF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCY5	Anaphase-promoting complex subunit 1	1	1381-1405	KNSDLFRTPLRKRQQKRNHTEDEMS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCZ6	KLTH0B07084p	2	1-25, 42-71	MVDEKKLTKKQLKAQQFRKTKEERE, PAEDEAPRKKRKTRRGKGGKGKKGNRFIVF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCZ9	KLTH0B07150p	1	729-756	TNRAEGTPKSSSKRKKSKNKNKKRCYNK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD76	Atypical serine/threonine protein kinase BUD32	1	49-74	IPVKYIIKYRPPKKYRHPSIDKTLTK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD89	KLTH0B09240p	1	172-197	APGSALNPSKKKKKRGLFGRKKDTAE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDG5	KLTH0C00814p	1	34-72	SDEMSSRTSKRRIKRSGLACVRCRRRHAKCSGEKPCSTC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDW7	KLTH0C04378p	2	441-463, 481-501	VNILPIKRKSSPRDKNPSEQITS, PSDSHDETKPTKRRVKPTLLL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEE7	KLTH0C08580p	1	60-83	IFSQIMKKDEQKKKTKELLKPIIS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEX8	KLTH0D10604p	1	110-131	GSFSRWKTHRRRGKSIPQDQKE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG23	KLTH0D01826p	1	1128-1151	YLTVDWPRWLRPQRFRPRQLAAAK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGA0	KLTH0D03564p	2	26-48, 725-745	SQACDRCRLKKIKCDGIKPTCTP, ELPFFKKKRSNKTTIAQPPPI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGK2	Non-specific serine/threonine protein kinase	1	631-654	AQKAAEKKREDRRKKIQQLYAKLT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGW0	KLTH0D08712p	1	103-127	GYVAIKCVPKRPRKSQQYSMNQVLR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGX9	KLTH0D09152p	1	23-48	AYKYMLKDPSKKYKPFKAVTLPNRKW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH25	KLTH0E00814p	1	807-832	GNRSRFFKLRSKSRSRSVSPFRKQSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH83	KLTH0E02112p	1	427-449	LDGSRGDYRRRRWIRQCTRIAEQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHD8	KLTH0E03564p	1	79-113	AQKPVQVLTKSQRKKNKKNKKSKQKPKPAADLSET
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHX2	KLTH0E07832p	1	434-455	LRDQAKCKKKYGEDWDKYCKEC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHZ4	KLTH0E08426p	1	317-360	IEKREIEKERNLRRLKRESAKVEDRSSRRSRKRRVDDLETTLRL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI34	KLTH0E09372p	1	895-927	GKRGGQPEVKPKSKPKRNKKNKNRGANTTHSNS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIM6	KLTH0E13706p	1	363-384	NDSLDCYTRRRMWKRRAFQCSH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ69	SURF1-like protein	1	36-58	VDWKPIKSSKTPNDEKHKKPFTR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJE0	NADPH:adrenodoxin oxidoreductase, mitochondrial	1	281-306	MLPFDQRTKKNYKKHRPPEHGLNRQW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJL0	Fe-S cluster assembly protein DRE2	1	243-268	ITVVTCGKTKTRRRKACKDCTCGLKE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKW2	KLTH0F08008p	1	226-245	RESLLHKREMRKKQRNFLDD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL89	Ribosome biogenesis protein SLX9	1	71-95	GAISKSAIRRRKRKLRDQLKPKMED
