ProteomeAccession	ScentificName	ProteinAccession	ProteinName	#NoLS	Positions	SegmentSeqs
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H2P3	Pc13g14850 protein	1	215-236	AAIFLRWRRKRSPRVVGLHRGE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3E7	Vacuolar protein-sorting-associated protein 36	1	83-109	LKSSPKLTIYPKPQKKKTDKSSSATAS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H7C2	Pc16g02390 protein	1	118-137	LDKMKKGGRRWRHGHRERAY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H8R5	Pc16g04470 protein	1	1-30	MSRSFTGCKRCKARRQKCDEQRPNCGRCQT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HCB9	Pc18g05730 protein	1	677-701	SAEASRRPKSKRRVSLKQQQDRQLY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDI6	Pc20g07160 protein	1	243-263	TELYRRPWSSNPKRNRRLGAL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HE82	Pc20g02080 protein	2	245-265, 543-566	TTASCSSRSRRRKQPPSGLTL, MNSLRSLNCQKPQKSHKKTNVTTI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGW0	Pc20g06630 protein	2	1-36, 51-71	MPQNKPRRTRSLGGCKTCKRRHVKCDQNRPICQTCS, WVPAKKSQTSKRSSNEKRGYL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJ89	Signal sequence receptor subunit alpha	1	192-211	PYFPQKRKSGKTSEKRTQGS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HMD1	Dynamin-binding protein	4	501-521, 1149-1172, 1230-1256, 1532-1555	AEPPPKKSPPLRSSRPRQPVS, RKDSPSPEQRRLKKRRHIIKELVD, YVMPKTLRWTSKRKRKNQPPESTTPSG, LYNAPQRVMRKRDKRLPEYARYKA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNR8	Squalene synthase	1	346-369	CDTFRQYTRKIHKKNTPKDPNFLK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQ08	Mitochondrial distribution and morphology protein 34-1	1	355-382	LGASRHSRAHARRRKKRVVDLRSRPTTP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQJ5	Pc22g07080 protein	1	106-127	SPSTSKTSPKPRRPLRARKAAM
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSL5	Pc22g04010 protein	2	503-532, 624-646	TPIIKPPKVKPEPPKSRRWRGRRLAVDEEE, QAPLPPKTRRWGRGKPQHGQSDS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HU04	Pc22g09310 protein	1	10-31	RVDGRWYRLRHPRIRVSPPEAA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVS9	Pc22g23420 protein	1	1-26	MEYRAKRRAKRRAKIKVPHPYRRLGY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HX35	Pc24g02600 protein	1	254-280	RDNLKAHYARHGKRKGRNRYVATLDKT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWD6	Pc06g01660 protein	1	725-766	DFAAMSKRQEERKKKKEAKEKKQKERSERRSKRAAERAEREE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GXN8	Pc12g08080 protein	1	145-164	LLPVPEKYRNSKRGLRKYYH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GY45	Pc12g15770 protein	1	150-178	QRAQNEGRIKDKKKHSDKKSSRRGSKYDD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYL8	Pc12g12340 protein	1	426-452	WDRNHKEMVKRAYKHKFGKNLIDRVRS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYZ0	Pc12g12670 protein	2	368-393, 572-601	DESGKGKKPETKKRRKMTSKEKDYSI, VGFVGFSKSKQNRIRKARDRNRARGKSGGK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZC0	Pc12g13040 protein	1	222-241	SDQNEGRRKRGGRRPKDESD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H1X0	Pc13g03330 protein	1	18-45	KSISYTGCWTCRKRRIKCDERPIGCKTC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H314	Pc13g15820 protein	1	314-340	VEDQKKVRARVRRPKRRDAPKEPSQSA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6D1	Pc15g01970 protein	1	169-191	TCAMRRTLVSRKARKRRIAENSE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H784	Pc16g02130 protein	1	274-300	VEYYRDLSKHARRKRNRGNIPPPTAPP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAB2	Pc16g12210 protein	1	407-430	AVPMSMPPQRLKRKREREEASDVD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAZ4	Pc17g00720 protein	1	296-320	QSLMFERKRHLGRQRGKKKDGEARL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDI1	Pc20g04330 protein	2	67-90, 94-115	PITRSSTSSRGKRQRRRPSATYVD, KPTTVRSSRRYRDHDDLRRPAK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEI7	Pc20g07550 protein	2	3-31, 34-64	DTNAPKGLSNKLQNKRKRQADDAAPKQEK, AGTPAEGSSKKKQKKNKNKKKQAEHDESQST
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEM8	Pc20g07960 protein	1	4-25	QEQAAGKRKRARTQSCPPPELP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEP2	Pc20g08100 protein	1	455-475	VDRQGARKAAKMRNSRRWTTY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEY0	Pc20g08500 protein	1	21-40	DQPVMSSSRKRQRTNSESST
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGD1	Pc20g00800 protein	1	199-221	GRGFGRKKGRRGIRGSNPNVRNR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGY7	Uncharacterized protein	1	98-123	VKSFKDKKENPVRKHREHRQRLDLPQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HI45	Pc21g14420 protein	1	823-845	YPGNRNSRNRTSQYSHRQRPFNG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJM4	Pc21g02300 protein	1	21-46	NSPNRFQPRSQPALRRRRQLFQRLFL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQ21	Pc22g19790 protein	1	44-63	GAGKKAQKKLQKPKPGSLAS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQI7	Pc22g07000 protein	1	280-310	QMWSWAWKKEKRYRKEFGDKYKKKRAVIFPG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQV1	Pc22g24420 protein	1	582-604	LSGATPERRQCRKRGRTGSDDLL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWU8	Pc24g01580 protein	1	398-417	SEQSRHSKRRCQGQHNKPDC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWV7	Pc12g14680 protein	1	33-55	AVPQGWRYSRRPRADQPLKLQIA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GX05	Uncharacterized protein	1	126-148	MPPQETQESQRRRRRGDRGHTAR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYG0	Pc12g16070 protein	1	1178-1197	SSDWKRTKKLGEGLKRAKTE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYR8	Pc12g01290 protein	2	80-111, 626-652	SPNGSRVKIGKTKKERRQRRGSRRERVSEDGE, VQPAPPKPTPPRPSPPQPKPAQPKPAQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYV4	Probable E3 ubiquitin ligase complex SCF subunit sconB	1	68-87	EIWKRQYYSQWVRPRARRLA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZH1	Pc12g09430 protein	1	333-353	GEFVSFKKRLRQLQKEKPGKY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZZ9	Pc12g09900 protein	1	464-483	GQRQEREAARRKAKRKNFTI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H0R6	Hydroxyacid-oxoacid transhydrogenase	1	24-48	QYTHPPNCPCHKNPNHHHNHQQSPS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H7X5	Pc16g08590 protein	1	2-22	SPSNQEKRSSRCRRLASSHTI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H8F3	Pc16g04210 protein	1	110-132	ANWFQNRRAKAKQQKRQEEFEKM
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H909	Nitrogen permease regulator 3	2	37-65, 204-231	SENRIKTTTKGGRRVSRNRTRSKNTDSSS, VFVREDGSWRKQRRKKQKKPRAEWDGGE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HB47	Uncharacterized protein (Fragment)	1	37-56	TYMFRWSKLGRKRRQRVVVL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEJ0	Pc20g07580 protein	1	6-38	ETRLTRCRTGCMRCRVRRRKCDEGKPWCRNCID
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFH2	Pc20g05900 protein	1	1-22	MSTSRRRNGKPASCEPCRRDKV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGA0	Pc20g11660 protein	2	702-723, 728-755	NDVLRGCKTRRNSALRKNVVDS, FSILKSRTANGRRYRKRVNEKDREHGIL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGP7	Pc20g13090 protein	1	189-208	CQSTILQKRKRVKENFDPFG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHY0	Pc21g01120 protein	1	179-212	RTSSDPNRKREGPNRHDRKRDNRRPRRRGPCVIL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIS3	Pre-mRNA-splicing factor 18	1	78-103	ADRVREREEKKRRLAKESKKRREEEE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJ42	Pc21g19300 protein	1	200-226	YVNTHTKKKRLEALRKRYDQRRDPGYE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HL57	Uncharacterized protein	1	1-27	MAPIRSRRTLRPRWPRGGTKRNAAERV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNA2	Pc21g09420 protein	1	11-42	GSIKRIRQACANCRRKKTKCTGERPICLHCRR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HP23	Pc22g01270 protein	2	131-152, 976-1001	LQSSPDNSRKRQRPLSQVSPTI, LRKDALKNKAEKKKYIRRLEKGWFPS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRA6	Pc22g03170 protein	1	283-304	ATLGRLWRTWRQRRRGTTLSRT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GXS9	Pc12g15520 protein	1	27-54	SFQLLVPHRMRRKLRSKLRSRLSPTSSI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYY7	54S ribosomal protein L31, mitochondrial	2	13-41, 78-106	LWKTPWRLSSPQKARQRKRLRSVDRVVDT, FDKKEKSYRKSIHKLPKWTRVSQRVNPPG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H4S4	Pc13g10240 protein	1	34-53	IKIESSGKGKKKRTPTEDSA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5P4	Pc14g00710 protein	1	262-282	YLRLTETKSRRQRKMWWVVNG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5U8	Pc14g01200 protein	1	1053-1072	WGNKAKTSTKEKKRSIWGFR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAL0	Pc16g13190 protein	1	62-84	QCQICRLRKTRCNGARPKCQLCT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HB28	Pc17g01090 protein	1	26-49	FREGYLCARKREKRPPSRKDFGDH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HBY4	Pc18g00670 protein	1	2-56	ERIRLAVPSRKKPKSSLRRKTALDKKYEEEPVTSLSTNNKRRRQKAVEKGREVLD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGJ2	Pc20g12310 protein	4	1-25, 50-75, 169-196, 1187-1206	MPPKFTPRLRKQKHRQNPDGESADT, QEQHLKMSAKKQKRLDKYIENKLKKE, GADGFPVLKKRKRAPKKKPVPAPVKADV, GWPMPAKKVVQKKDPKQGWV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIQ7	Pc21g23450 protein	1	275-295	GEPSGAGTEKKKKEKKRVIRA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIY5	Pc21g06420 protein	1	1-28	MQNAPKKHFDGKRKKAKVDKNNKSSGHD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJK4	Pc21g19640 protein	2	22-51, 70-90	SPLPTRVRSACERCRRHKSRCDPVRPCSVC, TLPKRLGSKRISRTDRHRSNL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJQ1	Pc21g06840 protein	1	696-724	IDFHRSTLKCRPLQRSRPAKRQLCQPETE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNV9	Pc21g18320 protein	1	596-620	TEEAMKKMEKKKIKEERRSAQIERS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQM2	Phosphatidate cytidylyltransferase	1	1-21	MSKSRRNVRFQHRSNDERRLS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQV4	Pc22g24450 protein	1	100-145	KESKSDSKPDSKQDPKPFHRRLLQFAQRPKKESSPRSKQEEQQRQI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTC6	Pc22g22000 protein	3	2-25, 95-134, 607-626	APSSSRSRSTRPMRSSRTKVQTYH, PDPKSVTTRTSKPKPPRRAATTPKPKQTKRSKPNQIGSAL, STSSKRQSTRLARQRTHETD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTP6	Pc22g17930 protein	2	3-23, 131-150	LCQNRLQEERKQWRRDHPFGF, EAYNLFKKDRPQYERRVRMV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUX5	Pc22g09940 protein	1	377-396	EKEKKPEKGKDKEKPQNQQT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HV03	Pc22g14660 protein	2	162-184, 203-249	KSETKSKAKPDAKPRPQPPKITT, ETKDKSDTKTKSKPDPKTKPETKTKAKPETKTKIEPKTNPKKRMIIN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWN7	Uncharacterized protein	1	3-22	ITYLKKELPRRTNQHSDREA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWW7	mRNA-capping enzyme subunit beta	1	363-382	RVDAQQPKPKRRRYNEPPIY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GW05	Elongation of fatty acids protein	1	504-528	EGFAKVPTKKGAKKQKAEKESSSSP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GX80	Pc12g15110 protein	1	51-71	VTYLFAKQKHQGENRKRDPNF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZC2	Pc12g16580 protein	1	1-32	MSTNKRKRARKACNPCHQRKRKCDGGHPCGMC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZQ5	Pc12g05900 protein	3	7-29, 107-131, 208-229	HSISGRPSRSKPRSSLKSPNSVS, IVPTTPPSMSRPRRDKNQTHGRFTS, MASPIPIKRRPGRPPRRPEAIL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H1H5	Pc13g02330 protein	1	88-110	SESLARKRVRKIHLRPLQRPDEE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H2C2	Ribosomal protein L19 (Fragment)	1	167-192	MDAKRAKNKALRERRLERKEAKRDAL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H4Q9	Stress response protein NST1	4	30-58, 117-143, 498-529, 596-621	SAATSAPSVNRKKQKRRQKQAARLAAEHP, HAALGETSKRKKNKKARSSSHNHADRS, NEQRNAKKAREAQKKKDKKRLQKQAKEEEKAR, ERKQREQKEEKKRREEAKRKEKEERE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H742	Pc16g02560 protein	1	445-466	RSSSASGRKKNPRQRTPHDDSF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H8P9	Pc16g02910 protein	2	59-78, 245-266	IKLQSKGKAKAPKRKAETKT, GPDVKEQKPSKHKKPNGELIVK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGS8	Pc20g03650 protein	2	332-356, 365-396	ISKHSPKVVLRRRRAEERKARKSAQ, EQVNSATKRRDRRERMMQRRRQSDRGKQPYAN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGU9	Pc20g06520 protein	4	230-261, 286-308, 312-331, 372-392	PNPSSPPRRNRDEPRHRRRERRSRSPSNPVSP, ISRSRSPRSRSPRGYRRRQSSVP, SRSRSRRSSARYARRDSRRL, TDGKRRRSIERYNPDEKRRKM
