ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9U7	ENTH domain-containing protein	0.629	172-175	RRER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FB25	C6 transcription factor	0.648	647-653	RRHQRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDS6	JmjC domain containing protein	0.998	565-582	KPRKRKKPRSEKGPKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDS6	JmjC domain containing protein	0.947	935-961	KRDRRRSQRPAEPIKSKRNPPRATKNR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDS6	JmjC domain containing protein	0.895	856-872	RRKSSSSKRAGSKRKAS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDU2	Ribosome biogenesis (Nop4), putative	0.995	676-785	KRGRKGFQKRDQRGAQRGDRGDRRGDQRGGQRGDRGDRRDRRDQKGPPGKPSQDFKQGLKRKRSESSSNDKKPGDKENSRNGGEKDNGVAKRNRIIAKKRMQRKTRKGKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FES8	Uncharacterized protein	0.902	205-221	RRGQRRKDLRRERWRKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKA1	Uncharacterized protein	0.813	225-236	KGSKPRRPRQPD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKA1	Uncharacterized protein	0.748	85-123	HKKPLPPIPGREARDIHPPPPLRVPKLSRGQLHPPGHKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKR1	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.969	795-812	SRKRKRLSKELKARKRQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKR1	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.898	858-870	KVKKTKTKKKTKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKR1	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.861	689-698	RRKRPVRRKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKR1	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.742	1108-1113	KKRKKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMF4	Terminal deoxynucleotidyl transferase, putative	0.785	612-621	RSKRRRNPNP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMF4	Terminal deoxynucleotidyl transferase, putative	0.711	102-110	AKRRRLENG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMF4	Terminal deoxynucleotidyl transferase, putative	0.619	112-114	EKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPC5	Cell cycle protein kinase, putative	0.716	147-152	KRKKPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FV65	Nuclear pore complex subunit Nup159	0.668	1095-1104	PRSPSPRRPG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXU9	CorA family metal ion transporter, putative	0.997	42-59	PAKKKKHRNRPRRRRPRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXU9	CorA family metal ion transporter, putative	0.85	364-371	ERRRRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYH7	Checkpoint protein kinase (SldA), putative	0.932	752-766	AKRFRPSPPKKSKKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYH7	Checkpoint protein kinase (SldA), putative	0.655	464-469	KARKIK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0V9	Paramyosin, putative	0.992	848-858	ARKKRKKKKRH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G161	C6 finger domain protein, putative	0.699	213-221	RHKKEVKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2A9	Uncharacterized protein	0.995	202-323	REEQRKKEEYERWKEAAKKKREEKLKEQQQKREKEAKERAERENKEKLEKEIAAAREAALKEAKEKLEREAAEAKAKAEREAAEAKARAEKEAAAREAAAKEAAKREADAKFAAMKEAAAKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2A9	Uncharacterized protein	0.716	766-773	RRQRRRRF
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2E3	Uncharacterized protein	0.774	97-114	RDSRKDKGKDKENQRPAM
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2E3	Uncharacterized protein	0.686	132-141	HQRSPSRPKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4X1	Uncharacterized protein	0.852	523-529	KKKKRKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8N5	Endopolyphosphatase	0.998	487-510	ARKHKKKGKGKGKKGSENKKPNFK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8N5	Endopolyphosphatase	0.988	400-416	KKKGKKKGKFLKKIGGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8N5	Endopolyphosphatase	0.975	656-667	KKGKGKKKHRKQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC80	Uncharacterized protein	0.656	342-349	RKSWFKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZL6	Casein kinase II subunit beta	0.922	343-354	RRKKAPLRRRRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEV5	AP-3 complex subunit delta	0.974	875-883	VKKKKKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEV5	AP-3 complex subunit delta	0.907	908-917	KKTKKKKKAT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FF61	ATP dependent RNA helicase (Dbp9), putative	0.997	587-620	