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLK6	KLTH0G01452p	1	1-25	MPPASASKAKREAKKAEREAKRLAE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLU8	KLTH0G03696p	3	1943-1964, 1979-2001, 2012-2040	PMSASHTKSAPKRPNRPSSIIS, ALNTVRRPKIQPHQKPSNPRETA, VERTQNIKISKKEKSRRSSFRKSVAETLH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM89	KLTH0G06886p	1	39-66	AGSTPVSTPSKKKKRAKKPATSVKVQEA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMT9	KLTH0G11572p	1	292-312	EQSSKNKTPKALRKMENVARK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMW2	KLTH0G12144p	1	342-372	LTSNKHMTPTKSIKRHKSKNHERRHSIQSSD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMZ3	KLTH0G12870p	1	159-180	NPTTCRFHVQRKKFNRETRQGE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMZ7	KLTH0G12980p	1	202-229	TAKRRNTQHNARSQRKLRKKLANQYEEI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNC8	KLTH0G15928p	2	163-186, 888-913	DSRGSETKVKRKKLLSKIFKGHGH, GLIPVKKAAHSRHKRNKILQNGESNA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E1Y2	60S ribosomal export protein NMD3	1	396-427	DVVLVKKQYIRKTRKNRSWKLKRMAREHKDIE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E254	KLTH0H02244p	1	96-117	EASRTTEKQRKKQIAFPQRKFA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2D4	tRNA 4-demethylwyosine synthase (AdoMet-dependent)	2	128-151, 749-772	HAFKPARSSKPKSGAKKMPRFISR, FAPGNTRFYKKKRGQEAQAKEEQG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2Z4	KLTH0H09042p	1	217-242	ATAKQAPGKPSTKRKTKKTKTSCVIL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E307	KLTH0H09328p	1	97-133	KTEVRKAQREDKKKADKEKKKADKEKRKAEKAKLAGT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCF4	Ribosome biogenesis protein RLP24	1	26-60	AKEFRFCRSKCHKNFKQRRNPRKLRWTKAFRKAAG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCJ8	E3 ubiquitin-protein ligase	1	1134-1156	EEYEKRKQLAKHKREKIMKRIAK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCS2	KLTH0B05368p	1	26-47	LIRSISSKDLRRKGGRRNGYLS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEN5	TBP-associated factor 4	1	13-32	QENLRAKRPKKEEQEQIFDE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF33	KLTH0D11858p	1	65-84	STQSRVARLRQKFKNCVVTP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF95	KLTH0D13310p	1	290-309	KAEREERMKRKAEQRAKKAN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFM0	40S ribosomal protein S1	1	1-28	MAVGKNKRLSKGKKGLKKKVVDPFSRKE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFR5	Mitochondrial genome maintenance protein MGM101	1	235-261	EKFVEHVTTKKKRKIWLRKDREVEYPY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGA5	KLTH0D03718p	1	29-88	CDQDHLSQKKRVTRRRHRNSRLGCDECKRRRIKCDETIPECRNCQNRQKREPGKRCSYLS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHD9	KLTH0E03586p	1	606-630	PGMIHKPPSRSQNQRHRARKTAFSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHG8	KLTH0E04224p	1	61-90	VKPRGPVRTASKSTKEKRNKRSSWLFSDDG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHJ1	Regulator of rDNA transcription protein 5	1	103-126	VPYSPRARAERRKEKRKVPAPQAE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIY5	KLTH0E16148p	1	1157-1185	AAEEKHRVEQKQRAERKRREQSNIDYSPK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJP2	KLTH0F18018p	1	219-240	LSKPGDKGKVTKKRKNVFKSPR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKV6	KLTH0F07854p	1	27-72	VDGKKVSKTSTGKRKFHKKSKNGCDNCKRRRVKCDEDKPSCQKCIN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL06	KLTH0F08976p	2	126-145, 543-570	NDAPKRQTTRKRSLKIEDEE, VDQAYIKRIRVPKNKKKKQQASASALNS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL62	KLTH0F10296p	1	114-137	IKSGMVGLVKKKKKKAKAKKSQRK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLA5	SWI5-dependent HO expression protein 3	1	390-416	QSQKGASKNSANNKKKRMSSHSYSKSN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLG4	Coatomer subunit delta	1	5-31	PAQESAFRKKRDHQKDRHTPQLARRVS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLU6	KLTH0G03652p	1	501-522	NMNKKLKKLKAGEKKEKLRAKY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM88	Transcription elongation factor 1 homolog	1	1-20	MGKRKKSSRGPAKRVVQKLD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DME4	