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HH13	Pc20g13760 protein	1	502-523	AHEEPRPRRRSRPSFPVNQFVT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HN72	Pc21g05020 protein	2	255-277, 817-842	VVTWHWYMVRRRRKNERDLAARA, CLTALLISTRHRRKHRRPSADLSLPL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HPK1	Pc22g00870 protein	4	80-105, 243-269, 1017-1056, 1086-1132	YEETTKTAKTTRKKQNLKVQQMFLFK, PGQKRAPDENREPRRKRSRQLSPGAPA, QEKVVRERIETQRRQKKQEHERKRREEQKKQEELDKKTRE, QEWTREESHKQQRKEEPKKEEETRKVSRRPGLRNSRKKNTDPTWKPG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HPW4	Pc22g11060 protein	2	104-129, 134-184	SRAYEIRHRRSPPRTRSPPRPRADTW, NRGYGRTRSRSPPYRRRSRTPPGRNFGSHPYERRRSPPRRFSPRISPRRDE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQK7	Pc22g07200 protein	2	90-114, 806-828	GGSGKGRDLSKKKRKRGSDVNGAVD, QEQPPPSKKSKTSVGKKSKGGRK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRF9	DNA-directed RNA polymerase subunit beta	1	83-105	RQAEGVRPPKRNRLNVRVREIFL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSY4	Pc22g21720 protein	1	264-285	GTLVFWRMYRRQKRFEREADEE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HU24	Uncharacterized protein	1	124-143	AAKHTRKRSRPWELAMRNSF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUT8	Pc22g05540 protein	2	185-221, 293-314	RLYRRTDPPPPPPPQRPKKKPKSRSSRASRTSKRTST, KAEEAQQRKRQKREKELLNLQL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVJ7	Vacuolar protein sorting-associated protein	1	2929-2951	KEFQTQRRMSKVRNRPKHALYGI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GXQ0	Uncharacterized protein	1	9-44	PRPTPPSTHPSKRGKKGPLRKMKAHQKAIKKRRSAR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GXX1	tRNA dimethylallyltransferase	1	428-447	RGLKSASKRTQRDEYFRKKE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZ19	Pc12g16490 protein	1	1-20	MAFLFKSKKNQQSQQPAALP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H079	Pc12g10080 protein	1	2-32	VYCGRPSTSCNNCRAKKRRCDKAVPECGQCC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H161	Pc13g00800 protein	2	89-114, 122-150	LRVHRVHRVHRVHRVHRVHRVHRVHR, HRVHRVHRVHRVHRVHRVHRVHRVHRVHR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3G7	Chitin synthase	1	1-20	MERLPRPRSNIRGRDSRTGQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H479	Pescadillo homolog	2	34-64, 600-673	RRLCIFKGIYPREPRNKKKASKTSTPNTTFY, ADEAAKKKSSKSKKVAAKKRSEDEELERQKMMMSRKKRKLLEKMMYSNKKTADESAKLRSKRRKLEKGEKGEKN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5U9	Pc14g01210 protein	1	659-678	VVDDQARKRRFKKVGFWSLQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H8C7	Pc16g09320 protein	1	309-328	AGFQKSQKMRRSRRLDRVTL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAL2	Pc16g13210 protein	3	8-35, 67-92, 311-334	PALFRGRNTVNRKPPKNFNKPKSTVFPN, QTWDLTKQFDKQRRKNKPVQQPLFGM, IYNLGKTNKRRQKKEQEEQEHLRR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HBR9	Pc18g04750 protein	1	611-655	QYQHRPIKDKRSIQRVRLKSDYEKAARRAEKRRQRSDSKSSDNKS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HC88	Pc18g05680 protein	1	21-50	QFSCTACRYRKLKCCRNHPCGNCKKRGEAT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHJ9	Pc21g05530 protein	1	560-579	SPPCRDCKMFKDKVNKFFGL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIK2	Pc21g14660 protein	1	483-505	NENILEKKKKERREIEKEKEKTT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIP1	Pc21g19080 protein	1	977-1005	VVGEDYEKKRYKRYRQWLRGKSLFKQRVD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJI0	Non-specific serine/threonine protein kinase	3	3193-3222, 3431-3454, 3549-3570	MLSIKKQHDQKQEKLNRARQQQQQQQQQGS, NEYIHKLRRWRDKFEEKLDRRSQH, FNGLLAKRKESRRRNLYFHLPL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJT2	Pc21g11130 protein	1	746-769	GVPADTPKRRLRRLSSTPRSKENI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKK9	DNA helicase	1	783-822	YIEYNKSRNKQLKDKAGHHPLFKKMERDRQRRKKEREMEG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HPE9	Pc22g00350 protein	1	271-294	SINPIKGKVFKKKPINNLNPDKNY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRD2	RNA helicase	2	2-29, 46-69	PGPVDTAKSINKRKRKHGSKAESDVAKP, STPKASAEKATKKRKVSPSPSAEE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSD6	Pc22g17120 protein	1	14-36	QACEPCRKAKVRCDHASPKCSRC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSL4	Ubiquinone biosynthesis protein	1	37-59	TRPTQTTRTSKPRQLPQRTYHSA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTR4	Ribosome biogenesis protein SLX9	1	43-70	LVSKIEKNSQKTPKRRRASKKLVTNLES
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	A7KAN4	Sterol 3-beta-glucosyltransferase	1	286-309	AIKSGYLSKRGRKNPKYHRYWFAL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYA7	RNA helicase	2	71-109, 559-579	EKTPAATKVKEDKKSKKDKKKEQNKTKKDEQNSKEQKPK, AGKIHSKKTKKAEDSNGPSKK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYK3	Beta-mannosidase	1	4-24	HFFNKLFKPKGKGPKEPRFTL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZ85	Lysine--tRNA ligase	2	22-56, 74-97	VTGEKVSKTELKRRQKQREKDAKKKEKEAAAPPKA, YFEIRCKKINKLRETKQPDPYPHK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H1C0	Pc13g02000 protein	2	28-61, 685-727	GSKPSCKNCESKNKDCTYRQRNDKRKIPVRVAVS, QQQWHKRKRGMAQKGAKRGPENENSPGKHPKRSRNTAGTQNWL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H2F1	Pc13g05130 protein	1	26-46	ARLHWHHKPSRALTRKTKFLA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H609	Pc14g01810 protein	1	469-490	TEIAGPCRSEKKRNFFRFFQDL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HBV5	Uncharacterized protein	1	266-285	RSIRTKFKSTYRKGEGRKGG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEH3	Pc20g02570 protein	1	817-840	PMLERRSQVNCKDRARNLKKKYLR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HF54	Pc20g02940 protein	1	926-951	TSNFHEPTPKRPRGNRKSTNHPYNFD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HF83	Pc20g09240 protein	1	27-46	GSSSTRRYSRRNSNDLQRAA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHB5	Pc20g14290 protein	2	94-116, 621-652	SPDPTYRPPTRRKGPLYTRTHKV, NMSDEQRREYNKERRKKKRRRLAIERNMREEG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJM0	Pc21g02260 protein	1	899-918	QDTGRIKTRSQARKNPDQFT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HLK7	Pc21g08130 protein	1	1-23	MPPFKVAKKRTTTKQRMKDAILD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HM94	Mitochondrial DNA polymerase catalytic subunit	2	153-176, 282-304	ALNCPAKPRKWTKRSGWTKYNTDG, MCSQQRPTWMRHKKNQDMRDKIA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRX6	Pc22g12580 protein	1	8-55	HDGRGRGRSRAQSPRSHRRKRKVLSCEQCRCSKLKCDRKQPCAACTRR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HS70	Threonyl-tRNA synthetase	1	722-741	EEVRIKLKALRKERRLENAL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HU37	Pc22g14070 protein	1	22-51	SSFRSHELRRGPRNSIKRPNPIQSSKKVET
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUX8	Pc22g09970 protein	2	70-94, 389-408	DEYERLCGRKWRQRASEKYHPFWKL, STSGRLKRKLSKPFLPKRSA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWQ0	Uncharacterized protein	1	47-66	ESLRGKKYHILRKQRRIGAR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GW82	Pc06g01440 protein	1	1-41	MYKPAPRRPKKTSIVRSRSGCKPCRQRRVKCDEKQPSCTAC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWC6	Pc06g02260 protein	1	2-26	LRMTNTPRSCPPRYRKLKLKTLSVT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWF4	Pc06g01840 protein	1	240-259	SDSGGYFRRNRKRVNPADAE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZH8	Pc12g09500 protein	1	114-140	QSARKRSKISRACDECRRKKVRCDASS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZV2	Pc12g02280 protein	1	527-547	SGSPVRRRRHHQQEPTEPSPR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H2V1	Pc13g15540 protein	1	168-188	EVERFGKRRKLNDKDRKRLVA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H4T1	Pc13g10310 protein	1	54-74	FANRSGKPKGSKNRATLRKLG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6I0	Pc15g00340 protein	2	22-62, 516-539	EASTTRSGPRRLPKKRTKTGCLTCRKRRIKCGEEKPICTNC, AKTTRDLRAHRRRAHEKRRQSGWS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H709	Pc16g01070 protein	2	14-40, 46-66	GQLNKRSCLRCSQRKVRCDKVHPCSIC, QCTFPGPKRTRQTLNRPPVSE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H9P0	Pc16g11470 protein	1	92-117	FNIPTKIREGRRKPPLRTILNKSHGC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAQ4	CCHC-type domain-containing protein	1	20-39	KKETRSCYFCKQRGHLRAKC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HC40	Pc18g00950 protein	1	1-24	MTKGCYTCRRRRIICDNGQPTCRK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HCY5	Pc18g02640 protein	1	30-51	ANLRAANEKKRQKRNWSSSKLA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFA5	Pc20g09460 protein	1	278-307	PEDADKPLSKREIKRRAKKARFDAKGENTT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIN0	Pc21g18970 protein	3	110-133, 178-201, 206-228	DTEANTRKKRRRISRDNDKARPDP, IKEEQRLKKENPKADKRKRESLAS, SSIASRPRNKRLRLENGHKRDGD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJZ7	Pc21g02470 protein	1	1208-1230	VWKTSKMSAKKKLEKATKKKTSG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HMY1	Pc21g17730 protein	2	53-95, 676-699	ATFSRPDLRNRHMKRKHPEHEQHRSTKRTRRQTAPRQDRLHSS, GALMWARKVFQRRQKWQLGKLILS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HS87	Pc22g08210 protein	2	216-238, 261-284	AGHGHTGHRHRRHRHTDHGHTDH, AGHGHTGHRHRRHRHTGHGHTDHD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSM9	Pc22g04150 protein	1	16-35	QACIKAKRRCDQGWPRCSRC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HV09	Proline iminopeptidase	1	307-332	TRAKLFEKSKHSHSKSQKSYKKHEIL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWR8	Uncharacterized protein	1	161-181	QQPSLSERRKRKRVSFQDDTH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWX4	Uncharacterized protein	1	3-28	YPTLPSPIGRPPKRQRRVSQDAEDQS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GVP5	Pc01g00010 protein (Fragment)	1	242-262	ALRRARANAKQHRKDNFQQST
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GX52	Pc12g11310 protein	1	20-41	QIEKNLKKEWKKQDSEEQPQTN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GX54	FK506-binding protein	1	334-359	VEPKEAKKDDKKDDKKEAKTDKKVQF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GXM6	Pc12g07950 protein	2	20-46, 1060-1080	QNEEEKNSRKEEKPSRRRQSLAKTLSI, AKEPDKRTTSHRKEGPRQLSE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H2C7	Pc13g04780 protein	1	193-213	QSWVVRFSKHNDKRRCRPLSE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3S2	Pyruvate carboxylase	1	972-995	PEPLRTKALRGRRKLDKRPGLYLE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H463	Pc13g07600 protein	3	2-21, 24-43, 97-124	AEKRKLPARDRRESAAKRRV, ATPQSHKKKAPTPRVPSPEL, DGILVRYYTKPKKTKREQIEKNNPSKDT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5I4	Pc14g00150 protein	1	40-62	GDTSNNKELKRKLKSRHLQMIAI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6L6	Asparagine-linked glycosylation protein 10	1	486-510	LQAHQQPPKGTKKPNRPTPLVEPRY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6Q4	Pc15g01100 protein	2	8-36, 42-64	PGLACEECRKKKLRCNRRRPQCDQCEDSG, NQVRSPRGPKKGHLKALRNRIAT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H7D0	Pc16g06580 protein	1	290-316	SCCAACCRGRKARKELKSKGVNWREKS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H8R0	Pc16g04420 protein	2	2-24, 42-63	GEETAKPSGRKRGRPRTVTDDQE, INLRRRKQLRLAQQAYRKRKET
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H916	Pc16g06370 protein	2	30-55, 535-559	AATAKSPHQTPRKRLRSDKHLPRVDV, RENIAKDRAKRSRGRQSRYAGPREC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H9V7	U3 small nucleolar RNA-associated protein 11	2	38-62, 205-248	AKDYNAKKAKLKRLEEKARDRNPDE, DQTSSKTRKTPKQLQAERQALADARRARKIRKRTIEARKNKLIA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HA56	Pc16g15130 protein	1	1-20	MPKRSNEKRLKLNQQCREAL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEG9	Pc20g02530 protein	1	314-338	TFWDRTPRPRVPKQKRPRGPGRSVS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HF85	Pc20g09260 protein	2	105-126, 294-316	ASTGTQKLSRKKSQSRITHLDA, ADDSKKSKAPSRKRKKDVETDAE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFT6	Uncharacterized protein	1	1-27	MRLKHHKRHHKRHSTRIQKATKGRYGN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFV3	Pc20g10590 protein	1	390-421	DANPMSKNQGKKEKKKQEKKTQAKKSQGIQKG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFV9	Pc20g10660 protein	1	251-273	TVLQNKTKRVRKQMKKENLQSAE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HG23	Uncharacterized protein	1	160-183	SQTKMPCLTRRRTTKRKCVFCSLL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGX9	Pc20g13400 protein	2	250-269, 1024-1048	TDSKRRPVKRGPEGETKKRW, GIESWKWCKRVYFRRQDRKAAARGD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HH92	Pc20g14060 protein	2	54-73, 555-576	LYSTPKPKAKTQPAFQDDKR, LDMRYRGRGRGRRKQYLVRWSA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HLM7	Pc21g12380 protein	1	455-485	EREVRDLRGKNEKKKQKRARSRKHLYVESGL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HN27	Uncharacterized protein	2	46-67, 155-175	VESLRGKKYHILRKQRRTGAKA, DYVHRVCAARKLRYRRTERPH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HPC3	Pc22g02490 protein	1	616-637	ECWNFIAEKKKIDKRKRPRTRY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUU2	Pc22g05580 protein	1	106-136	SWSQSGSPRTRPKKTAKQRRRNNRRELSDSD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GW02	Pc06g00570 protein	2	1-30, 57-81	MIQRSRRGCWTCKRRHKKCDETRPVCERCT, MVLNPVRQLRPQRRLRRSRVVDVLP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWK1	Pc09g00040 protein	1	273-295	DITRLPRLTKRQRRPTTTKIQPA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWR6	Uncharacterized protein	1	158-180	PPPIAALRGRRHRHNDWRKWAVF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GX44	Pc12g11230 protein	1	196-220	DLLEKLAEKKKWKRCSNCSRIIERI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZS2	Pc12g09730 protein	1	16-36	FCTFTKTSKHLPYNLRKHQAN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H1P2	Pc13g01550 protein	1	340-375	FTRDPVKQKLDIKKQQRAREKKKRTEPPEKGDHPAK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H4P2	Pc13g09920 protein	1	1-128	MAGSDDDRRERRRRDRSQDSQDDHYSSSRRRDQDRRSSHRDSPRRRSSRSPAERTSRRSDRDRPRRERRERSTSSAGEDRPRHRHRSHRHRDTRDEYEARSSRRHRRTRSRSRSRSPQRSRSPPPRAL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5R3	Pc14g00850 protein	1	156-176	ATNDRDLKRRIRKIPGAPIMS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H751	Pc16g02650 protein	1	1-22	MSIRRRTAHRRRAGDQRLRFDE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H9J4	