RIRKARDRNRGRGKGRKPGGRIDPLKTFNAKGRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG87	DNMT1-RFD domain-containing protein	0.933	366-381	RGRKRRVRKSVLRPKV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG87	DNMT1-RFD domain-containing protein	0.725	139-145	KRRGKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRE5	Histone-lysine N-methyltransferase (Ash1), putative	0.998	606-645	PRPKDQRPKEPKADDKKKPKTKARKGGKSSLAGTKRKLGS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRE5	Histone-lysine N-methyltransferase (Ash1), putative	0.978	651-826	TSRLNKKRKLLTPKSIKAGVKKAVSKARTSVSGKGRATTQAKTTTTKKTVKKVAVKGARSKLQPKMKTAKTKTGTKTVAKPRAKATVYRLNSKATSRAPSSIRKTSNSSNKSTSSSKAKASPGKKSTPTKGAKASPKRATATKETKSPTKTVSRRGSVKDAAKSVVRTMKRASKAS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRE5	Histone-lysine N-methyltransferase (Ash1), putative	0.96	230-274	KRSRDMMEKGKKIGRRASLRPRTAKEEPADSTSKDAPAAKKRRVS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRE5	Histone-lysine N-methyltransferase (Ash1), putative	0.707	67-76	PRRRSTRAKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWM2	Uncharacterized protein	0.961	637-660	KVSDKRKKGSRPARQNIGQKKRAN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWM2	Uncharacterized protein	0.773	106-118	RKKTRKILNKTKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZV9	Transcription initiation factor TFIID subunit 2	0.823	667-678	KRLKRNKRQKER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBW1	Uncharacterized protein	0.841	355-365	PKWRRRRPGRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC49	Rif1_N domain-containing protein	0.939	1557-1567	KSSKKKRRSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC49	Rif1_N domain-containing protein	0.919	1366-1384	KNKSRSKRNRSKSGTPKGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC49	Rif1_N domain-containing protein	0.897	1511-1524	KEKRSSSKKRKGES
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GFD7	Uncharacterized protein	0.687	145-156	KEKEQEDKKNKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGK1	Uncharacterized protein	0.952	54-65	GKSKSKRKKKNK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HX32	DNA repair protein Rhp26/Rad26	0.706	259-266	KRRKLQPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HX32	DNA repair protein Rhp26/Rad26	0.61	359-364	RRSAAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXB8	Transcriptional corepressor Cyc8	0.923	879-899	RKRAARHRGKVKSFPKDDPKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXB8	Transcriptional corepressor Cyc8	0.672	1098-1105	KLPRKTHK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXB8	Transcriptional corepressor Cyc8	0.641	986-988	KKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FH09	SAP domain protein	0.798	194-205	RRRGTKKTEKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FH09	SAP domain protein	0.681	399-403	NRKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM09	Uncharacterized protein	0.791	69-88	KKAGKKSTTRRMYKLNRKLR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUW0	Glutaredoxin domain protein	0.853	273-284	AKPKRSAKRRTT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW00	Ribosomal protein L15	0.944	366-404	SRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW00	Ribosomal protein L15	0.931	4-24	ARKRTKQTKAKLPQKKQKKEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW00	Ribosomal protein L15	0.837	479-518	KPVHKHRESRGLTATGKKSRGINKGHGYTKTTAGRRKTWK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW00	Ribosomal protein L15	0.7	228-233	GKKGRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW65	DNA damage response protein RcaA	0.94	588-605	GRKNFKKFRRKGHARMPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW65	DNA damage response protein RcaA	0.773	508-514	RKPKRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW65	DNA damage response protein RcaA	0.64	709-712	RRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZB9	SH3 domain protein, putative	0.984	395-427	DKDKGKDDKKRKDKKSGMLSGLFKRKDKDKKNK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZB9	SH3 domain protein, putative	0.705	219-228	NPLKKAMRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4L8	Uncharacterized protein	0.868	63-77	KKKNNGRSAKKPRDF