KLTH0G08162p	2	1-37, 40-66	MPPKKKQQQPVKKKDNVDKTFGMKNKNRSTKVQKFIQ, QTQVDPKKEEMKRKKQEEKLLRERQEA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMN9	Protein-lysine N-methyltransferase EFM6	1	200-222	VLMSYRKRRKADRIFFKAIRKNF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMT6	KLTH0G11506p	1	174-200	ALISTQKMKAKKKVKKKKKSAIDDIFG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN10	KLTH0G13266p	2	197-217, 248-276	NDPIKRKQWKHVVLEKKRRNA, SPDENVPRKKLKPDRTPNKRIPKHVLLNY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNJ5	KLTH0G17556p	1	20-39	LEPVKDRRRRRSSSLISHVE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNL5	KLTH0G18106p	1	1-24	MAVQKIIRKKPKAKVDPLAKQKII
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNT5	KLTH0G19690p	1	486-506	YFDFGKQKSLRRKFKSPAELE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2C6	mRNA-capping enzyme subunit alpha	1	400-419	MKSNWEKRQIEKKRGFQEVQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2J6	KLTH0H05522p	2	1-31, 613-639	MPPKEPPKKWKAPKGPKPIQRKNKNTIGLGR, KTQAESSGGKKHNKKNKKGKTRAKFSD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E334	KLTH0H09944p	1	1116-1139	ASKSPSSPKVTKKPESKPSRSLSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E366	KLTH0H10758p	2	58-81, 364-389	DSEPEKQKQMTKKEARRREKEALL, VWQAEVKDKKRDDKRAAKFVNNQPHY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3C3	KLTH0H12166p	2	8-54, 272-291	NPEILLRKRRNADRTRLEKQELAQRRQQLKQKQARARKNKFERAETI, SKLQKIRQREWQKRALKVSN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3H9	KLTH0H13706p	1	50-81	PEGGKAKKAANPNKKQKKDKLPREERNLHKEE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBQ4	KLTH0A04532p	1	96-126	MKLEQAKQVRKEKERKLRDKERKENEFANRK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCH9	KLTH0B03212p	1	764-787	LFYYRWCIRTPRKVRKRMEVVSEN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDB0	KLTH0B09724p	1	560-585	KAKQAEDDKKNRKDKKHNAHEVKTND
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE20	AP-1 complex subunit gamma	1	32-56	RTKLKDDHLPQEKRRKNIHKLLYLH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE45	KLTH0C06182p	1	741-762	AVKSKSTRSKSNKNVPRKMKTS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF79	rRNA biogenesis protein RRP36	1	286-316	DHMKAKQREKVMDRKRKKRLGKEFKQFSFHN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFL7	ATP-dependent DNA helicase PIF1	1	369-393	DSKILLKKVRRSKKHVKRWASIKAL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGS2	KLTH0D07810p	3	35-54, 332-355, 381-418	AKTFNAKGKKTSKRIGKLLS, DEEPLKKRQKTSRESKNTKHDKAT, AQQSSNKPLRKNRRGQRARQKIWEKKFGKNAKHVQKQM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGU6	KLTH0D08404p	1	153-172	AKSQTQRQSQHQRQPPQQDY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGU9	RNA polymerase II degradation factor 1	2	1-27, 65-95	MSTQSRKSNSSKQPHSTHKKLDPELKF, AATKWDEVKKPSKKERQREQQQQQQQQQQAQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHC3	KLTH0E03124p	1	53-74	FSRLDVKKKHFARHLKNSNEGF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHP9	GPI ethanolamine phosphate transferase 3	1	22-41	EDKRLFKSRIQRFKTTHRLY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHV2	KLTH0E07370p	1	180-199	AAAKKSRKSRSKKNSLPTGL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHV5	KLTH0E07458p	1	607-641	EEEDRKTSELKRRRLLRKRKESGKQKARRSPESEA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHZ7	KLTH0E08492p	1	619-643	LVKMCCEEKEKNPKKNHNPILPIAK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI46	KLTH0E09636p	1	74-93	ADPPRPRKINSKRSERPEEI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI75	KLTH0E10296p	1	1451-1471	EALLRERSKKRSPFDARQMAA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIH2	KLTH0E12496p	1	1432-1454	TTDGKNQRERWSKQKRPVVEQII