Uncharacterized protein	2	2-26, 33-53	AEETRWCHSCKKDRPKDLFRAPEDA, MCEPCRIKYRNISRARRSQGG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H9X4	Pc16g14270 protein	1	498-526	VTGRSICVFERRRRTKRFNWGERAKGQKK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HA27	Pc16g14810 protein	3	80-99, 134-153, 435-467	VSQLRHKRYSPKTQERLDEA, LFSWRCDQRRGKDGRRRTAG, LLRRNFPQPRTIRKRRKAQEKRVKKLWQKFDNA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HCZ0	Pc18g02690 protein	1	8-37	LQKPLRTPRACDRCRRQKLKCESSRPCVLC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDE9	Pc20g07430 protein	2	91-111, 812-839	EPDQKKPGEKEKPVYRPREDR, LLARHAFQHRKPLKKKYQPKTDTGKTVE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDU5	Pc20g14880 protein	1	539-563	EDAERDPEKTNQKNWRKRAQYMIFG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HH26	Pc20g13890 protein	2	56-79, 331-353	ASSRTPAVSQKQPNKKKQPGVVVT, DEPYCAPYSKRREERMRGQQRGV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIK0	Pc21g14640 protein	1	251-270	VNFATQKGWEKKKQEEKAKL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HK24	Pc21g07000 protein	2	1210-1232, 1381-1405	FSEDAPRTRRKRRSSLSDLRPPT, QSSSSSQRPQKPRMQSPQKLRDRVQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKE7	Pc21g07210 protein	1	1-20	MTPKGSRKRVKTSPSPVDSS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HPV0	Pc22g06600 protein	1	1-21	MPFRKLRKSLKRLFSFKARRV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQM5	Pc22g11700 protein	1	236-262	SENRRIAKRDELKKRRQPQPWRQNSNN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQS9	Pc22g20260 protein	1	10-30	EAAEIKKRRQFRKFSYRGIDL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVS3	Pc22g23360 protein	1	8-36	RTGCWTCRARRIKCDVCRRCARQNAPCGY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWH8	Pc07g00030 protein	1	1-29	MAPPLSRVKREQLRKRRNNLLRRHNEFWL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZ35	Pc12g01620 protein	2	25-55, 783-802	GESYRRRSPASQDRRRARPRSRSPVIDRYEP, LHQPGPMRRGQNRNNRPGPY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H2X2	Pc13g05630 protein	1	136-159	QENEKAPNPRPKKNRELNTRFEND
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3L6	Pc13g13460 protein	1	20-42	TTTLRFQRLRKLHKQYDYPTRES
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H491	LigD_N domain-containing protein	2	349-377, 449-472	TTDFARPIREGRKRRRRHPSRPTVPQAPS, QSEGLKERGKKRTWTRKPAGGFEP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5R6	Pc14g00880 protein	1	52-81	TEDTKDTEDPKQKKRRRLSREKGKERSDSS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H864	Pc16g03970 protein	2	28-69, 649-668	KSKSVKSSSSSKKDSKKDFKSTKSDKKPSKKVQKEESEDDDD, KKSELLKTLKKNKKALEQAS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H9I0	Pc16g05270 protein	1	9-33	ALPGACQTCRRRKTKCDSNYPCSTC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAF6	Pc16g12650 protein	1	25-51	STGSDCRISNRPPRQKRSRVLITSQFE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HCM8	Pc18g06320 protein	1	694-714	EPNSASQQPPKRRRVAPTLIS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDS2	Pc20g04460 protein	1	193-215	ALVWFLLRRRNKQRQENGVQDMP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEF5	Pc20g05150 protein	1	401-425	IVIEGQDRKKRKREQPWENDLRKAR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HF43	U3 small nucleolar ribonucleoprotein protein MPP10	2	61-85, 632-660	VDAQTARRQLNKKRKRSDLESDSVT, KEEMSREQKAKNRRQNKQTQKKADAAKPT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGH5	Pc20g06430 protein	1	34-53	RPVAVRRETKKKGPNFGKWF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGP0	Protein transport protein sec16	1	1956-1977	APQARKGNTVRGKKKGRYVDVM
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HK45	Pc21g11250 protein	2	15-46, 57-82	GLSGHNRPVKRRASKACCCCRARKVRCDVVEN, QVECVVTESKRRKKSRVEIENHSESP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKI3	Pc21g11650 protein	3	121-149, 761-780, 811-834	NICKSPAWGKPNKKEKRVTKRLEAERKEL, MSILKRRSQKAKEARSPQTI, DSDSKLGKSRSKKQPDTGMRKLTG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HN20	Pc21g00090 protein	1	515-535	CDGNTTKKLLKRSPRRLFDRL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNU9	Pc21g18220 protein	1	445-468	VMPGSSPKNNRRKKASLLLRKLAG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNX7	Pc21g22750 protein	1	34-53	KCDGERPCTRCQKLDKQCVF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRU4	Pc22g07990 protein (Fragment)	1	6-30	LEKPETPEKTEKRSRRRGAELDPFI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSV2	Pc22g17470 protein	1	36-56	STTNRWSNKRYTGNKGKKGDQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HU44	Pc22g18050 protein	1	188-207	PDFAPPPKKQPPPPKREPEE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVH5	Nascent polypeptide-associated complex subunit beta	1	15-35	IGIGKGTPRRKVKKVVRNSGA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVK9	Pc22g10300 protein	1	9-34	AAASPDMKFRRTKRRKVSDDDPVSPE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWI4	Pc24g00210 protein	1	1-29	MAPPLSRVKREQLRKRRNNLLRRHNEFWL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H107	Vacuolar protein sorting-associated protein 27	1	42-63	QPKDGMRSLKRRLENRNPNIQL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3H3	Pc13g06400 protein	1	398-417	VDDCIRRRWHHERRPSWILP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3Z6	Uncharacterized protein	1	22-42	CKSWMTCRYIRAKRKLKPVSP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H668	Pc15g01230 protein	2	41-68, 88-115	IASKVASKEKASKKNKKKEPTPSSSESE, SEEEKPAPKKTEKKTEKKVEKKVAAKAE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6A5	Pc15g01670 protein	2	331-351, 372-396	STRSRSTRYTGKRKNRANSAC, GDITRLPRLTKRQRRPTTTKIQPAQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6N7	Pc15g00930 protein	1	67-88	STLKTVMRKIFNRKRQSQADEL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6W0	Pc16g00550 protein	1	474-496	NKHITRTCKKSVKWKGKTRMLSG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H886	Pc16g05480 protein	1	619-643	EIVGEGRALKRRRRQLQKEIEDLEA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEH9	Pc20g02630 protein	1	42-61	TPSTRETCPQPRKVNTPNDG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFE1	Transcription elongation factor 1 homolog	1	1-22	MGKRKKSSSKPQGPRKREPLAT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIJ6	Uncharacterized protein	1	86-111	VSKGQTPVRRCKPGRRWEGRNQVTMR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJ37	Pc21g19250 protein	1	1323-1348	NGKSSVAKKARKEKSSRPARKSTSSI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJF1	Pc21g10880 protein	1	269-312	DCDFPKKVKLSRKEKKMIKQEAKDSKRRGRRRSSSRKGARVSED
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJH1	Pc21g15300 protein	1	35-70	VDAIIRTKRKAREPKACYPCHARKVKCDRNLPCDGC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HL62	Pc21g07680 protein	1	125-146	LLSSRFSKRYNYKRAKYKDPEI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HM18	Pc21g12780 protein	2	208-227, 1498-1517	CSTYYRTSIRRVRRNFRDDI, GSPDSRKVPRRSFLSKRSVS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HM30	Pc21g12900 protein (Fragment)	1	76-95	LVAIYKKLSRYNKNRTRVIS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQQ2	Pc22g16070 protein	1	97-117	SVGHVGKSRRRVSRDPRRLSA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQR5	Pc22g16200 protein	1	343-365	SSGVERYRERRRKHRASDGDRFF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRS8	Pc22g03720 protein	6	288-316, 450-478, 1021-1047, 1105-1128, 1276-1313, 1330-1362	EEPKPEEKPAGKKKKKGKKGKAAKATEEP, EEPKPEEKPAGKKKKKGKKGKTAKAAESE, AEAAAARHSRRRRKRSSPIEGERRHSK, PAPEKLKRSKSSSKEKVREKERAM, TAEHGRSREERKEREKVREREREKVRERERERERVREH, RPEGSSRRSRETREARHHRRHRREESPPREESK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTA2	Pc22g21760 protein	2	349-370, 379-402	SSLSARNKRAHHRRRLKVLSQA, NDDPSTPNKKGKRTKTRITKSTLS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTD9	Uncharacterized protein	2	103-128, 283-303	KKRAAESSTPPRKRRRHSHSTSQIPG, SENCERATRRAEKRASKPKAY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTF3	Pc22g04500 protein	1	213-244	NWYFCPLKCQKPSNPSKPKSRRYRIFGRGSTD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HU59	Pc22g18240 protein	1	513-535	LFICDCCPKKPKKFDNPDGLRAH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWB6	Pc23g00660 protein	1	295-316	WLDPKGKKHYRLRTQTLRRLVT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWL7	Pc24g00580 protein	1	398-417	AFQHGPRYKVIKRKRPRESV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HX49	Pc24g02790 protein (Fragment)	1	38-60	AELRRQAEERERQQRERNRPTTF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWN2	Uncharacterized protein	1	1-20	MEKQKPRPEHDKATHRKCLQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWR1	Pc12g07180 protein	2	182-209, 281-300	DFDRYSKEPEKKKQQRVKKAQKEAREAE, AAVGARKGTKPKSKRTKAST
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GY11	Pc12g11890 protein	1	8-34	HVPPYKIQQRKDSKAHPSRKRIVICCD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZH6	Uncharacterized protein	1	58-79	DVGHAMKKRKEKRKEGGQPAVN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H0G4	Pc12g10230 protein	2	5-33, 135-160	APARSARSRVTPARQPKRQRQTDDHTPDV, TLEQEPKKHKKAIQRRKPLNGAERKV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3X7	Pc13g11110 protein	2	9-32, 35-59	ERSCLRCHAHKIKCDKNSPCSKCM, NITCQYPGPSRIKRQSPKKSTSDVA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6X0	Uncharacterized protein	1	77-103	TLGALRGSSRRRRKPSRMKYSPTRSNL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HCP9	Pc18g02040 protein	1	648-683	SQLKVTSKIQARKRKDEERSKKSKSKNKSEVDGLKQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HD17	Pc19g00240 protein	1	86-113	ERNRIAANKCRERKKREHRQIERRFTDE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HF70	Pc20g05590 protein	1	1224-1252	LGKPRLTVSSKGRRRRPSSKELRQALKCD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HF89	Pc20g09300 protein	1	227-253	SREPEEPKGKRKGKKGKKGKKQAELVE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGU7	Ribosome biogenesis protein NSA2 homolog	3	7-31, 51-70, 137-156	IERWQKQHGKRLDHEERTRKRQARE, QQNRHKEKIQMKKRIKAQEE, NTGKKTHKKAWKRMITKPTF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJ44	Pc21g19320 protein	1	192-212	NIHYRRIRCSQPKQIRHDTEY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJS8	Pc21g11090 protein	3	196-222, 260-280, 481-511	CKWVGKCPSDKRKHEARHKKLFKCDVP, GTNCPRPNKRWPRLDNFKQHL, QCDACPKRTRLRCEMKKHQKRHERPYGCTFP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJV4	Ribokinase	1	315-334	AYAVRVARWREKRRAEGKAG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HLX2	Pc21g04140 protein	1	11-42	DYPRKRASIACNFCRHRKRKCDGQKPTCGLCT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HMN4	Pc21g04530 protein	2	31-75, 177-220	LTGFHKRKVQRAKHAQENAIKRYKEEKREARKKIREDRKRDFEQA, AASEAARKKKRNFRYETKVERKQTMLKQRSMKAKRAKARKGAEE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HPF9	Pc22g00450 protein	1	20-41	NHNHGHSRSRGHRSNRWAQPPP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HR60	Pc22g20510 protein	3	158-223, 244-265, 310-331	KETLRRKEREKERGDRDRGKDRDRRHRTHDSKRRRYSDDAGDDRRDRHHRRSSPRRHRSRSPASPD, SDSRDRRRDEHRSRRDDRDRGR, ADEDRRRDFPRREYNNRRDSGR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTX5	Pc22g04920 protein	2	14-107, 664-698	REQRQEKSEGRHHRDRNRDRDRSKERSRQHRHRSSHHHRRQSSRSRDRDSERVRESRHRDDDGHRHKRSRRSDDQGDERGHKRHHRNSKDEGEG, APDVIKRQGRWNRGDRRVEGFRKRWKKFDWTRILV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUX1	Pc22g09900 protein	1	69-95	CKCCCSCCCPSGRRRNKTPKHFDDFHQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWX9	Pc24g01920 protein	1	52-73	RSVHNDKTERRRPPRPKYDEEE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HX37	Uncharacterized protein	1	281-300	ASPYRRKQCIPAKTCRRLEF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYB4	Uncharacterized protein	1	419-456	ISFNSGKKKITPKHKRVLKRFGKKLKHLLCPTCKRTSS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZI3	Pc12g09550 protein	2	23-43, 53-72	TCEACRQRKVKCDKLSPCTSC, VERARLPRGRTRKPERMVGS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3D1	Pc13g06570 protein	1	133-157	FDYLESRRERNTKKHFKQKSLVILR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3Q3	Pc13g07160 protein	2	326-350, 639-658	LLPPETPGRKKRKHKQRSPAGTTTA, RSGKYNPYIKWKKNGFRFFL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H523	Pc13g11900 protein	1	15-45	LKGSKVSGGRIEKKKKKSTKKKEGEATQSKS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6K8	Origin recognition complex subunit 4	2	78-100, 166-188	ARAGTRTSGRQRKTPKRYEEEAV, RRTITRTRSRRSTAKPRSKKALA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6U0	Pc16g00370 protein	1	79-101	GDMPSWRWDPYRQRHPRNAAVLA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H8I5	Pc16g06020 protein	1	1282-1301	KDTLVREKERGKRLERCLRS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H957	Pc16g09790 protein	3	215-238, 534-572, 657-692	TACQRERSPTRKPSPRPRYRGSPA, GDARRQSPRRSPRRLMSPPPRRAGRTSPKRLKSPPPPMK, DIVEGLEKKRQKRKEKFWRQHCRKAAKEQMGKRPVP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HCX5	Pc18g02520 protein	2	37-57, 242-274	PESRLRRRWKGGKSLFQRPPN, LSEKADQEKTRRKWKKVLIEIRKRGRAKKRSGK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEM3	Pc20g07910 protein	1	73-99	IPKISRRIRACTECKRHKVRCDMKATD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGE1	Pc20g00910 protein	1	16-37	QLMPPPPPPKRIKRPATVLDED