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4L8	Uncharacterized protein	0.778	10-21	KGPRNGKRPQKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4U6	PSP family protein	0.94	549-562	RKRHKKDEERRSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4U6	PSP family protein	0.873	13-22	LRRQKKKEKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4U6	PSP family protein	0.744	119-124	SKRKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G566	C6 transcription factor (Ctf1B), putative	0.619	72-74	RKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5A2	tRNA (guanine(9)-N1)-methyltransferase	0.995	86-138	KKLRRKQQWEDLRDSRRAKRKEKLIAKRERKRAAAIEAAQSGAPKPEPKLKLK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8E7	Tyrosine--tRNA ligase	0.841	373-386	EKKQKKVKDKGSRY
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9M3	Lysophospholipase NTE1	0.91	393-403	RKPTRPKKRKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9M3	Lysophospholipase NTE1	0.644	522-525	RRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9M3	Lysophospholipase NTE1	0.635	809-811	KKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9M3	Lysophospholipase NTE1	0.634	1543-1547	KKLRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GE19	Ribonuclease Z	0.725	1177-1186	KRKSSPRRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GE19	Ribonuclease Z	0.722	1116-1127	KKNKQNKQKGKN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEB0	1-phosphatidylinositol-3-phosphate 5-kinase	0.789	1973-1990	ERQRERQQRAAKGKHSRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVN8	DEAD/DEAH box helicase, putative	0.957	79-99	GRRSKSRSATPKPKPKQKRTP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWD1	Uncharacterized protein	0.997	46-61	PKRKPSRKKSKRRKNR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWD1	Uncharacterized protein	0.94	297-322	RDRRRKEKKRIEDQERLQRRLQRRAE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWD1	Uncharacterized protein	0.609	148-149	KR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWD1	Uncharacterized protein	0.602	152-152	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HY73	Uncharacterized protein	0.931	209-215	RSKKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HY73	Uncharacterized protein	0.882	190-198	GRGKKKKKT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I131	Isoleucyl-tRNA synthetase	0.796	656-665	KQKKGKSKKQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5B4	ATP-dependent RNA helicase rok1	0.959	651-708	KKDKKELKKHGVKARQSSIKDDKDAKLHKKMRISTKSGFDRRMENKRKGAVMGSRNRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5B4	ATP-dependent RNA helicase rok1	0.908	142-161	TKEPKKKKMKQGSAPVLTKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5K7	Endosomal peripheral membrane protein	0.899	477-488	KGKKKRRGSLSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9F3	CDAN1-interacting nuclease 1	0.994	200-217	RGDREEETKEKKKKKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9F3	CDAN1-interacting nuclease 1	0.983	35-67	TSKSKKDRKKQRNRKLTQPSATQKKPLSKSKRN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLL9	Eukaryotic translation initiation factor 5B	0.999	108-197	KPKVPAKPAGKAAKESPKAADDEPKVKSKKEKEKEKKEREKQRKKEQAAKKKATGPAPKAEPEKPAEEKKEAAPAPAPAPAPEPAKKKKV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLL9	Eukaryotic translation initiation factor 5B	0.994	240-278	ERKREEARQRKKEKERERKEQLRKEGKLLTKAQREAKER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLL9	Eukaryotic translation initiation factor 5B	0.989	305-356	KKKPVFDNKRKKKGPKKQEDDLEAAAARAKAQREAKEAEEAERKRKEEEAKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLL9	Eukaryotic translation initiation factor 5B	0.91	55-66	KKNKTKKAKKGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQB7	Curved DNA-binding protein	0.998	384-403	SKSTGAKGKKNKKKKKPAKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQC1	DDT domain protein	0.828	707-730	ERKRKQEEEQKRKELLAKQPKGSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTN3	Eukaryotic translation initiation factor 5	0.97	146-164	TKGKKDKSSKKSRRERNKD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0P6	Uncharacterized protein	0.8	350-358	RRRARRNRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0P6	Uncharacterized protein	0.684	143-149	PRRRALR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4N2	RWD domain-containing protein	0.915	181-197	EAEEKKKKPSAREEKKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5E6	RanGTP-binding protein	0.602	642-643	RR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9R0	Cell division control protein 45, putative	0.996	730-760	KRQEERRNKKEAKDKKNKEKEERRAKRAAER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9R0	Cell division control protein 45, putative	0.765	297-309	RALRRKLLRMRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEN1	DNA replication regulator SLD2	0.984	490-527	