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJ86	KLTH0F14344p	1	2-25	ARTNVENRKRKRSGAPDPRSNLPD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJK1	KLTH0F17072p	1	294-319	QCRFDFKKQCSDYKKWKQQQMLVKKP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKM2	Altered inheritance of mitochondria protein 23, mitochondrial	1	343-378	SKKEDRMALKEQRKRERQEKLERKLEKKKLRNSENY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLC2	KLTH0F11792p	1	33-54	VHTSWKKGKCYQYKLQHNPTLD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM17	Non-specific serine/threonine protein kinase	2	36-57, 593-618	NYAIKVCSKKHIIRERKVKYVT, SSASRPTSATKSRPKQKINSSPRMVV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DM49	KLTH0G05984p	1	157-176	EPTHQAKKRKVENGDARRLA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E1Z0	DNA replication ATP-dependent helicase/nuclease	2	33-58, 1495-1519	SAVTRASRKKAVQSKKKYKFAPVDTL, SYNIPRPAPSQHSRRKKQGSVVANI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2U2	KLTH0H07722p	1	67-96	ECNNEKSQKDKSKTKVKRKKKPVPIEYDVV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBK7	KLTH0A03410p	2	1-23, 143-163	MVKTRNASRRSQRVDYKEKQESN, KEPPRKRTKVTDFFRKSKKEP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBV7	KLTH0A05698p	1	268-295	EWQRREEGKAQRREKKYQAKMKEMRVKT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDF7	KLTH0C00638p	1	248-275	GKPTYVCSRCVKREQRRASRRKSGLCDN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE36	KLTH0C05984p	1	171-200	AQDRRNQRFHLKRGKAKEIRSSQRHRREFM
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEG5	KLTH0C08976p	2	598-618, 665-685	DMMFDGKKAKKNHKNDPDYVP, SNKIDSTKSPKQSNKDMCKYI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEM7	KLTH0C10516p	1	1-39	MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEM9	KLTH0C10560p	1	496-515	MYEYHTFKKSKKMPSEKPFA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEX0	KLTH0D10428p	1	1-25	MNESSQKKRKKVSKACLYCRRSHMI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF04	KLTH0D11220p	1	1-21	MKLTRRPQRPIKALKRAPYYL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFS2	Vacuolar membrane-associated protein IML1	2	141-161, 1195-1214	SALPRRETATKKKKAFRLELG, SLNLVNRKWHWKRHNNCFIG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGE9	ATP-dependent DNA helicase II subunit 2	2	29-51, 111-135	IEYTLFLKSKKQRKTDWVNCFLA, SSVSMRDEFKKRKVRKRIIVFTDNL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHB4	KLTH0E02926p	1	31-63	SLGFLKPSKRNPLVRKYTRTRRRYGPDQQSFRS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHS8	KLTH0E06820p	1	308-335	FTRVNVKGNKAERRRAKQKERAARANML
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHY0	Calcium-transporting ATPase	1	507-526	NPFHKPRKTLFPWSRNNRKE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHY4	KLTH0E08140p	1	1-35	MKVIKRRRSIKSCKYCYEHKLKCNKQSPCNNCARL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI37	KLTH0E09438p	1	30-49	PTNVDKWKHIKNSVKKEFLI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKD5	KLTH0F03762p	1	659-684	LVEKNKRRKINAGRRRREKDKEKTSA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLN6	KLTH0G02200p	2	23-46, 327-368	FTVAPDQKRRRVCCQPFYNNAMKR, ISQKKAFLVEQKRKRRQQERQRRAKSQKNEKQPEKKNISPSD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMH2	KLTH0G08888p	3	23-45, 129-151, 508-527	ARNDTPRCARPQRATPRSQRAAN, AATRQQRQSLRRDRNPVRQRLSH, STQNSFKKARPPYRVRTYSS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMJ4	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	1	