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGU3	tRNA (guanine(9)-N1)-methyltransferase	1	101-121	LQKAQKKEKIIEKRERRKAMI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJW7	Glycogen [starch] synthase	1	561-585	FMFHFTEKSRRQRINQRNRTERLSD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKA5	Pc21g20110 protein	1	866-885	AGRRGNKQQAQKARRKQLAK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNY2	Pc21g22800 protein	1	2-23	EDSRRRQLHSCDPCRKGKRGCD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HP20	Pc22g01240 protein	2	29-54, 769-790	VTPSDKTTPRPFKKWMDSFRGRKSES, ISPSSKKWSSPQKWSSPKNLFS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HPW1	Uncharacterized protein	1	162-186	SDNRNCTYYSKRRYKVSKYFYLYPN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQ46	Pc22g23990 protein	1	522-541	TSRRGRKGPSHSQLRKNPEF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRH5	Transcriptional activator of proteases prtT	1	44-66	MTACHTCRKLKTRCDVDPRGHSC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSJ8	Pc22g25600 protein	1	302-324	FNRGCDLRKHFNRHRKYLFCRYE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUL7	37S ribosomal protein S25, mitochondrial	1	68-92	QVVFQVQEKRRKPKKPSRLFQPVEL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GW35	Pc06g00960 protein	2	15-41, 66-87	HGPPTQTRYQTRKPTNLQRGQKQNPIH, YGKPTPTKLKRQTPPKPTQANR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWF5	Pc06g01850 protein	1	6-29	KPSKGCGECRSRKIRCDQAQPACS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWR0	Chromatin-remodeling ATPase INO80	5	328-349, 381-409, 487-507, 1575-1596, 1640-1659	VESSRAEEARRKRRRNEFLIDL, IQDEKERKKDMQRKRRRENTVRQEMQKKL, AGPVTRPKKSKEQKQAEKDLA, TLGTKGGKKAAQKRKRDLTLDD, GGKGTSKRAKTTKERLRLID
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GX21	Pc12g07490 protein	6	96-118, 205-225, 420-445, 680-700, 803-824, 997-1020	AHDETTPKQRRVRKTYGLRSSAT, VLIPQPTRKKKPVVNHVQPIE, QKTSHSGTPKDRRNIHKPSKPRGIRD, STGPRHKANSLKRPKSKQSLL, QAKISPPRPKARQHRHWTTNLS, TPTPKAPVSRRRLRKNPPTRINLD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GY52	Pc12g00790 protein	1	12-37	IVTIIRDTPRPKKKRSVFGNEERTKI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYB9	Pc12g12140 protein	1	152-177	DSACRNDRKTYKPHKSYRKIYKHVIY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYD7	Pc12g15830 protein	1	104-125	ADAGARTHRKKHRHAHHDIGGG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H1R0	Pc13g01450 protein	1	682-707	AGAAGAGARRRRRRAREAERLYNEDE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H4J6	Autophagy-related protein 11	1	1264-1287	ASSPSRSTSDRRHNGRSRPWEKLW
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H881	Pc16g05420 protein	1	514-541	FPGCTKSFTRPDQLKRHQRTTHKQEFSP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H8A1	Pc16g07960 protein	1	571-597	SSGQRSPSSRPRRSSREDAKDRHKALT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HA89	Pc16g15470 protein	1	266-291	VESWKWVKRIILRRSRKAKHESSPSE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HBN7	Pc18g00220 protein	2	245-271, 634-654	LISEVRPKEKKRHHHHRPHIPKNHLHL, RETYVRKKISKCKEGEEKTKP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HBN9	Pc18g00240 protein	1	2-25	LKRFSTQFKRSKDSKDPKESNGDA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HC94	Ubiquitin carboxyl-terminal hydrolase	1	558-586	SQDTPTVSSRLRRRRKPNDRWWRISDEKI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEP4	Pc20g08120 protein	2	266-286, 291-334	SRPSNQRSSKRAPAQRKDEDM, GTEAQPTPKNKRKREEDTGYRPKGGSSRSKKKKEEPTSNLSKAA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HER0	Pc20g00010 protein	2	1-26, 44-68	MSLRPCQPCRHSRIRCSREVPHCQTC, QKPALPEPRSKQQKQKQERASDEYH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HF14	Pc20g09110 protein	1	216-235	MEQPSREMPRQPKQNKPDFF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHI5	Uncharacterized protein	1	88-107	GYARHPRYGKPQPWHKRDLN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIF5	Pc21g05980 protein	4	27-75, 138-159, 260-286, 297-327	RSISKRQSITPGRKHHHHRHRHRHQYRDQQQQQHPHQHRHQNQSQHQNQ, NCQHTRCTKCPRHPPARNKDGE, DADPPRPRPERTWKKPRQRVHYVCHVC, CSNCGQAKCEKTKRIPPKKVKRETDPEVLKS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIV7	Uncharacterized protein	1	148-169	TDPSHPRSTPQRHTTRRTNLTN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJL7	Pc21g02230 protein	1	1-34	MPPESKTKIRPQQSCLRCRERKVKCDRSIPCRAC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQ77	Pc22g06920 protein	2	932-959, 1176-1196	TNLPVNRSTSKKKKKNQTFEKKIFRTLP, VVPARGPSRPRPPRIPRTLES
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUW2	Uncharacterized protein	2	27-50, 76-111	GTSELSPPRRSKRQKSTTNLKELS, VHTAKEKKKKAPVKKSNEDVKPKKARKSKKDQEVES
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWM0	Pc24g00610 protein	1	457-487	EKEVSDLRAKNEKKKQKRTRSIRTIVHKGDL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYF1	DNA polymerase epsilon catalytic subunit	2	747-766, 1248-1272	RDRRYDFKGKQKSWKNKADG, GFLKYQKQKWKIQKQARIRRRQLFG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYU1	Pc12g05070 protein	1	208-227	RVQRTRVKRTPKSTPKQQVF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H077	Pc12g10060 protein	2	32-51, 417-436	PPEQRLRRIGSRQRNLQDQS, GYKQHMKGDKRKPFAKQDEF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H0K7	Pc12g02980 protein	1	421-447	GSPQTNSETWRNKRREKRLGADTQLLL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H219	Phospholipid-transporting ATPase	2	199-223, 1302-1327	SDASPAPPPKQRKKFRASDLNIFSR, MEQFQKAIRKVRQVQRMRKQRGYAFS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H2Z1	Transcription initiation factor TFIID subunit 8	1	17-41	LLTQNSPKRVKRHYHHHHRLQEPVV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H516	Uncharacterized protein	1	42-66	KVGRREVEEKKKKPKRTTNPGGEDG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H587	Phosphoinositide phospholipase C	3	137-158, 236-259, 764-789	AANKLTRRRQSTTQNEKRDRST, QRGTVLTKVTKKRRKQVRFFLDLD, ALATVHTDKKKKRRQKSKITKPLSDL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H8V2	Pc16g09240 protein	3	85-104, 225-253, 270-291	AGGPKKRKRAPVDPNAPKRA, SPSPVKEKTPPRSTTKRRRSENKAKEAET, STPAVKTPAENKRRSKKRKSEV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H9J3	Pc16g11420 protein	1	9-47	GPDSRVRKGPSRQSRSCKVCRLRKVKCDRVKPCHACCAH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAS1	Pc16g13800 protein	1	284-304	LCTYDKVQRVKNKWKCTLKDG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDJ9	Pc20g07290 protein	1	127-148	ETALKEKEEKEKKKKVAHEGLA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDN8	Pc20g12520 protein	2	19-39, 397-420	SCEPRTYRSLRIPYRPNQRFH, LKYASTRKVPEPKQAKREEKPAVA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFN9	Uncharacterized protein	1	183-210	WTRSISRSVRRAVRPRRHKRSETLEAGQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFY7	Protein arginine methyltransferase NDUFAF7	1	74-100	YPTVTAKELRNRRERPRQVKMLTREFI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHI0	Uncharacterized protein	1	198-223	ALRSGEGKTHRPKKKGKSREMVSDVV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJX1	Pc21g19730 protein	1	30-49	IPKERQSVIRRKFDRRVLPI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKQ6	Pc21g03080 protein	2	14-36, 110-129	ICHTDPPKYRCPRCSTRTCSLPC, AHPTASRKRKHPNQGLAKGE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HL04	Pc21g20540 protein	1	79-108	DGSTPPRSDGPPKKKKKKPLAKSKLSFGDD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HL22	Pc21g20720 protein	2	670-691, 769-788	SQAARAKPAPPRPPPRRTNTGS, APLPNKREELWRRRWDRASE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HLQ5	Pc21g16790 protein	1	21-41	DYKTGKKKVKAITRALQKANR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HR25	Mitochondrial distribution and morphology protein 34-2	1	358-386	LGAGRHSKAHARKRKKRVVDLRRPKTTDD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HW97	Uncharacterized protein	1	91-117	YSDMASTEKKKKKKRKRSDKSELIDQP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWJ6	Pc24g00340 protein	1	515-535	YDDNTTKKLLKRSPRRIFDRL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWK0	Pc24g00380 protein	1	60-84	DTFIKCPKFDNKKCTKDNNKCTVDT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWM1	Uncharacterized protein	1	291-310	CWTQAKKKPAQPAQPAKRDP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWN4	Uncharacterized protein	1	11-34	GDYLCKAYFRQRMKKHPLPPGPSH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HX21	Pc24g02420 protein	3	48-72, 148-173, 543-564	ITSRRPPATLKRVGPQRRKNWILYQ, SAMSRHQKSNSCRKGKKRGSHQALIS, HIERSNRKLRKKTTPWKKDMYT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GW72	Pc06g01320 protein	1	339-363	LSFGSMDRKERRRRRKPSVPVNTLA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWB6	Uncharacterized protein	1	89-120	TTYSDMASTEKKKKKKRKRSHRSELMDQPPGS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWY8	Pc12g00100 protein	1	1828-1850	GHSQTRRSPPSRNRRPGSKLGIE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H1A0	Pc13g00940 protein	1	35-60	GQSNHKLTKGRKQQEKPEKSKNPLFG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H1Q5	Pc13g01400 protein	1	204-223	LPKVSEKKTKPPTKPPTKPL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H246	Pc13g04200 protein	1	15-46	PSNKRVSRACETCRQRKIKCNGKTPTCRQCEE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H468	Uncharacterized protein	3	140-172, 539-566, 654-680	SHNVVLHTKQPKKQKKNKKKTPRKQIEYTAPSY, LTWMEENKAKRFKRRKQRAEFTRCCPKF, ASKKNGIKITGKKRGHRFRSQTAPIPL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H630	Pc14g02020 protein	1	453-475	LCGWNYHRKRRVKSKRDSQLREL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H851	Pc16g09100 protein	1	12-34	CDGGKPKCSSCMNKHRECRYQAV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H9D9	Pc16g10340 protein	1	146-166	HPSRNKHRANHLRQHRRQESQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HA44	Pc16g15010 protein	1	3-29	YPTLPSLISRPPRRQRRVSQDAEDQSK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAW4	Uncharacterized protein	2	232-252, 305-327	TPSSTGKRKRVDRWSQRAGPQ, RATTPVPERRSQRPRKTSYADIL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFD0	Protein-lysine N-methyltransferase EFM6	1	187-210	PNSVCYFCYKRRRRADMRFMKMAK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHF4	Pc20g14710 protein	1	11-33	TEEERRLKQDRERTKYWKRWGPY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJW6	Uncharacterized protein	3	1-24, 27-46, 56-75	MAEKKKGRKRSKIKRWLRSWVFTP, NVKIKLINKVERKRRSIPDW, LTDRCPCRFFRDRNDRQASS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKS2	Pc21g03240 protein	1	47-70	RATSGIQKKQKKNDKISRAQRLRQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HPW3	Pc22g11050 protein	3	1-26, 121-144, 561-580	MKLSKNQLRRAKKKAQKAEVRQILWS, EQEGEPKISKKKRKEMNKLSVAEL, MLAQENRKRLRKEEERRRKH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HS60	Pc22g25400 protein	4	24-51, 692-711, 750-791, 826-851	PAAASRKRSPPSRSPSPNRRRSPPGDSL, YTPSRSRSPVRRRRDVSDSR, SYDSRSPSRSPYRTRRSVTRSVTPPRRGQSPPSRRNRSYSRS, TDSVSRSRSPPPRRRAESRGRSYSRT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSS3	E3 ubiquitin-protein ligase	1	644-664	QQLREKSQKFKNFYTKYRNLH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HT28	Ribosome biogenesis protein NOP53	4	4-32, 64-85, 271-305, 347-366	AVDAPKQFKQPSRKGKKAWRKNVDITDVQ, NEEVRKSIAKKQKKPLKSDEIL, YEKSEWLNKKRPERKTKTQRNKANRRKAAERQAKW, DTTLRRKTFGSKRRVPEKPL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTA4	DNA-directed RNA polymerase subunit beta	2	1-20, 25-47	MPPRRRPQPSAASRGRRPSE, SATDSTKSKRPSQSNPVPQPHEH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTS3	Uncharacterized protein	4	48-70, 113-141, 303-323, 629-655	ESKLVRLKLTKPRPPKSNPQEVD, RTIPSKPQTAPAKRRKSNTKKSTATKEGS, SQTKTVHEKSHRKRRGRAESV, TEKLARSHPWPPPKKHRPSFSQKDTAE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUW9	Pc22g09880 protein (Fragment)	1	2-21	GPPFAGSKRRREPHNVDVKL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWA9	Pc23g00590 protein	1	101-125	PIQLSKKDQQRERNRQAQRKHRESV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYQ6	Pc12g16260 protein	1	801-835	PEVPVKKRGQHIPSWKKHNDKKKLRQAYNKRSVDE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZ88	Pc12g09280 protein	1	3-22	YALESKKRKFHRVLESISKP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZS4	Pc12g09750 protein	1	4-38	TEDERPSKRARQACEPCRRKKSRCPGEKPACSYCE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H089	ERF-3	1	643-663	LEPGTGRKSKRPPQFASKGQT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H0P5	Pc12g06850 protein	1	90-111	SSIPIPKPRRGRCMRKEPVTDN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H152	Pc13g00650 protein (Fragment)	1	488-518	ATREKRSKLGASCFRNRRRSARRSRRFKHGI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H235	Pc13g03790 protein	1	330-354	DGNGSGNNKKSKKKDKDAIQPGLVE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5X4	Pc14g01460 protein	3	57-79, 234-254, 365-384	QITKAYRKKSRTIHPDKVKRAFI, VAVNRRQKRMMDKENKKDKKG, ETTATSNARSRKRGKRSQRS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H624	Asparagine-linked glycosylation protein 14	1	37-58	MISQNITPPKRRRRGSPVHLLV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H764	Pc16g01860 protein	1	62-84	LRAVPKKKTSHMKKRHRQMAGKA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H7L5	Pc16g03010 protein	1	503-522	AANKAQLKKIAKKYDPREVY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HD95	Pc20g04100 protein	1	299-320	PLLPGTQKRRRVQTPPKQLSSE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDW8	Pc20g15120 protein	1	592-614	SEQVVRKPTKLTKKRNSKMSAYE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HI92	Pc21g23160 protein	1	18-40	LATSEQRKANQRKEEARRMVKFN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIR3	Pc21g23510 protein	1	34-67	QITRNRASYSCHTCRRRKVKCDKIHPICGNCQKN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJ02	Pc21g10680 protein	2	92-118, 667-713	QETKMGSSSKPTKRRQKEKPSTSSSLN, GDSPKDSPKKSSPKKRKQSKPKEKGKDVCKKRPQKSFKKQVLLRDPS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJG3	Pc21g15220 protein	1	824-845	DKPLMPTSSKHKRKMSPQSPLT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HK38	Pc21g07150 protein	1	12-37	RCVSTACVACRKRKSKCDGNLPSCAA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKH3	Pc21g11550 protein	1	287-312	DDNSMPLQRRNPRRKGKAHGTSWKSG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HM55	Pc21g17240 protein	1	309-330	ATMTWLRKSRAKKPPKDSLFST