KAKKPVARKVNPEAHANYRSLKIRNKNSKGRGRFGRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEN1	DNA replication regulator SLD2	0.84	79-100	RADKTERHSKVEKDVSKKRKHG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEN1	DNA replication regulator SLD2	0.79	384-394	KKKGQKRTTRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GG35	Non-specific serine/threonine protein kinase	0.601	828-828	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVL2	SH3 domain protein	0.983	296-312	AAKKEKPKKPPPKKQPP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVL2	SH3 domain protein	0.804	454-467	AGARKPKPPAPERK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVL2	SH3 domain protein	0.606	76-78	PAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1J1	C2H2 transcription factor (Rpn4), putative	0.618	738-740	KRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKP5	GPI-anchored cell surface glycoprotein, putative	0.69	150-160	KQRKEPAPPKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKP5	GPI-anchored cell surface glycoprotein, putative	0.663	343-349	SRRRAAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKP5	GPI-anchored cell surface glycoprotein, putative	0.654	656-659	KRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKP5	GPI-anchored cell surface glycoprotein, putative	0.652	795-800	RKARVR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMR9	Urea active transporter, putative	0.615	27-29	RRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ57	Nuclear RNA binding protein, putative	0.787	560-588	KAPNKPKSPKHLALPRTPTPLRRVPNLKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ57	Nuclear RNA binding protein, putative	0.711	527-536	RKKQSARKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G289	Uncharacterized protein	0.848	54-67	GKNAAPKNRRPRKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G289	Uncharacterized protein	0.846	106-121	HNRKKRLESAKRYKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3P2	Uncharacterized protein	0.898	563-578	GRIPGPPRGPRKPRPP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7M0	Uncharacterized protein	0.995	102-136	RRSLRQTRSSNNRSSKPSSGRKRKRLGEPLKKRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBZ2	Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyldiphosphate specific)	0.939	41-54	RRPSRRKSGRKQKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYD1	40S ribosomal protein S11	0.9	24-37	KSKAKSKRVGKGRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZK5	Uncharacterized protein	0.826	192-201	KKRKARKQAE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1M9	Obg-like ATPase 1	0.978	168-186	KVKKKGKKMGPKKAVKEEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2F9	Uncharacterized protein	0.794	185-191	SRRKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I562	YagE family protein	0.935	180-205	KKRRRVPPERAKSYAERLPKARRAEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9Z1	Guanyl-nucleotide exchange factor	0.815	756-765	RKDPKKKKTR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9Z1	Guanyl-nucleotide exchange factor	0.697	149-161	KRKTKIKLLPRSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC51	Uncharacterized protein	0.97	113-141	GRKRRNKTSFRLAHPPRNPRHKRLRMRPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FI73	Isochorismatase family protein family	0.823	368-382	PGVKRTRAKMRRIKN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJV6	Splicing factor YJU2	0.912	252-271	ARVKKPKKPFSAGLGIKKKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQT3	RNA-dependent RNA polymerase	0.647	236-240	KKPKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSH1	HLH transcription factor (PalcA), putative	0.661	506-516	RKPDPKAGIRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSH1	HLH transcription factor (PalcA), putative	0.628	290-292	RRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU37	Uncharacterized protein	0.941	186-204	AKIERRRQKIERHRQKKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU37	Uncharacterized protein	0.817	402-410	NKGKRKSKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUA0	acidPPc domain-containing protein	0.688	37-43	RRKLRSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVU9	Cut9 interacting protein Scn1	0.922	307-321	HERKVPSRRERRRRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWE2	Uncharacterized protein	0.978	171-189	RSEKKALLAGRRRRRSRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXH7	Uncharacterized protein	0.716	25-33	RSGHRRERK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYI4	Mannosylphosphorylation protein (Mnn4), putative	0.712	270-279	