179-202	KTVYSQEKYLKRKKQKFAKFFTVE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMY5	KLTH0G12650p	1	531-551	RGASWKDYFNRKKKARDLAGD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNC7	RNA exonuclease 4	1	13-34	TQKVHKPSKGKVSKTTKRKDVI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2Q8	KLTH0H06952p	1	341-360	RNTCRDTKVILKRKLQKRDA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E399	KLTH0H11572p	1	1-42	MGAQMKRKRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3H0	KLTH0H13508p	1	117-136	ICTKCSRKPHSVRCIRGVRK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DB87	KLTH0A00550p	2	18-40, 365-385	VGSPLQKRCSNPRQNTGPKESQA, TKPSCTKSKFSKTSCTKKSKS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBR7	40S ribosomal protein S24	1	96-125	LAEKVEKASRQQRKQKKNRDKKVFGTGKRL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBW8	Uridine kinase	1	469-489	ALGTHHCKWARKRFVDSQYFG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCE5	KLTH0B02398p	1	49-70	ATNNFCKPNKRLEKPPRGERAL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCG2	General transcription and DNA repair factor IIH	3	11-39, 59-81, 409-432	DESLNRPKKQVRGRTSKGKKHVRIEEDYN, DSGPSNGRKKKKLANKNLQGANG, TDTCYSCQKRFPRLKNQKTQELLT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCI9	KLTH0B03432p	1	34-53	VEAHFKKKDPRDTRSSNVRN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDW2	KLTH0C04268p	1	22-43	DETSTEKKPRAEPKKYREYTTV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDZ0	KLTH0C04928p	2	3-24, 141-160	RYAVLRCAQKHARPRNRCLRAS, YAGVRRRKLRGGFRRRGGSH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE02	Lysine--tRNA ligase	1	25-68	EMVSKSELKKRAKQRQVEAKKAAKKASAQPKPEPKKKSNDAFAD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF14	Leucyl-tRNA synthetase	1	159-181	VTKFKAKKSKAAAKKGRGKFQFE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFY0	KLTH0D00836p	1	156-180	GPQIATKRPRPPKAAKPKHLQSSGW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG85	KLTH0D03190p	2	22-43, 70-91	PGKVKVSGGRWKDRRKAKAMLN, VEERKEQPARKQAKKVQIKATP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGA8	KLTH0D03784p	4	17-39, 658-683, 709-729, 1012-1033	QPVQPNQPYQQQQRYPRNSGQKS, GRSNSRSSSKRKSKKMGDDRKSNRAY, SANRWVPKSKQKKTEKKFAPD, EERERKMKGSSRSGSRRNNSNS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHD2	KLTH0E03410p	1	18-47	FAEVKDQKNKERHKMRKQRAKEERENPELK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIG7	KLTH0E12386p	1	54-81	QAPPAAAARKRRKPLRKDAPRRLARPAF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIU9	Pheromone-regulated membrane protein 10	1	231-259	EDKVDHFKRFFRRRSSTRRRSSHDSRPSG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJP9	Patatin-like phospholipase domain-containing protein	2	778-806, 812-831	SYDSPLKSYYKRNSKQHRNRSPTVSRTST, GKTSSRSKSTTKQEFKNPEY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJY7	KLTH0F00374p	1	3-33	STKPSFKVLIKKKGKTLNRRLKNSSKSYREN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK62	Sterol 3-beta-glucosyltransferase	2	19-41, 479-498	ATVVESPKRRWRRSMPPVGRMYQ, HPERRGRSRSTSKKLFKRVL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DK81	KLTH0F02486p	1	228-251	LKVPRDMKKDVKVKNNKQNAHDTD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLH1	Glutamyl-tRNA synthetase	1	169-188	QELKKASTSNKKKETHKANF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMI3	Regulator of rDNA transcription 14	2	58-84, 142-171	RERDAHSIKKREQRNRRKLQRARQLAE, LRNTSQRSSLQKRKRKQRRDDFDESKKPVS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMU8	Nuclear mRNA export factor	1	24-58	GSHNGFTKKSHPQKRDKGRKQNRPGKQLSRENLSR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN50	