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HN64	Pc21g04940 protein	1	10-29	VSGIKKRKASAPKPRVSPFA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNZ0	Pc22g02830 protein	1	82-111	ISMKRQAYRSKSMSRRRRRRREDGVEEVGD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQV9	Pc22g24500 protein	1	14-36	HRTSVACVHCRRRKIRCLVAPDD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTW2	Chromatin modification-related protein	1	500-524	RPTRSRDPASTKRTQKKPIPQPAIP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVA6	Pc22g14690 protein	2	56-89, 1063-1084	GPSGFSKLLDARRRRKENKKKTQKHNDEPAVPPV, NGAGRGKGKRKKGDSGRRESTA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVX5	Uncharacterized protein	1	223-267	SNSNASSNKKDKKKNDKSKSDDKDKQSSNKKDKKKQDHEKDAIWC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWR5	Pc12g07220 protein	1	26-56	SSCSHHHRIKCCVCKRRRPKSQYSNNQLSYL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H2K7	Pc13g05420 protein	1	86-105	NAYFRSKSKQKISYKPARVD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3Y1	Pc13g11040 protein	1	16-50	SCTPCAENIDRRKRRKDATRIQREKEKERRNNEIV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H4I3	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial	1	53-78	QLKQEAKALRSHKKQRKETEEASRQE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H4J1	Pc13g09010 protein	1	196-216	VSDRNTRRRRSYERTRPPHLS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAC6	DNA-directed RNA polymerase subunit	4	228-253, 557-577, 1136-1155, 1320-1339	GVSPSYKKDRYNKIFRKQLPEKQKLA, APSNWRQKGSRNKKVYRHLTT, ADVNKNKLIKDKKKNIEGKV, LTKAELKKRNEEKKGVKGTT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAK7	Pc16g13160 protein	1	1-31	MGPRRSHRKSRNGCPQCKARKLKCDEQYPCT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HBD1	Uncharacterized protein	1	256-288	PVEECFRNPQNTKHKRKSRRKQAKRAAALEAKK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HCI8	Pc18g06110 protein	5	80-105, 119-140, 147-173, 899-923, 1060-1083	APVMKRQTIAGRKKRREGHREDAART, EEEDARRRNKSRRQEEEEVPDA, AFMTETEKRQNRKFKKKDAYHLPNLDV, DDAHVAFRKKFRKKASKIFLPPSFP, GSATRAKAGTNKKRKIRRADSPEP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEM0	Pc20g07880 protein	1	302-323	AEAIKQKRASRRRREEEDDERV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHD2	Pc20g14470 protein	1	5-24	GGLLKKRRTKDSQDLGKPDS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHQ7	Pc21g14350 protein	1	80-103	METALKREREKVKKLSNNEKPEDS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIV6	Pc21g06130 protein	3	33-56, 98-133, 265-290	TIEPTLGRKPSKRQSNRTSRADAA, GSLLRRKPSQNGNPPNKLRRKLSKRKANEIMREREI, LRELLDRDRRRREKKQVDDQERLRRK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HK81	Pc21g15850 protein	1	50-70	NYPEDERKKVFRKVDRRLIPM
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKA3	Pc21g20090 protein	3	85-116, 141-162, 370-390	VYKCLRCSQRTVLPRRNSKKPISKPSSRATVT, GDNQSSKKRAKARKQGGLQALL, AVGGSKNSRKRRRQDSDASMI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HLI0	Transcription factor rfeH-Penicillium chrysogenum	1	281-305	CSSVTKQSKTHKVSKQKREWHGDSA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HMB6	Pc21g04430 protein	1	707-728	VNRSRATSPANRQRHRRDRSSG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HPP9	Pc22g00920 protein	1	1-25	MTFREKVKRVFRSKSKNDGKPKIEY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQX6	Uncharacterized protein	1	2-31	NPNTSKMTTTNPKQIKKKNWPQRYDQIYCY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRX2	Pc22g12540 protein	1	515-540	VTEVLKSERGKHEKKKDSGDKKDEDD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVV6	Pc22g06240 protein	2	21-40, 46-69	GQPPCQRCLKTKNQGCNLTD, QRTRSNTVTSRTPRKRKASFALSP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWY7	Mechanosensitive ion channel protein	1	845-867	DEERRSRTSSRHRRPSNLSAPSN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GX76	Pc12g15070 protein	1	716-740	LVSDSKDDDKQRKDRKKAIFDCAIC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H892	Pc16g05550 protein	1	179-204	YVRSHLINRRRQRKANRSNTGRPPSE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAL3	RNA helicase	2	42-89, 759-788	NAPADNKKRKREVESVKPKNKKQKQQEKQQLKNAKKNKKNAEPAPEPE, NGPNTKKSNVKLSNKDKKRLDDRQMRHDGN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HCG8	Pc18g01680 protein	1	236-260	GVAVFYCCKRWRRKQREQAAPHVFE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HE87	Pc20g04790 protein	3	43-64, 147-166, 535-554	LEDHLKREIKKLQRFRDQIKSW, TLHAQMKKGKKDTKKADRMA, ALRNQSWRFHKQYQTWFQRH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEJ2	Exosome complex protein	1	189-238	KDSQKKSKGEHKSQSSKAKKERKISKATLKEEKKERRLKKEEARKARKAQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHD5	Pc20g14500 protein	1	48-78	SRAFRFKDGSRPHRKRTHRHRSRTRDGESSK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKY1	Pc21g16230 protein	5	26-45, 467-487, 957-980, 1162-1185, 1211-1236	RSAARRTRPPPSTPPRSRPA, PPPTTKKTKVSQKSSEKKQLL, AASQPTTRSKKKRTGLKLDLNQTT, LPTEHPPKLHPSKQPKASSNPPAD, PEVPGTPPPARKERRKQSPRGPWRKR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRS3	Trehalase	2	26-45, 511-536	GKDDNIKKFKSRRRAFSVGL, ESSAVWDRRARKRKQRMDQLLWDQEK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSN5	Pc22g04210 protein	3	227-248, 450-476, 555-577	TPTARPKSRSRGKDFRKNTRDN, ERVQKVKAITPRRNNKSRKNTVSNYQG, GTSYAYRKKEFRTRWRDQFKLVE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTJ1	Pc22g09040 protein (Fragment)	3	22-55, 115-142, 188-214	FTDKDTKPGKIKVKKTSKASTKKKADGKAPRTCF, HVRGCLKAKQEKARKKKEARDAANRLKA, EDDGKESKKKKKKDEPKQKTAKPKGPV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUJ7	Pc22g14320 protein	1	247-279	ERSARKLTKQELKQFKEKRREKKEEKRRAWLRD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVG6	Pc22g23210 protein	1	19-44	AGISCNRRRAVKRKCLSTRPRGSYSP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HW94	Pc23g00400 protein	1	257-276	LKAHYTTHGKRKGRNRYVAT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GVY7	SWR1-complex protein 5	2	43-63, 68-99	AAEPAKKKRKTDTQSQIPKDA, GDEATIRRAREKKQKKTAKKPKGQRARDSDED
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GXG0	Phosphatidylinositol 4-kinase	3	61-82, 317-337, 696-721	HTPPGHRRRHSGFHRGRRNSGV, RTEDAPKRKKRPWNEACRPSG, LDGWPSLPPRQHKHRKNGGPVPFRVP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H078	Uncharacterized protein	1	177-199	SPSNPKAGDKYRRRKSERLEDFD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H229	Pc13g03880 protein	1	60-79	ATNKKPSPSAGPPPKRKIQF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H2F8	Pc13g05200 protein	3	7-40, 161-180, 1256-1283	APSSRARSRAPSKGRSRSRPSLRRRDSSPPPSSP, GDVRRKLEQAQKKARSREED, AEQINRPRAPPRQRHIRKTSSQWSERRY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H367	Uncharacterized protein	1	62-89	VLGSEKSGRRDRKKKEERRDAKRPEGER
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3U4	Pc13g07440 protein	2	2-22, 89-109	SSTSMAKKNKAKKAADPNETS, DRDYSKSKKRADQLQKDQDKG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H440	Pc13g09580 protein	1	356-382	LERNRVAALKCRQRKKQWLANLQNKVE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H669	Alpha-1,3-glucosyltransferase	1	1-28	MAPPTPSSHRPRKKRKIATSPSSNNNLI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H738	Pc16g02450 protein	1	363-387	RGILCGPRERKKKMEEREGRKGMRL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H772	Pc16g02510 protein	1	150-169	ATVTKKSKGKGKRGAAIRRG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H7H8	Pc16g06640 protein	1	1-26	MSSNEKKRLRDRRSQQTLRDKKLRHT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H7V8	RNA polymerase II transcription factor B 38 kDa subunit	1	55-79	NCPVAGCRKTLRKNRFRKQTFEDIG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H888	Uncharacterized protein	1	388-411	HAEPLKSRRERWRVTARQLRHFMT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H8T4	Uncharacterized protein	1	276-305	AEREEQKRMASRKRRARAKAKRARVSCETE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H9Z2	Pc16g14460 protein	1	25-49	SVSTPSKRASSKKRARSAAREESKE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HB39	Uncharacterized protein	1	111-133	SVDNRHEGKRLPKKQKNNDSGGG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HBE5	Pc18g03810 protein	1	22-53	GARPYRSHKVRACDLCRKRKSRCTVDIPGQSC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HD21	Uncharacterized protein	1	63-84	TGAKVPRRSVKQKRPGDVRRSA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJ52	Uncharacterized protein	1	29-49	EMGHGKKSKWKDLLKKQNQSA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNK9	Pc21g05140 protein (Fragment)	1	373-400	EAWADMAKKREKKKSSWKMKRGTSSFGD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNS4	Pc21g14000 protein	1	197-219	ERAWQRDIKKFRKKAPARPRDTH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQK2	Pc22g07150 protein	1	253-272	VSSVGSKKPRRNSLKDQFKM
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HR00	Pc22g07530 protein	1	16-38	KSSCDLRTPRCSRCIKRQVECAY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRK6	Pc22g16740 protein	1	459-486	DSETPLGRGERNKRKRRFRSLSPTGRSG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HS93	Pc22g08280 protein	2	49-68, 250-279	STSQRWRTASRRIRNRAGTI, ATGPPPANPKERKKQKRKSKKNIKLTVHIA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUK5	Elongator complex protein 1	1	1181-1212	GKTGMSRHTSKTRRREERKRARGKKGTVYEEE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HV06	Pc22g18590 protein	1	100-120	SRDLRLLRKARRSPPVTKKTL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GVS2	Pc03g00260 protein	2	1-27, 58-79	MTSPCIRYRRRRRCDNSHPTCRNCAQR, EDVLPRPKGRRRDLTERKRLEA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GX31	Pc12g07590 protein	3	27-50, 461-487, 498-517	ANAKSARDKKLRANLKRQEFKHKE, KIKNRGRGRNSALRKYLRKKGGKNVID, KEYLARTKDKLKQEQQDLGP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GXD5	Pc12g07830 protein	2	206-229, 1225-1250	HNQLQPSKRRRAPEKDTNSKQHAP, TDKTEQSSNPNPKPPKRPRNAADGPE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZ37	Pc12g01640 protein	2	32-59, 63-82	ANGPKKATRDGQQPKRRGPKPDSKPALT, ELNRQAQRTHRERKEQYMRA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZA9	Uncharacterized protein	4	121-180, 352-375, 415-463, 473-514	QRPNQQPNPLSKRQQRKQRALQNKQKQQQQNQNEQPSKQNRQNRRKQKFKNQGQNSQKSP, RDDDRTKSYKKHKGDRHTSPERNS, DDDTKSYKKRKGSRYGSPERKSRGRPSPSRDRGNKSRNRSRSNSWEREE, WGQDSNVHRDKKKKKERWEIELEENAKRCRSRSPSRERSVTG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H124	Pc12g14530 protein	2	217-242, 304-329	RDLTQDHSQKRRKGRGKPYPHPDNEF, APTPVPKKGKPVKWYKKPRNTSNSTL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H1L0	Pc13g02570 protein	1	539-563	QEEKTKLEGKRAKRQLRLQQVNQAD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3Z1	Pc13g10590 protein	3	30-53, 58-83, 1057-1080	SPFSRPTWTQFTRKTRNDQREINF, LFLRRYNLIKHPRLRHDQKRHIDEWM, VFSSPTRRPVRMRIKYNRSDPFMR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5L6	Pc14g00020 protein	1	110-131	RASKTKCSGERPCQRCRWKCST
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H8A4	Uncharacterized protein	1	322-348	LAGVRKFYRRIKDKKEKKYDRSLWLVD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H8Y1	Pc16g03210 protein	1	494-520	VRGQSSPTTKQPSRKRQNSVAKAQSQS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HB49	Pc18g02800 protein	1	356-380	RYRSVDPKTRPPRPVQQPAPRLPKG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HCF0	Pc18g01500 protein	2	59-79, 162-182	GKDILRRTSLRSKDKSKQASV, IQPSRRRTILYKRPRRPMLAV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDQ1	Ribose-phosphate diphosphokinase	1	89-110	LYFPYSRQSKKKSHRGAITARM
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HF09	Protein FYV4, mitochondrial	2	87-106, 224-247	IEPARQRRYLIRKREKFRNG, KVDGGERRRREVQNKKRLDERKKA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGK7	Pc20g12660 protein	1	6-56	VKQACDACRRRKVKCIFPKPCEQCRAAGLVCRTTSQRQKKGRQGQTANILN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIX4	Pc21g06310 protein	2	187-217, 250-271	LDDGSSSKSKKKKKNKRRPKSQRGQNAPSGF, EGIKRFLYKRRLEPYRRKVFLK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HR94	Pc22g24790 protein	1	1-31	MSSPLSARPYRSKRQRPCDQCRSRKLGCQTD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSA3	Uncharacterized protein	1	3-22	SEFAKERRRKARAFELQRRS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSI8	Pc22g25500 protein	2	17-36, 127-149	VIVIWRKRQHTRSSSNDPAI, LDRSCCSSSPKDKQKPDCNRVNV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWZ8	Uncharacterized protein	1	16-37	PVFEYSKSIRRRKDLRNISVIC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GVP6	Uncharacterized protein	1	185-207	AEYHVFHRKGKTKPNRTCKAVSI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWI9	Uncharacterized protein	1	46-67	VESLRGKKYHILRKQRRTGAKV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYE0	Pc12g15860 protein	2	111-135, 138-168	ESGAPAVPRKRGRPRKHPLPAPGGQ, ITKGRSKTGCITCRRRKKKCDETKPSCLNCQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYL2	Pc12g08840 protein	2	3-26, 41-60	DSTPTPTQQKRPRVAEENRKRAVR, GVPCRRCLRYRRQCNFTHID