KKKFSKRSRI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G435	Uncharacterized protein	0.602	614-614	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6G6	Uncharacterized protein	0.998	368-427	RSRRSHRSKAHSSAAPSRAHSKAPSKAPSRAPSKAPSKAHSKVSEKEKKPKEKPKRSSRL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6G6	Uncharacterized protein	0.738	75-87	RRSGRSKRSHHPP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G840	Uncharacterized protein	0.994	357-387	RRRSSRAKPKKASKRAAPPAVPKEIPVRRPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G840	Uncharacterized protein	0.846	444-453	SHRRRGKKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G840	Uncharacterized protein	0.63	623-628	RVRARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRG7	Cell cycle control protein (Cwf2), putative	0.981	420-434	KKTKKIIRRKRRPAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4R6	Endoplasmic reticulum junction formation protein lunapark	0.683	684-690	SKRGRPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9R3	DNA topoisomerase 2	0.998	1576-1633	KTKAKPAAKTGAKTAAKPAAKPRGRPKAAAKPAAAPAAKPSPAAKAYASKQAKASKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9R3	DNA topoisomerase 2	0.993	24-66	KPKPKAKTAKKPAAAKAAPKKLTQTTLKSKAGAKPAASKKRAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9R3	DNA topoisomerase 2	0.933	95-110	AKKAKKAPAAKKAASK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9R3	DNA topoisomerase 2	0.932	1414-1428	KKSRAAPKSKPKPKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9R3	DNA topoisomerase 2	0.876	1281-1305	KVANMGRRASSKLMTGGRAPAKKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9R3	DNA topoisomerase 2	0.758	1373-1385	KKSRAAPKSKSKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJL3	Cut12 domain-containing protein	0.822	418-433	GRRKEKEAKLKQREAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLL4	Signal recognition particle, putative (Fragment)	0.897	379-401	ASKKGKDGVKREERTGKKLSKLR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUA3	HUN domain-containing protein	0.991	56-93	TTPASARRTRRKKDDDDKKAEPGKESKPRSRRPREKST
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUA3	HUN domain-containing protein	0.918	563-571	KKKRTRKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUA3	HUN domain-containing protein	0.862	624-637	RRGRGRGRGSGRGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUA3	HUN domain-containing protein	0.664	101-105	ARKKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXJ3	Cortical patch protein SUR7	0.766	226-235	GRKQRRRGFF
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXN1	AAA family ATPase, putative	0.999	185-217	KKKKHKGHAKAKKNLKNKKRNKQKRKSKNGHRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXN1	AAA family ATPase, putative	0.994	116-139	KKHDTKKRSKAAKKHISKRKNKKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXN1	AAA family ATPase, putative	0.989	300-327	RKRLNDDKSTKSNGKKAAKSKRKRASKV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXN1	AAA family ATPase, putative	0.98	240-257	QKKASSRLRAKKKAKKLK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXN1	AAA family ATPase, putative	0.979	430-443	AIAKSKKKKKERKQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXQ7	U6 snRNA-associated Sm-like protein LSm6	0.912	898-934	REQRRRMWKGLREAAGLGLKKPRERHSAVTHRSKERT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZG5	Uncharacterized protein	0.719	320-329	NKPASKSRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZG5	Uncharacterized protein	0.698	350-358	QRPLRRSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0L8	G-patch DNA repair protein (Drt111), putative	0.984	138-151	RRQRGGRKKRKKNR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0S2	SpoU_sub_bind domain-containing protein	0.76	150-166	KDKGRRQKENERDKGKY
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0S2	SpoU_sub_bind domain-containing protein	0.688	71-84	TRRPERENFRRRNR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2V1	DNA repair protein Dds20/Sfr1, putative	0.661	193-199	KERAKKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3Q3	Dipeptidyl peptidase, putative	0.925	2698-2711	RGERSKRKRRFRSL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4H6	Import receptor subunit tom-70	0.999	73-101	PSAEKRKSKKERRKEKKRAEEEKKAEKAA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4H6	Import receptor subunit tom-70	0.604	1350-1351	RA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5B8	Glycylpeptide N-tetradecanoyltransferase	0.969	47-60	KKKKKKLFGKKSKD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9W7	Dimethylaniline monooxygenase, putative	