KLTH0G14190p	1	177-205	RGQKGKGRTAGKTRKPREKKPLTRLEEMA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN67	KLTH0G14564p	3	13-40, 106-129, 299-325	REAVREDKRVPARKKRRLLRYDTKDVTG, SITLNTSKKESKPRSKNLISNEDR, LEDSSSRPLPRRRQNKKEKDSDAKRYS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNA1	KLTH0G15312p	1	542-563	TTTMSHKKPKPSKTTSGRQFSD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2Z0	KLTH0H08954p	1	611-635	KPEANGTQTSSKKKKNKKNKKKGKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3R4	KLTH0H15708p	1	64-83	VSYKLYKEKNPSPQKPQSAT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBV9	KLTH0A05742p	1	27-60	GAAASHRHVHKKSKKSSQESKKTWRESRRIVFSL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBW5	ATP-dependent 6-phosphofructokinase	1	16-39	KDKLREVRPKRANLAQRRSKSNFS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC37	KLTH0A07524p	1	15-38	SESLTTKSRKPPNTAFRQQRLKAW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCX9	KLTH0B06688p	1	89-111	IQRFKKRYSASLLKKKRRGGGKF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDM0	KLTH0C02090p	1	88-108	KGAPAKKKEASKDKSKTKKRK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE16	KLTH0C05522p	1	77-97	GANRAKFKKCRFKVSSQGINN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEX9	KLTH0D10626p	1	223-250	GGSSSKNSRALKRKKKSTKPKSICGYHP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DF17	KLTH0D11506p	1	31-50	GLLLKRRYEVPKRRWRVWFF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DFA9	KLTH0D13618p	2	175-198, 370-390	AGPAPRAAKPRRKKQCPVCHNFYA, EYPPGTKKKDRSSVPGRCKQC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGX5	DNA polymerase	1	88-108	DDKPRERAAKGSKKIKNDGKG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHF0	Non-specific serine/threonine protein kinase	1	635-664	EEGSSERRKRKRGSRGKKKNKKVHEFSQTD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHU6	rRNA-processing protein	1	108-132	ATKMHAKKVDRLRRREKRNKALKER
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI69	Ribosome assembly protein 3	1	3-33	LEERNPARNSGKRTRRSKKRRTAESSDSESS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJA2	Pre-mRNA-splicing factor SYF2	1	175-195	NEKNKQFNDKIERQTKKREEN
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKC6	KLTH0F03542p	2	380-404, 528-551	TREAPKIPPPRKKSPTKACRSTNSS, QKIQSLDKELKKKKQASNLGSERF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKW0	eIF-2B GDP-GTP exchange factor subunit epsilon	2	1-21, 515-537	MAGKKGKTPKKSVGGGKKPEV, SISSTAGKRKKKRSMSTNSIYTD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL57	KLTH0F10186p	1	144-167	NRQDSRPAKKLKSEKKKVAEENLP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLX3	Serine/threonine-protein phosphatase	4	2-23, 35-57, 189-209, 641-663	GNTSSKVSSKKNKVSRDSAPPF, GKSTRSVKSSKSRRSQSSQNAGA, NESHHHRRRSNDSRRYSQKSP, AALKQVMKKGRQERKLANQQQQS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNF1	Trehalase	1	37-56	EGESRGTNRHHKRTNSLDQF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNF7	KLTH0G16588p	2	1-24, 2434-2492	MVKQKVTSKSSKRYRYSSFKDKID, IYSSVKHEVTRRRYERRAKRATLAVVAPEAAARRKLKKHARSKEKRKHEKDENGYYHAK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2L2	mRNA cap guanine-N7 methyltransferase	2	54-94, 118-137	KKELEKPVFKIQKRKHQRYDSEERRKKHQLHKMREEQIKRH, TFVAKRRRRHLSPIIKLRNF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E321	KLTH0H09636p	3	65-91, 458-488, 633-652	GNTTRPHPSKALKKRPRAAPKPSMASQ, EDEFGTADKKKKPRRRRVHIRRQIKKASGHH, GFSHKDKQRQIKQEIKSLKK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E394	KLTH0H11440p	1	275-301	EYFIDPNKSKEHKKKQKESKSSDGKCS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3Q1	KLTH0H15422p	1	61-80	VESPSKPSRAHRRRPVSIAF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBD7	KLTH0A01716p	1	9-37	KKELREKKAQELARRKRARDNTERKEDTK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBI1	KLTH0A02816p	4	54-81, 445-466, 503-527, 594-617	NESGPHKRRTKEPSKYMRHLKKPDGEFF, RALAPKRQSRKHAREQANDSME, PEALQAPAKKKQKRKTGPAAPASQV, MATVIGVRGKKRKKFKDGLLGFET