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H1D5	Glutamine--tRNA ligase	1	16-39	ATEPTVPPKKSKSQEKKEAAAAKK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H2M8	Pc13g05520 protein	1	103-130	RDAGRDRRRDRTPPRRGRSPSPRRSRGG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3Z2	Pc13g10600 protein	1	81-100	RYNRRVPRACASCRQRKTKC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5V8	Pc14g01300 protein	3	25-55, 723-744, 767-800	QDTGLRKYWKINPILKKRKRERKADCGGPDI, AQLSRSRSRRGSRIWSKKPGVD, LTPSEPMRGRSRSRNNDHPRRRLTKVRRQTDLCL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAY0	Pc17g00520 protein	1	709-731	EGKETQGRAGRKRRPPSLPDGFE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HBN4	Pc18g00190 protein	2	40-65, 94-118	LPPRVDNKLLARQKRRRTSPEDHAVL, VQIWFQNRRQNDRRKSKPLQPHELL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HCJ4	Pc18g06170 protein	1	87-114	TVAEVRRQKRKTTRRTNGRRLRTARRIA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HCZ4	Uncharacterized protein	1	17-66	VFQLWTMIRSKKKKRKKKRKHTIAGTLLQQKTDSSPFKLCRKRRRILCMT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HE65	Pc20g15760 protein	1	327-348	LFDPCRTKRRSKLLFMPTPNRP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEZ3	Pc20g08630 protein	1	465-493	EQSPTLKMGKAKQKRAKKAAKQADLPTGF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HI82	Elongation of fatty acids protein	1	283-305	ATYNKTAKTGRPRRNTGQKSLID
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HMW9	Pc21g17610 protein	2	342-361, 452-475	GTPIRRKKRKGALTNPSAYS, NTSGQAKRHGAKHKRGKNGNEAIG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNV8	Pc21g18310 protein	1	281-302	IPRFMIKKLQARNERRKTRGFG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HPV4	Pc22g06640 protein	1	3-25	DESPAQRSARLRRERREAKIKEG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HT05	Pc22g26000 protein	2	572-595, 853-872	ACMSGKQHQKRNSRARRPRLHSTG, GYSIYGRRRRPSRRLLESLG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTT2	Pc22g22280 protein	1	2-25	ATLYPPPSKRQKLVQADKAREQQE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWU5	Pc12g11020 protein	1	438-457	STHLMQSRPQPRPQPRPQST
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H0Q3	Pc12g10450 protein	1	110-131	KSGRGREWEKGKKNKDNVPRVL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3L8	Pc13g13480 protein	1	56-80	GDAQVVHPRDRKKRKNLHDETDEPK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H9E6	Pc16g10300 protein	1	354-379	LGYPSARQRRNEKKAAKKPQNSVSTL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H9R3	Pc16g11930 protein	1	96-115	EEHKQQLKSREKKQSKMEQS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HD15	Pc19g00220 protein	1	464-493	AKQTIKKMQSHKIPVKRSKRIIKGASKSPL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDA0	Pc20g04150 protein	1	299-331	GRRSTPVHTRGRPQRFRRPYRSRSQENIDRSRR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEN6	Pc20g08040 protein	1	52-76	GFPAPRQRKPSSFKQRRANQSTPPA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEU4	Pc20g05340 protein	1	1167-1198	QPEVKRDRGQPVKHENKTKKTNLQPTAPIRRP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHS0	Uncharacterized protein	1	3-25	IPTRDRTRISKCRLPTKKEWTEA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHY7	Pc21g01190 protein	1	103-133	EDFATRYHQNQRKQAQRKRLEKRLRATKVSI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIV5	Pc21g01800 protein	1	10-65	NSPAKKTSAPEKKYKCQFCNRAFSRSEHRSRHERSHTKERPFKCLKCRSTFVRRDL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJP6	Pc21g06790 protein	1	22-41	DEPPEPPKPKKIKALDPDVV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKC6	Pc21g02790 protein	1	121-144	GLSCEYARERKKRGKASKKDIAAT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HL54	Pc21g03450 protein	1	670-693	TNDDGNPPRRKRKPLLGRAPSHSS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HPG2	Pc22g00480 protein	1	1-34	MPPRRAHTKSRQGCDQCKRRRVKCDEKGPPCSNC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSA0	Pc22g08350 protein	1	74-95	LLSLVYKRWRERPQRPVKIWAF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUI6	Uncharacterized protein	1	37-56	KVCRNPAKSGSKRRRARLGG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUW3	Pc22g09820 protein	1	479-500	FDSPSNNKKVRRKSTREPTMTM
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVN9	RNA 3'-terminal-phosphate cyclase (ATP)	1	359-386	IGSDRLPKPKNKGKQKHQQAQDRRHDSQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVP0	Pc22g15210 protein	5	6-34, 142-161, 233-259, 777-800, 804-823	SNTRSLRRSMSTRSIRKPRRPAAEIPDAA, SSYRRLRKAKSMFSTRQRTS, VQPRRSSFLLRRKREHRPFRKSFRATS, KGVGLKRSWTKEQQRRYSARRAPI, SRINHFRSMRTQRDNRANNE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWV3	Pc24g01630 protein	2	10-38, 99-126	AVRTRARTACQSCRKTRTRCIGGPPCENC, DLESHKEVRPRKRRTWACLPCRLRKIRC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GX75	Pc12g15060 protein	2	659-693, 718-895	GDRPRHMTRDRSRSRSRRRRTSRYDTDRRRERSRD, GGSYRPSRRSRSRSAGRRDRDRSIGRDRERIRDRSRSRDRDRSRNRDHDNYRPRRNRPSRSPVRRRSRSRSRSRSRRRARDRGRSRSRSTRRRSRSRRRSPSPTLDIDRYVPSTSNRSKSPRRRVRSPEREREREQRPRIWLKQKREILRLPWKKRRRRRKKKKKRRKWMIADLVDEL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GXW2	Pc12g04390 protein	1	462-481	ATSRLRRRSWARKSLSRLFG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYM3	Pc12g12390 protein	1	173-193	HSDTRFPQRKRPRKDAATPAL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H4C8	Pc13g08450 protein	1	48-75	QLAAKDCPTCQRRRIKCDRGLPGCHKCG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6C7	Pc15g01920 protein	3	28-50, 69-96, 99-119	MYDDRSRSRSPDRARSPRRLAAD, DRDDYRRRTSRSSPHRGRNTYKDRDREG, SASGNRSRTRSPRRGQSRMGQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H869	Pc16g04080 protein	1	712-732	GENARLSRRRVQLKKGIQDLE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDW2	Pc20g15060 protein	1	20-50	RCEICNKVYSRRDLRDRHRRRCAAKGGQSGK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFG2	Pc20g05800 protein	1	126-149	LPSPALRQFRRRSINRRSKKALST
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFT3	Uncharacterized protein	1	58-87	GRTLELAKKKKKEKRKRRINTQRQKQIEIP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGV4	Pc20g06570 protein	2	37-71, 79-102	IRVALACNQCRKRKVRCDAHQPKCRNCRVRGEVCE, EDCSAVRRRATKRWQSKVRQEVAQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHJ6	Pc21g05500 protein	1	455-482	VSDLRGENEKKKQKRARSRKYLYVESGL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJ95	Altered inheritance of mitochondria protein 6	1	57-82	SPGLSGDRSKRQRSCRSRYLHGLRRA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HK93	Pc21g19990 protein	4	78-100, 191-217, 249-271, 503-532	DEDLNEDRRKRRRTDTTQTTEPT, SSPPRETRNRAPGKRGRPRKAVSKVAT, PSAQPRKTESQPKKPTHPFFSKK, KSSKENAKSKSKREKKAKKRQKADKLDGFV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKT3	Pc21g07500 protein	2	251-272, 810-830	APSKYLKVRAHYKKDKTFNRVF, FTTSPPPSPHRPRPDSNRTSE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HMB2	Pc21g04390 protein	1	55-76	VSCELCKQRKVKCDRVQPSCGW
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQI3	Phospholipid-transporting ATPase	2	24-45, 55-77	VSSNVSKPTKRQRWATTRAPGP, IDRFHKRSDVRDEKRKSNNTSTT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQS2	Peroxin-1	1	1111-1133	SAKLEAIKNSRRRQRQVEQGTSG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRH8	Pc22g12360 protein	1	1-34	MSTKQSKPKQACDNCRRRKIKCSRELPCDKCQRL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HV95	116 kDa U5 small nuclear ribonucleoprotein component	1	159-178	LTERLEKRTGRKREEQLRYT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HX59	Plasma membrane ATPase	1	55-81	IRESRSWYAPWQKKKYRWKYVGVGQEY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GVT4	Pc04g00060 protein	1	38-60	AELRRQAEERERQQRERNRPTTF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWK7	Uncharacterized protein	1	17-46	AERLYFKPKVSKPRGRRRRRHGDCGPSFSP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYL6	Uncharacterized protein	1	79-105	ITNNLVTRKRWKRSKVGRNKRTPLEAC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H2K0	Palmitoyltransferase	1	445-474	CIPCMTRKPLRSRHCRRCGRCVAKHDHHCP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H2R6	Phosphatidylserine decarboxylase proenzyme 2	3	133-159, 222-245, 739-758	NQPPKWYTLNSKRKTSKRKDSTVSGEI, GPEVGEKRRRRLRLARLRRKSLAA, LYKGIKSRDMEKKRIRRVLR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3G8	Pc13g06350 protein	1	44-67	SPDDIKKGKKIWKQANKHNTPFSQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H4T6	Non-specific serine/threonine protein kinase	3	56-92, 99-136, 151-186	LKGTRTPLRLRSRTRSLSRSRSRSPYRENKTEKRGYD, DGGYDRRPRHEPPRRYRSRYDDRRRDRPAPNRRPNSYY, TDDYDRHDRHKDKRQRTRSRSRSPYRESRKPKQYSG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H760	Pc16g01820 protein	1	147-184	EKEEDMKKKQRSDRKARDEQRAKEKKKQQEYEQLKWQK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H8I7	Pc16g06040 protein	1	50-75	LMWYVRRSLRARRLRRQEDQQNDQFN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HBY9	Clustered mitochondria protein homolog	3	866-890, 1149-1171, 1210-1236	GSTHEEPKKKGKKKGGDNKSPARTA, AKHAKDIQARRLRRNPLNPRVSS, GTDTSSSRSKQKKRAATSNPKLRGSKQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDU4	Pc20g14870 protein	3	17-43, 48-69, 1270-1297	EHENSPPRLLRPRRSTRPPNNYAQEQE, QSNARSQQKKTQGKPVAQREAV, KTNPLRRGTDRIRKFRRYHRSPLYHVAD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGE3	Pc20g00930 protein	1	718-741	APLPPVPVRNPNRRKARSPSYSLF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGF0	Pc20g03520 protein	2	121-141, 150-177	HKRSRNCYELRPRYKTREDRY, VETQSQSRKGRAKKPRGRRHTMNDDFRA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHQ8	Pc21g14360 protein	1	282-323	AEFERRESDKKRRREAKFKTKLQDLKKRTRVEAYRRNRQGPS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HLI4	Uncharacterized protein	1	158-179	IPPTPPLRRSARIRKYIQKGNR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQF1	Uncharacterized protein	1	40-63	YMYNRCRLRARSNQKRQRTKHLTA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRQ2	Pc22g25130 protein	1	1-23	MYNLPYTRKRKRFTNSLSPGRNV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRS2	Isocitrate lyase	1	17-38	AVQSWWKDSRWRYTKRPFTAEQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSJ6	Pc22g25580 protein	1	425-447	CPFCPDQQHKYPRPDNLQRHVRV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HT77	Pc22g13490 protein	1	684-711	SSVPVMVARRKLKRHTWKDKLKGTANVR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTB0	Pc22g21840 protein	1	1048-1092	PSSFPLGSSRKDKKKAKKRAEWAEENSHSSNRTSKKRKKSKLENE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTR2	Pc22g22080 protein	1	537-562	EESQWEAKTRREKKDQDQKSKTQDDA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUR5	Uncharacterized protein	2	44-64, 70-92	GQPGRHRRKGAKETPRRKGAI, IRLDWMRRTRPKPHRRYEIDLQD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWE7	Pc23g00970 protein	1	634-659	SLNRLDCDCNRKKKPFWGCPFGCHRY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HWF8	Uncharacterized protein	1	82-105	LRVFPRQKREYPRRRYNRGQSTTI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H149	Uncharacterized protein	2	20-43, 123-154	LEEILRRDRILRRNPQPSRRSAGS, KVYFLTGKSHFRKRNKKTSRKRPVSLTPRSSP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H1N0	Pc13g01220 protein	1	509-534	FVVPRRSSTRSRRKSIAHNTDRPNGA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H269	Histone-lysine N-methyltransferase SET9	6	1-20, 38-59, 94-117, 311-330, 473-500, 623-644	MPPKRARKSSPAAERRERLT, HAYFWTTTRKNRTKYSPARGIH, MTNLRSPREKEWFRRHLRKYIQMY, SCSTPRKRAKFQRQVSKLRE, KLDDDKVVDKPKKRKPRTKRRFIVDSVE, VTESRRDARATRRRTRELRMTM
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3E5	Pc13g06260 protein	1	1-21	MKAFRRSLKGEKDPKHHHISI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H4Q5	Pc13g10050 protein	1	23-43	LEMPKIPPRPGNRRNDRSASP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5J8	Pc14g00280 protein (Fragment)	2	19-45, 598-619	RQDPVSCESCRKKKLKCDRGLPCSSCS, MMEILRRHWKHEKRVSSRDLQE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5P8	3-oxoacyl-[acyl-carrier-protein] reductase	1	1645-1664	QAYKTKVEARQKKAYRYFHN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H660	Pc14g02350 protein	1	12-35	ADAVNQKARRRRKSLFRKASQYSS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H7C8	Pc16g06560 protein	1	257-279	ESQEAKRRRRRASHNLVERRRRD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H7F3	Conidiophore development regulator abaA	1	173-194	EYIFKLTGKRRTRKQVSSHLQV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H7H4	Pc16g06610 protein	3	87-107, 569-601, 691-715	IYPRSQAKDFPRRPRCWASRF, FRDTLRRARDEQRERRRIRRRQVRQARANEGDK, SRLKDMLLPRKVKKQQSKEDDSGSK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H7S2	Pc16g03560 protein	1	68-90	IAIPRGPDRRIWKSNRRVSRACD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H9Y6	Pc16g14400 protein	1	1-22	MGQRHNRRRTRRSSNRAPQTVL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAK2	Pc16g13110 protein	1	159-180	NTEPKLKPPRPWRKIYKHVIYA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAW3	Pc17g00310 protein	1	435-459	ASNYRPSHWKRDRKVHNTRSRAQCQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HBX1	Pc18g05010 protein	1	10-32	HVGRECSHQKWSRRNTPKFTVSS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HC12	Pc18g05200 protein	1	111-130	GTARDDRKSNKARDKLLRLS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HC96	Uncharacterized protein	1	168-192	GNGGQKKASRSKKEKIKDVVNKVIP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HES3	Pc20g02680 protein	2	31-51, 126-148	DQKSRKKMSKSQEEEMRRQRE, VSTVNSPRRVRRRKDPTSYNVLV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFB8	Pc20g09600 protein	1	31-73	ADCPNKPPCSRCRRESKQCFFAASRIRKTTSTKRKAQSPLPQE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HH01	Pc20g13640 protein	1	22-41	LQEKRERKLLRTIRKNDVAK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HH65	Pc20g03950 protein	1	22-51	PEPTGKTSKGTKRKASTEKAPQPKKEKTED