0.686	463-477	KSVRERPSKLRQERA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAH4	Uncharacterized protein	0.837	879-896	SRKKVKKSTGEVKARSSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GF94	Uncharacterized protein	0.732	395-404	EKEQRRKEKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQB3	Camp independent regulatory protein	0.904	96-110	PGEKKRAMKKGNRRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUF3	Intu_longin_1 domain-containing protein	0.98	620-637	RRRRRRRRQISRHIRGPS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F742	Beta-glucosidase	0.961	156-169	KSKKGKKGKHPQRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG45	Uncharacterized protein	0.967	155-174	RHRDDDRGRPRRERRRHRGY
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG45	Uncharacterized protein	0.896	98-133	RRGGHRRRRGYDDRRDRRSQYSSSSRSPSPRPRRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG45	Uncharacterized protein	0.797	563-572	RRRKREMRRT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG45	Uncharacterized protein	0.747	496-502	KRKKRQE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG45	Uncharacterized protein	0.731	279-288	RKRGGSRGRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG45	Uncharacterized protein	0.728	513-519	EARKRKQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG45	Uncharacterized protein	0.667	182-190	SRSRSRHRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG45	Uncharacterized protein	0.651	341-346	RGSKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPW4	NodB homology domain-containing protein	0.954	223-243	KGRKSKKDRLDRLRRRYRMKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUQ5	DnaJ domain protein	0.986	215-229	KGGKGRGKGRKKKAT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUQ5	DnaJ domain protein	0.962	262-297	PKKGSGKGKKRAADEPPEEAFAAVGARKGSKKKSKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW81	Uncharacterized protein	0.716	196-202	PKGKRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBS9	Uncharacterized protein	0.707	589-594	KKKKVR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBS9	Uncharacterized protein	0.652	16-24	PKRSLAKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD06	SANT domain-containing protein	0.95	155-278	PRNGPPGRGRGRGDWDGGRGRGRGPYLDDRDSFRRRSRSREGRWERDVPPRDRDRDRPLERERPIDRERPLERERPLDRERPLIDRDRERDRDIRERERIIDRERDRERDRERDRDRDFDRRDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD06	SANT domain-containing protein	0.949	1040-1060	KAKLNKRWTRRGRARRSTRNP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD06	SANT domain-containing protein	0.935	1113-1141	GHAKDGDTEKPSRRGGRTGPGSRGGRRGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVG2	Uncharacterized protein	0.855	671-681	RGRRPRRHRGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVG2	Uncharacterized protein	0.683	484-492	RKRTRARGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5U6	Clr5 domain-containing protein	0.94	186-201	SAERWATRKRRRRTRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5U6	Clr5 domain-containing protein	0.628	175-179	RKERL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC09	Uncharacterized protein	0.62	8-11	RRTR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIS6	RNA helicase	0.99	692-708	AKQKRREKKEKRKARER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIS6	RNA helicase	0.882	9-27	HGKTKKPARTTPRTLKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIS6	RNA helicase	0.86	618-631	KRREKLLKSKKKLL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIS6	RNA helicase	0.742	523-532	GKKEKEKKVR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLV9	ATP dependent RNA helicase	0.82	5-11	KKKKKPA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLV9	ATP dependent RNA helicase	0.784	326-334	KKGKKGGKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPI2	Sister chromatid cohesion protein	0.988	1756-1783	PTKRKSSFSSGGPPKRPKGKKTSIGKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPI2	Sister chromatid cohesion protein	0.804	591-601	RRSKNKRRPPM
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPU5	Uncharacterized protein	0.831	518-542	AKASRPRNKKSALERDVGVKLKRQR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPU5	Uncharacterized protein	0.632	1429-1431	KKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRA6	Uncharacterized protein	0.991	187-226	TPSKSKGKTPERDRDRERDRARRSLGRQHRERERERRRRW