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBV1	KLTH0A05566p	1	152-171	NGTTHSSKKRSNKHNSQIDT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCG0	KLTH0B02750p	1	478-502	QLYIGYLCKKENKKRDREQEGQVTS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD97	KLTH0B09416p	2	82-107, 118-141	EKNSGDQKAGSKRRRRRSSGVAGPSL, HSSSSLNIPKRKKKSSQPASLSIS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDA7	KLTH0B09636p	1	16-61	ETAKKSKLSKPAKYTENNKKAANFTTKAPKKKLKKTIKICSKTINY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDT8	ATPase expression protein 2, mitochondrial	1	512-539	FEKHRNAYSARKQRRTEAAQKAQKRFDD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDX8	KLTH0C04664p	1	283-305	NDSEDGHKKRKRRIQVVLDSDED
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DEA7	KLTH0C07656p	1	235-263	DDETSKRVRTSKNKKRGPKPILKKRSVSE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG11	KLTH0D01540p	1	224-250	AAAGARKKRAPRKRLTAHQKQAHNKIE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DG17	KLTH0D01694p	2	27-50, 62-83	GAYVRVRRRGRATARPRSARRAAP, GRPQACSRCRNHKIKCVHNGEA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DH44	KLTH0E01232p	2	89-124, 389-416	ESSNEEKSKPGNKRKKSPKTAKAAKKQKLSKKSSSS, EKLGRVRGKDFTKNKNKMKRGSYRGGSI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHZ9	SWR1-complex protein 4	1	329-353	NSHIQNQVKKTKKQKQEMQIAVKRK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI19	Ribosomal protein L15	2	60-80, 180-204	VIYRVRVRRGNRKRPVPKGAT, FHNTQAGRRKTWKRQNTLSLWRYRK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI24	KLTH0E09130p	1	13-38	DDGYRDFRPRMPKRQRVPPVVQLCKE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIC6	Probable vacuolar protein sorting-associated protein 16 homolog	1	715-740	IGYHPFFKYCLKQKRKKEAAVYVRMI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIX4	Histone-glutamine methyltransferase	1	6-32	LNSRHARPSPGTSRRRSRRIIQFTNFS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJB0	Actin-related protein 8	1	46-69	SNPNASKVKKPDPHAKQQTKVPGH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJG4	KLTH0F16214p	1	59-78	LEKIKDNKEKIKNNRQLPYL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJM1	KLTH0F17556p	1	111-137	SDEIKRRFYKNWYKSKKKAFTKYSAKY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJN7	KLTH0F17908p	2	75-100, 554-576	AMIELKRSLKKKKTEAKKQAVSNFQQ, DKSDPTKILKKKVRHLGSKQAAI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKA6	KLTH0F03058p	1	1270-1290	DFTDHFYKVKRDDRQKSQIEW
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKT8	Protein FYV4, mitochondrial	1	107-128	FFGGERKRKETKAKLRAQERNA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DL22	KLTH0F09350p	1	1191-1214	GQDQKHLWLKKRTRPKQEAEVSLQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DLD5	KLTH0F12078p	1	2-26	PHQLIPEVYKRRRKQLQDDLVNQVS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DMA2	KLTH0G07172p	1	347-370	ALSTKCSTRSSRPRNTTRAPPIRG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DNA5	KLTH0G15422p	1	206-231	LPDARKPRRRWTTRDRNLRRQIPKCG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DBG0	KLTH0A02310p	1	550-569	SPEASAKKVKYKNRIRFLAI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC26	KLTH0A07282p	1	702-725	SGDCKARIWKYTKKSEPKLREVKE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DC64	KLTH0B00352p	1	1-46	MEHQHPIKIQKRNRPSFVCQECRRRKIKCDKKRPRCSRCVDTGLPC