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJK8	Uncharacterized protein	3	300-323, 373-404, 464-492	VEMPSAKKKRGRPKKQPLPDNDED, AAPKPAKPGPKESKKKKTRKSKTTPIHEPQAD, NVQDSEKPAPKKRGRKRKQTTEQAETPPE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HK52	Pc21g11320 protein	1	401-423	TDLSAFVKRKPAKQPSQQPETAS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKQ9	Pc21g03110 protein	2	1144-1167, 1415-1436	VEGNQKRLRSRHRSASRRRAEKGT, ALPRSRSSSRSRAKGHNRTSSG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKX1	Uncharacterized protein	1	26-48	NPFPQAWTRQRKNSSRSRPYNAW
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HM77	ATP-dependent RNA helicase DBP10	5	27-51, 757-779, 799-821, 855-875, 886-913	DSDDGAKPPLKKKPQKPDTNETLDF, EARSIMRWDKRHKKYVARQNDED, FRSGRFQAWKKGKRVDRMPRVGE, GDYDKMKKKNEAARERQHEKL, LRSTDDIRKARKQKLQRRDKNARPSKKR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HPR8	Alkaline protease 1	1	77-100	DTLLNDLRTRRKLRRRSEGIDSRG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQ50	Pc22g24030 protein	1	9-31	VNPAVAQRKQDKQKELRKGKSEA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTX2	Pc22g04890 protein	1	259-286	PGTPKSDDPEKKKRKRTARERDLCHVKI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUE9	DNA replication ATP-dependent helicase/nuclease	4	134-161, 241-267, 316-335, 1599-1622	NPDTSSQTPGSRRRKRRHSSSPAGSPSN, SCTTDFPTSRTKRRRVNRPDAGPNRGT, DARRCRSSSPTKDHRLHKAD, TPGSAKAKGKGKNKSPSSRPSREP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GVY1	Pc06g00360 protein	1	4-23	EPQPAQKRPRLPFKPPSRTT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H412	Pc13g10760 protein	1	469-490	GASTIDKKKKHRLSGFFGRLKE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H4F4	Pc13g08670 protein	1	507-531	TERRLWRWILEYKKQHRNRFGIEEC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5F7	Pc13g00070 protein	1	905-931	LVNSWPPKRNCYCSPRVKRHIKFLEPA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5P0	Pc14g00570 protein	1	453-477	LNVLYCAKINRDKRKGKYDQYAGYN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6B8	Pc15g01830 protein	1	38-58	QTNVNRSKTKRWVEAKKYSYD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H7U6	Pc16g07020 protein	1	414-436	QLLWPGRHSRRVYKTRGKSYTLC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAR3	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	1	94-121	HDDRDGGKKDKGKKKKNKGQNTNRSYGT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HB21	Pc17g01010 protein	1	1-29	MAPPLSRVKREQLRKRRNNLLRRHNEFWL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HB44	Uncharacterized protein	1	1-22	MTRFFLCARWHRQRQADQVGQR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGE0	Pc20g00900 protein	1	180-201	VSTDEKKSEKKEEKLAKRKDLE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHW9	Pc21g01010 protein	2	123-143, 408-454	FENTNNKKKRKIPTPGNLGGH, LIRQYEMKDRKERKRLAEKKRLLEKAKMKGRKTKKATKNASKNGSQP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJT5	Pc21g11160 protein	2	14-40, 836-862	RENGVLGPQKSKKEKRQNAKTGVGAKN, RAESNRLKKEFKRERKGAMRELRKDAS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJY7	Pc21g19890 protein	2	521-547, 946-966	SQSLESSRRKPLRRRRRKRAAGVGGPI, NLSPAPPRIRDRPRRDSDDDG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HMH1	Pc21g13230 protein	1	1-21	MASRKKQPAKKKDAIHFVNAR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNB5	Uncharacterized protein	1	154-176	VTSSPEQSPKKRKSRFQLSQLAS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNE1	Pc21g17990 protein	2	2-33, 36-60	SEPTPRKRSRLACTSCQSRKRKCSGGQPCSTC, TGSECQYSARKKRARSHSLYRASLS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNM5	Pc21g05300 protein	2	16-35, 44-70	LSCVPCRQVKCDRNQPCEMC, CAYTPKITKRPGQHRFRPVRDRARYLD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQ22	Pc22g19800 protein	1	685-712	FLNTGNTTRFKPKRKKTRTSQMPSPGYT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQW9	Pc22g24600 protein	1	21-65	ACEACRKMKMRCIRPQRGQQGGKLTEPCQRCKRTNRECNIPEPRK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRR1	Pc22g03550 protein	3	126-147, 179-208, 211-240	MDWGIARRRQRRGPSIRYDHFF, DEDDPPTRRRHLRRGVKKGKRRAREWSEES, SDTGKVKRTSSRLRKTRRRNMKERLEDDEY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HT45	Uncharacterized protein	1	15-35	TTTPTRTRTRTERQRDENVNE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTZ3	Pc22g09200 protein	2	314-337, 1007-1029	EFPFPDVSKRKKIKEKKTPMYAVA, DTKASTVKRLRLRRKIIVGHNSG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUI2	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	1	442-466	RADNEPKTSKKQMKRQAAMERAKLR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HW01	Pc22g15430 protein	1	127-149	KESLAPMKKTIKKRNDKKTDFEI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H024	Endoplasmic reticulum junction formation protein lunapark	1	405-427	DQKEESKPAPVRRSKRSAKGNKA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H0X8	Pc12g07000 protein	1	64-92	LPECIKAHTKPRTHKRVCKGRVQSFRRSY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H2U1	Glutamate--cysteine ligase	1	505-524	DRKFWFRKDPFPRRVPRSAQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H781	Pc16g02090 protein	1	81-101	VLNVRRSTRYRPRPLYPQSFV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H838	Pc16g08210 protein	2	102-129, 846-865	FSRKGSRVVNERRQQRERQKQAQEATNV, AEKLREQERNDPTRRRKEIE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HB60	Pc18g02910 protein	4	24-44, 111-134, 1251-1272, 1557-1578	AAADAKKKAPRRATPAARAAT, EQQTEVPKKRVGRPRKNPLPAEAP, LSPSRKSPRVSRSPTPKRRSIT, QDEESRRQRRFRMEAARRKSLV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HB88	Uncharacterized protein	1	4-25	DYHLWEKKGRRLQKWIENYRAS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HC27	Histidine kinase	1	1240-1265	NENQQPQPPQQQQQQQQRSKQQPLPS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HCS6	Uncharacterized protein	1	88-117	LKPPRCRGGKTRQNRQRRPQGRNREPKPVQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDD6	Pc20g07110 protein	1	282-302	TSSYRKRTTSHQRTTNRVQTN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDU8	Pc20g14910 protein	1	220-239	SEEHLKQRRKRRAELRRLYE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HET7	Pc20g02820 protein	1	670-697	QYRESAPHGRPRRPLRSRPVRRWVGDEE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HF72	Pc20g05610 protein	1	11-41	EKLAAAKKRVAQLQKKKKAKKTPATGEDTTK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFP6	Pc20g03150 protein	1	196-217	LSRKINKRYFSRKPKKSAEQIE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFY1	Pc20g10890 protein	1	583-610	LPVPPRMWKMKTPRPRPHTQRAAYANRD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKE4	Pc21g07180 protein	1	41-67	VCSSTFRRPEHLKRHLRSHTKEKPFEC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HL73	Pc21g07790 protein	1	103-122	ASNASQKKTKKRQQGTDANI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRR0	Pc22g03540 protein	2	401-481, 561-608	SYSRRYYRKNAGKIKAKNRKYQRKNADKIRAKRREYERKNADRIKARLREWRRKNADKIKARKREWRRKNADKIKANNREY, ADRVSASKREWHRKNADRVNARQRERRRKNAGKTKPRIQERERKMKDN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HV08	Uncharacterized protein	1	54-77	LEYWPKRKVSKAKKKLDERRTATY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVX7	Pc22g10670 protein	1	14-38	SDLRGENEKKKQKRARSGKHLYAES
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GW23	Pc06g00840 protein	1	82-102	YFNVLWRKPSAKKHKTWDGDG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWM2	Pc09g00270 protein	1	213-238	FYTRSSKVLRGRRRVLQRQAHGKLDR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H0G7	Proteasome endopeptidase complex	1	219-238	YMKPNDRPQKERNYRFPRGT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H0S2	Pc12g10640 protein	1	30-57	VKRVRCTYLRPAHRRGPKSRRVASHQET
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H1U3	Pc13g01830 protein	5	22-43, 120-139, 154-173, 196-215, 408-427	PEIRAAHRKRVLKCHPDKIQDE, GVRSKSKPTEEKKKARAPTS, THSDRAKTRDQERRRQRQAE, RYAHKRTSTPRRERERDSRS, EPKSSKYRSARSPDRDRVPS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H495	Pc13g08000 protein	2	97-127, 152-183	ETNDFRSKGHRQSPKRKYHANRKGKEKKMTL, FKLPSKAQHKTQRKTTKQKTTKHKGHTKHSTS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H4F1	Pc13g08640 protein	1	472-498	LDGLMNKKKSKSDKRKLTKALPPQKDA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6G6	Pc15g00190 protein	1	289-310	RLECGFVYRRSNRYKKPADYYE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6Y3	Pc16g00800 protein	1	216-237	FALQSKTPKRYRERIPRYLEIY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H761	Pc16g01830 protein	1	4-33	GNPPSATPSAKSKKNKKKAAKAKADSKADE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H7J9	Pc16g02850 protein (Fragment)	1	1-31	VLLQRQKQPRARDREKKLSTKHPSRARQVLT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H7S9	Pc16g03650 protein	1	504-529	STGFGVRYSKKWQKDHKDDVKVQTIV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HA17	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial	1	39-64	ASLRHFSSKSWRPYHKDNNSENNRGG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDP3	Pc20g12570 protein	1	38-57	WSTIKHDKARNDKAKSRERQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HE43	Pc20g04730 protein	1	484-509	MVALNGIKWRQKRNRKEEEKSSCEQD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFK2	Pc20g10010 protein	1	5-32	TESHESTTTSKKKRSRRGNKGSTPCPVA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HFN3	Pc20g10340 protein	4	45-73, 409-429, 499-529, 607-629	DKDPTPKSRPNSLKPTRPRTSNRTRRDSS, AAPNAPSRQHSRKRSRPAEDV, TSTNDAEPKPSPKRKKPNPSPTKPHPHPPAP, LNDDSIQQSQRKRRRLKRRSLGG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJA1	Pc21g02060 protein	2	192-218, 482-507	APGRVRIPESQRRKARKRDPGKPSWAS, AKNRLMSKNSYKHKRNPETRRSISTS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJS7	Pc21g11080 protein	1	336-359	GDSPSPPRPRPRHVSRRLRARSTG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKE6	Pc21g07200 protein	2	12-33, 55-83	STAPRSVRKKFAKPPVKVACLP, RECSYLPSKRGGPRKKKEKSSLSPEQESR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKW3	Pc21g11920 protein	2	95-119, 266-290	TTETNLTHSKKKRKRVTADDYERYL, EDFYRFQSREKRKERQNQLLRRFDE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HMQ9	Pc21g08910 protein	1	52-81	LTVMKHRQSTSLRRKKKKVADRGGRPPAVG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HPS7	Pc22g03000 protein	2	314-338, 436-455	GVGHRVRDCRQQRRNKHGCRNCGSV, HTVVRCRQPKDKDPQDEPAF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HPX1	Pc22g11130 protein	1	83-102	NGSLRNPKHRPRKSISEAIT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQC0	Pc22g15820 protein	1	95-117	RQTMDASPRRVRRRKGNAPAISI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HR80	Pc22g24650 protein	1	392-413	QTVIKNRRTRFPRLRRVDIEGA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HRU3	Pc22g07980 protein	2	1-21, 73-97	MDRANPQPRRRDPRAQSPAES, ADEYWRSSRKHNQRRSPSPIARPSI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSI2	Pc22g25440 protein	1	93-112	QPPSSKPKPRGDPSPTRQRE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSQ5	Pc22g08600 protein	1	3-23	NIFQRLTRRRAQSPSRSPPHM
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GXE9	Pc12g11470 protein	1	322-343	QYSSQIRARRRPRKQGTLSRLA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GXZ9	Carboxylic ester hydrolase	1	493-520	PGSEVEYKRRHCRWPRRNVFKGPGNYTD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GY31	Pc12g15620 protein	1	665-699	ISNDPDATQKKSKKSRKEKKAKKAKAKSESQPESE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYL1	Pc12g08830 protein	1	23-49	LKTSRGFERQKLSRREKTAKAQKDDKA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H1F0	Uncharacterized protein	1	120-141	ILTSSRQAKGKRRKYEESTQSL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H2V6	Pc13g15590 protein	1	488-509	GDPDAICRKRPQKYIEREDEEF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5Y2	Pc14g01540 protein	2	519-542, 775-800	GKVPKFFLWRKKGKRARVEKSETE, SVPNSTKQNGNGKKRNRLSRTLLRAV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H667	Pc15g01220 protein	1	77-102	VEYGEGRAHQRRNRRRRLQHLAAITT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6M9	Pc15g00840 protein	1	238-264	LIHLRRRLTHGKIKRARRDPLRAHDAF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H843	Pc16g09020 protein	1	67-91	SRTVQRVWRGHRSRKATYKVWKSEW
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H873	Pc16g04120 protein	1	85-105	RPKLTREIRRRLTKHERTQTT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HBI5	Pc18g04210 protein	1	40-62	ELSKQFKYWQRTNKEHSRRQSSG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDJ5	Pc20g07250 protein	1	356-376	DDSPPKKKLGRLQKGRRAPSP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDR0	Pc20g01750 protein	1	4-33	VPSSRGCDACRKVKKKCDQLKPTCSRCARL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGG3	Peroxin-6 Pex6-Penicillium chrysogenum	2	3-34, 1396-1418	FEQYGQSSQQPRQRRRRAGKRRLNNKTPIAAR, STTSSKGKGKSVSKKGKSRTGAE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HII7	Pc21g10400 protein	1	674-700	ASSGNGKHDKKDKDKKEKKEKKYRFFK
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIK3	Pc21g14670 protein	1	127-148	RAYGNFKRKERKPQTTSRKEGD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIT1	Pc21g01520 protein	1	4-29	AKQHIPIVKKRTHRFNRHQSDRFMRV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJJ7	Pc21g19570 protein	1	50-69	ESGGKECRTRPSKRGRPAAS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKZ0	5'-3' exoribonuclease 1	1	87-106	GVAPRAKMNQQRARRFRTAL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HL47	Ribosome assembly factor mrt4	1	10-31	VHESKTAKKDHKEQTRRLFANI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTC2	Pc22g21960 protein	1	108-130	GTDAKEAKNKKLKTKHKDTEDDP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTC7	Pc22g22010 protein	2	279-301, 749-771	RALVPQWKPKRGRKRVEDRYIEE, SEATWKQRYTRLRAQMQKKEQAL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HV66	Uncharacterized protein	1	156-179	SFPFRPYMMKRHKKDKHINKLSEL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVF3	Pc22g19090 protein	1	2-23	TEQPRILRPRPRRPFDLTPAST
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HX87	Uncharacterized protein	1	1-24	MGGIRKASRPLRRPDFRGRLQRAL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GXT1	Pc12g15540 protein	1	33-55	DTKVTQLVIKPRSKRRNGFIFML
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H0M2	Acetyl-CoA deacylase	1	6-27	LLKSRVRRPSYLKKLAKPEDLL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H165	Pc13g00850 protein	1	1043-1074	EKIRYLQKTVPRPSKRRWFNWGKGSRRTRPLV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H1U5	Pc13g03570 protein	2	460-486, 525-544	VSDLRAENEKKKQKRTRSIRTIVHEGD, GRACGICRKPGHRRETCPDR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H2L9	Uncharacterized protein	1	189-213	TSPNNRRIIRPKLKFNQRKRLTFTT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3A5	Pc13g13130 protein	3	189-209, 421-450, 1329-1348	NGSLPRPQKRSKSQLWSPSSN, KICSGCIQRERKRASRKKQRKPEEDELFQK, VISREQQKHLREQQARRMKG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H966	Pc16g09970 protein	1	564-586	LIGRQENRSKRRRKDTRLEQLAI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H9G0	Pc16g10860 protein	1	44-67	AGEQCEQAIRQRRRRFPERDLLAR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDI5	Pc20g07150 protein	1	1-44	MNSSAKRPGRRRGTKSKTRYDTCKSIRCVKRGKAKPHCLRCGSV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HIY0	Pc21g06370 protein	2	17-83, 786-809	VHCKWTSEARHCRRARPDQSKKPILSENPRNRPTRESARSSRPNKNPALKPSKNRPTRNNNKTFEPV, SSSLNARRRHDARQNVRNARRSRT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJF2	Pc21g10890 protein	1	18-45	VERRRAQNRIAQRGYRKRLRKGDEDPTS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJF3	Pc21g10900 protein	2	467-492, 523-548	VRDLRGENEKKKQKRARSGKHLYAES, QPRTKPPRGCGVCRKPGHRRETCPDR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HK42	Protein SIP5	1	559-588	RLRREEKEARKEAKKREKEKEKEAKKADKV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HK55	Pc21g11350 protein	1	591-619	DSPYFRQPVNPQRHQARNRRVRPSDYREL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HN02	Pc21g22220 protein	1	83-102	QDRGRCRLRRAKQNGGRANR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNF5	Pc21g22470 protein	1	23-46	RYAYTTFRWHKKYKLPPQVPGVPM
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HP50	Pc22g01980 protein	2	1-22, 60-84	MGALRRVKNKRRTRDYDQVVAD, YNLKAHTKGKNHKRRLRILREEPHS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HPG4	Pc22g00500 protein	1	148-167	EDPAEFKKRVRRCVRLTLDD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HT07	Pc22g04260 protein	1	40-59	SDDKDLIKHKKKPYEVEFKV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTG2	Pc22g04590 protein	1	27-53	AHTLTACTRCRQRKSRCDPGIPRCAPC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HUB6	Pc22g26790 protein	1	100-119	ASNKCRLKKKHEQLKIQHAL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVF2	Pc22g19080 protein	1	557-581	YTEANGPKKDRKREREERYQAKAAL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GXK0	Pc12g04150 protein	1	552-576	IEEARSNCVKRKRKWQLQSEPIGTT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GXM9	Pyruvate decarboxylase	1	1-23	MKSTNTVPQKRKKQESDDEDDIV
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H1H0	Pc13g02290 protein	1	5-48	EGKRNKLALDPRPRARRGRKTTSCSQCHARKQKCNRELPCSRCI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H283	F-box domain-containing protein	1	433-456	LTFYHQFPFHPRPKPRPQNVPASY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3L3	Pc13g13430 protein	1	98-128	IPKVSFRCQRGQKYRDRRRKREDGTPLRNTT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H3R8	Pc13g07190 protein	1	134-158	MDRPGARVAKRRRCKSKIGVNHRIT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5C1	Pc13g12410 protein	2	102-129, 144-172	RKRVIYSCMTCRRRKVKCDKTLPVCGNC, QLDSRPSRSRRANGIKRRRQNQHSLEENT
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H8J5	Fatty acyl-CoA reductase	1	325-344	EWWRAFKKERRLPWNAKPSW
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HC02	Pc18g00860 protein	1	209-232	YIQPTHEKTKREKQRKEKNFLDVD
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEZ2	Protein SQS1	1	351-371	AWQNDRTKKKLRKMERAELRA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJA8	Pc21g02130 protein	1	466-494	PDDSIAQAPQRRKKKKRYRHCGSDDSKIC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJP0	Pc21g06710 protein	1	701-731	LARSQTSSSSPRKPSKRNRRRETSADQSPVE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HK17	Uncharacterized protein	1	3-22	NIFQRLRKGIKSRRSTSKDE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HK32	Pc21g07080 protein	1	330-359	VKNGRSLKSKGKRIRKKKKKAWDSDRSMSE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HK95	Pc21g20010 protein	2	61-103, 584-605	IKDKVTRPCHFHRREPPTPKTPRTPKTRKPRSPHPNSLKFTTP, GSRPSSRKRSSTRQKYFRGPSQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HL36	Pc21g03270 protein	1	28-48	GTHPHRLSTRAKPRRWPLVFR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HL61	Pc21g07670 protein	1	77-96	YDNAREARQRKQREREMMGA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HLY6	Pc21g08440 protein	1	197-217	EDRNKKYGVDHRQKAKKREGI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNR2	DNA polymerase kappa	1	578-601	QETTLIPNNHRKRKTPSQAGIPET
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HQK8	Pc22g07210 protein	3	445-470, 617-668, 744-768	PKRDLPYSTKPKKKKFQWELRFCQEV, VEAITNKKKKTPPSSKKVGKTKLAKKDSKKLSSGKRDKKSKVSQPGKTRAVT, VPASAVAPPKPKKNKPMSKFEQEAQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HR05	Pc22g11880 protein	1	7-39	NYSERPAKRVRQACEPCRRKKAKCPGEQPVCSL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GWQ8	Pc12g03650 protein	1	72-99	HTPRRVSGRRSTPSKRRSRIRSGCRIGI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GZK8	Uncharacterized protein	1	194-215	VYVTGRSNKRSKQRMFKFCSGF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H0M0	Protein phosphatase PP2A regulatory subunit B	1	89-108	EEKINKIKWCRRQNASHFLL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H564	Pc13g13940 protein	2	7-31, 573-597	FPPPSPEVKRSNNPFRKGKNPVATS, SKSQENSPSSKKSKKKQVVVEEFDL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H6D3	Uncharacterized protein	1	21-45	LTSLTERAHRRSRQRNKIAKEETRI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HC50	Pc18g01050 protein	1	97-116	IDQPAKKPRKAKPYVPTLRS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HC58	Kinesin-like protein	2	734-759, 788-807	ERETHNQSPTRKHRPKNATPARSNLL, GAPPMKRTRKMGTRKWDLAP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HCR4	Pc18g02190 protein	1	283-305	EMMWKKLKLRRIYTKPKGRAPDY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HEN1	Pc20g07990 protein	1	148-167	SSFGRAKDKKPPPPPRSHHG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HGL2	Pc20g12710 protein	1	125-243	RERDHHRSIHRHRRERTRSPRRERRHDRGDDPARDKDRRQRRHHDDRDRHHRSHRHRSRSRSRGRDHHRRRSDSRSRSRPSRKDEEHQKRRRMERSYSPAERRRHPERRRDRDDYDRRY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHQ2	Pc21g14300 protein	3	71-92, 200-223, 1097-1126	DFRDRDRDPRDRDRDRDFRDNR, LDDRDLFRRRSRSREPWRGRDRMV, EIKYKAKLNKRWSKRGKGTRKGPRPKSNAL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJ83	Pc21g01870 protein	1	80-105	GEPPKPVLKHKPKAVGRRSKQERDEI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HJG4	Pc21g15230 protein	1	566-590	DEELDLSQRRRRNRKPRAKAESFMQ
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HMI6	Pc21g17440 protein	1	280-301	EVILYPRKRRRREYRLARKAAF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HMM8	Pc21g04470 protein	1	745-764	TKSSLRRRSQRLKGGAKRQH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HN92	Pc21g09320 protein	3	7-39, 134-153, 773-803	NRDDRKSKTVKATKTKANKTNRKTSTKDPEDPS, EKEADKPKKKTNIKIRASEV, DDSASNISSNRRRRPKRRTERRTPAPVEEED
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HNQ8	Pc21g13830 protein	1	30-56	VGSSLSSTSKKNKFRRHCRRFWCIYLI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HR77	Pc22g20680 protein	1	21-48	AVKSRSGCKTCKIRRVKCDEEKPSCLRC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSX2	Pc22g21590 protein	1	404-443	GESPVNYPPRRRKRAYRVRALNLRKKLRIGKRKVPDLEHS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTR3	Uncharacterized protein	1	64-87	STTMSLRSPQRRRRRRVPALGAHI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HU51	Uncharacterized protein	1	208-233	LNKAYASYKKGKKKASKEKGRAISPS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVG5	Chitin synthase	2	110-129, 318-338	GTRQKGSTIRRYPTRRIKLT, QMMFCLKKKNAKKINSHRWLF
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVT6	Pc22g23490 protein	1	58-77	SFNSRREPQRPPQNPSTQNR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVY3	Uncharacterized protein	1	294-324	AEPVRAEPVRRKRARSPVTTPRRSHRRRRVR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GY44	Pc12g15760 protein	1	521-553	YRSRDRSPERFDRRERRRSRSPRSPRSPYSRDR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GY77	Pc12g04660 protein	1	129-149	VLDPKRHYKKENGKAKPPEYS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYN6	Pc12g12530 protein	1	274-294	DSPEDKTKKPMKKKVSHATDN
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H1A7	Pc13g01870 protein	1	158-181	LEERRKVKSKAYYERKKAARRVLA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5Q2	Pc14g00060 protein	1	454-475	NLWFLNKQQARRRVQNGKRAEI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H5Y1	Pc14g01530 protein	1	79-103	DLYQVSYRCLRKRRRHLSLRSYSIS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H638	Pc14g02110 protein	1	311-333	EWEQWDKNLPSKRQRWPGRYYDL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H7Q6	Pc16g08040 protein	1	44-76	QALQKTGRFEHNKKRALRRKIKIHEGRLRNLNI
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H8L2	Uncharacterized protein	1	83-102	LATVKRIRSKWKRREWGSFC
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H9J8	Pc16g10950 protein	1	7-28	LESFRRQWREEVTRRSKPKTTA
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HAB4	Pc16g12230 protein	1	550-573	SDRFDTPSRLQRHKREAHRQTTPG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HBH4	Pc18g04100 protein	2	38-64, 157-183	VAKFAQKKNEWLRTQRNRFGEKRKAGF, TMWMCMRREKSDRRHFKRMRFPPFDDE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HBR5	Pc18g04710 protein	2	151-174, 812-850	VSQTTTQTPKQRRQPSKPPASNGY, LRFRSMSWRNVRDRLRRVRQRRDERKRAVRREILKQSIG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HDH4	Pc20g04260 protein	2	31-70, 123-142	DVQGNAQPERVRKRRRRTMACTQCRTRKLRCDREYPTCSR, IPPVSTRRPHDKERKDCFLE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HHP9	Pc21g14270 protein	1	10-53	NPPSVDNTDDRPRKKRRKYIAKACNGCKRRKIKCNGQSPCQRCG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HK64	Replication protein A subunit	1	490-509	QWRCEKCDKTHPKPEYRYVM
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HK86	Uncharacterized protein	1	253-277	SPASSGPLSPRKRRRLLRESEDNEG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HKR1	Pc21g03130 protein	1	1-22	MPPKKGDQPKKKKATVEDKSFG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HM54	Pc21g17230 protein	1	134-155	EEYIKRTTRKWKLDKDIQFNAR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HR51	Pc22g16450 protein	1	191-279	IQLWNSTKKSSRRRDDSRERSSRHHRRHRSRSPRERRHRDDRSPDRHRRSRHRSSERGEKSRRDRSPRKSRSPESRRHRSDRDRHDRRH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HSA5	Uncharacterized protein	1	29-53	MILSCTRRRSRQRAMAKHQRHRLAR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTH4	Pc22g04710 protein	1	31-56	PKRIVSSKDHSSKRPQHPSLSRVKGR
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HTV8	Pc22g26550 protein	1	1-20	MPKRSNEKRLKLNQQCREAL
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6HVW9	Uncharacterized protein	1	528-554	YVALCGKDKQNNKKSRPRKENEIDPAW
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GVR4	Pc03g00160 protein	2	117-136, 455-484	KRRPPPPSRFSKRNYERAKC, PRERSDLRAKNEKQKQKRTLPRRQIPAEEG
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GW14	Pc06g00710 protein	1	945-984	NAGQQKKNNSNGKKATKEKKKPESEKSKGKGKDQPKEKES
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GX47	Pc12g11260 protein	1	181-202	EDPYEKSKRLRRTFRQERKGLE
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GY47	Pc12g15790 protein	1	616-640	TSNSTRSRKPHKPVNPNSRKQRSYY
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6GYT2	Pc12g01460 protein	1	276-303	LGIVLLPRKRRRRPKNRAKRSRGLGRRW
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H0G9	Uncharacterized protein	1	2-29	ACTYSGQGKNRQRKRTSLRIKIEQNWFH
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H375	Pc13g12990 protein	1	513-540	DTDSKEEQPKKTRKVKKQVRKGDLPIAS
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H4H9	Pc13g08920 protein	1	570-590	GEAKCRGQLWPNKRKGQGSKP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H693	Uncharacterized protein	1	89-117	TTYSDMASTEKKKKKRKRSDKSELIDQPP
UP000000724	Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)	B6H883	Pc16g05440 protein	4	12-69, 73-123, 134-159, 177-196	PVGSTYSSSRRPRREDDRYDRTRRDDGRSYRRSRSPERRYRGRERPRDRDAYRRRDLP, RDEDTYRPARRDRSRERRRDDDHDFRRRSRDRDYRSRRDDSRDRDRRRIDD, DDSRDRAASRRSRSRTREPSKPSTPV, EAWKQKQAAEREKKQKEQAS