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCJ9	E3 ubiquitin-protein ligase	2	21-40, 1266-1285	QNEPHFKKAKGPKDRAELDK, IHYKCFKRYAQKKRFSTNSF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DCR2	KLTH0B05148p	1	90-111	DAYRECKKQWLQARRRNRSQWE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DD51	KLTH0B08338p	3	16-39, 218-244, 518-548	SDSDLKKAYRRKALQYHPDKNPDN, YSRNYDRRTKREIKKRNEKLRQQARSE, DTESDSWDNNKKPKKKQKGKNKATSSVQPSP
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDI7	KLTH0C01298p	1	11-37	ARIGSQLRFYRKRLKPRYNHVPQVSSL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DDK8	Maintenance of telomere capping protein 6	1	471-496	MLSWRRVPIQDNRKRWKRVINSHLGS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE26	Condensin complex subunit 2	1	486-510	QGSEKGRDTNKPKKPPKQKFTLDFF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DE83	Aminoacyl-tRNA hydrolase	1	40-59	KDILKRCKAKAKKEQEMQGS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGC3	KLTH0D04136p	1	250-271	TDRFTCGKCKEKKVSYYQLQTR
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DGQ8	KLTH0D07304p	2	20-45, 104-131	NKIAGMKKQATKSKRKQVNSRCEELE, DADKQQTAPQPKKRRNRQKERLAKRDAE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DHN5	KLTH0E05786p	1	44-72	IRKTPQACISCRRRKVKCNGCRPCSSCKT
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI36	KLTH0E09416p	1	176-201	IQEQERKSAKKAKKQKSKTGPDFEVS
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DI43	KLTH0E09570p	2	15-40, 100-122	IPKTDSLVPRHVKKRQKSPIFIDLET, SGNQNDAKPKPVRKQKNSFTESL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DIK6	Translocation protein SEC62	1	221-243	GESECYSYIKKMKRRKRKMNKKD
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DJZ2	KRR1 small subunit processome component	3	222-251, 268-292, 309-332	RFLPMFKKRNVARKKPKNIKPKENKVYTPF, EYFLTKKEKEAKKLEERKREQAEKQ, KGYEGSSKKRRHEVQESPKKKTKV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKC1	KLTH0F03388p	1	111-131	TAETGKKSKKKTYTYSAVKLA
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKC7	KLTH0F03564p	1	905-925	QYSSRSSRLRNRRRLVCRIFQ
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DKK5	KLTH0F05478p	1	9-37	TLPQRTVHKAPRIRKHRSARSQTHRQMHY
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN64	KLTH0G14498p	4	40-61, 84-110, 1263-1284, 1387-1406	EDEQVVTRRRGRKAKQEDDYMT, EDVAYSKTRPRKRATAKSKKKAADDDI, GVLAASKKRQRKPASSRSATPD, IEAHKVQSKNHSPEKFRKHL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E277	Glycine cleavage system P protein	1	204-227	LSFNTAKRKKSKFIVDKRLHPQTK
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E281	KLTH0H02838p	1	16-37	LANMTRTYKKPKVNDNRTQLEH
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2B7	Ribosomal protein	1	89-110	DLKKLNKNKKLIKKLAKKYSAF
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2M7	KLTH0H06226p	1	396-418	GQNCTNKRCKFRHARSHIMCREG
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2U6	KLTH0H07810p	2	1-25, 471-493	MTKRISKPKKPKRSVHWKYIKEILL, SNEIRAQRDSKRNLKNVTRYKMV
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2U8	Required for respiratory growth protein 1, mitochondrial	2	205-225, 313-335	GQIIRREKRKNQKNIDYWEKC, QQFFARKSDKMYQNRKKRFESLL
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E2W7	KLTH0H08294p	1	587-608	CVSGSKHKFRRRKEDAKCLVKE
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3A6	KLTH0H11726p	1	17-44	HYEATSPPPQKKTKTRRRGWTKLIWGFI
UP000002036	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5E3K4	KLTH0H14300p	1	215-235	LNYQKRLKNWVRERSSRRLKD