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRL3	Pseudouridylate synthase 3	0.783	204-214	SARPKKPTKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRL3	Pseudouridylate synthase 3	0.602	75-75	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZE9	Mnd1 domain-containing protein	0.8	214-221	RKQKKRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0H6	Translation initiation regulator (Gcn20), putative	0.954	136-156	RVDRKKLEKAEKKIRAKQEKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4N3	Valyl-tRNA synthetase	0.786	12-30	KEKAKAEKAAKFAAKQAKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4Y1	Uncharacterized protein	0.798	52-60	NPRPRRPRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HV58	5'-3' exoribonuclease 1	0.953	1397-1427	RGGRGGRGASGPRGAGRGNGPRGRGVNRGRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZS8	Metacaspase CasB	0.866	62-72	HRHRRRRPSKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1Z6	Polynucleotide 5'-hydroxyl-kinase GRC3	0.973	66-80	STKPRTDKRRRKRKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I687	Zn(2)-C6 fungal-type domain-containing protein	0.622	20-24	RSSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F6U0	Transcription factor TFIIIB component, putative	0.944	296-309	KRAPKTGRPRKKRT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F6U0	Transcription factor TFIIIB component, putative	0.89	320-333	RPTRERRPRPRMKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F6U0	Transcription factor TFIIIB component, putative	0.65	601-604	KRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCZ3	Uncharacterized protein (Fragment)	0.816	678-694	KDTPKRRRENPAGAGRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FL78	Uncharacterized protein	0.998	1001-1018	SRSGKRRRSKDRKRKRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN20	Integral membrane protein	0.847	408-419	RRSPQKKKKSQR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN20	Integral membrane protein	0.721	317-322	GRRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNZ7	DNA (Apurinic or apyrimidinic site) lyase, endon uclease	0.995	591-617	NAKKGTGKAAKAAPKKERGRKVKSKSE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNZ7	DNA (Apurinic or apyrimidinic site) lyase, endon uclease	0.962	494-508	KARKGKKSKRPAGAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNZ7	DNA (Apurinic or apyrimidinic site) lyase, endon uclease	0.904	167-180	KKTVKRKRKTKEEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNZ7	DNA (Apurinic or apyrimidinic site) lyase, endon uclease	0.706	569-573	KKRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUD7	Uncharacterized protein	0.999	257-278	PKRRPPPPKRKAKGVGKGRKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FV70	DNA repair protein REV1	0.922	941-954	TKKRRGRPPLKASK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVA1	WD repeat protein	0.892	82-100	SKRRHSRSRSGSRSRSRGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0J5	Signal peptide peptidase, putative	0.634	608-612	KRVRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1I0	Serine/threonine protein kinase	0.971	82-92	NAPRKKKKKPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3I4	Beige/BEACH domain protein	0.779	1030-1044	RKKKSFRLDPRLRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3P7	Na+/H+ antiporter Nha1	0.976	527-538	RPLRRRKRRRRT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3P7	Na+/H+ antiporter Nha1	0.962	702-724	GRDKGEKKKEALPKPKGKGESTG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3P7	Na+/H+ antiporter Nha1	0.745	866-880	KAARKDAHEDRRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4Y9	Very-long-chain 3-oxoacyl-CoA reductase	0.961	329-346	IRKRALRKAEREKGKKAI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9N0	Uncharacterized protein	0.829	208-217	KRPRRQRRIR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GFJ8	Uncharacterized protein	0.815	319-328	RPKRPRRTKN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGC5	Non-specific serine/threonine protein kinase	0.998	639-660	EKKKKARRGRRGGQAHKRKAKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGC5	Non-specific serine/threonine protein kinase	0.709	1578-1589	KKARAAATRKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUM2	40S ribosomal protein S26	0.92	85-109	RVRSREGRRNRAPPPRIRYNKDGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUM2	40S ribosomal protein S26	0.837	3-18	KKRASNGRNKKGRGHV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3W2	Calcium/calmodulin-dependent protein kinase kinase	0.924	116-139	KSRLRKRAQSHVLRKPRGRGPMRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3W2	Calcium/calmodulin-dependent protein kinase kinase	0.629	47-50	RRRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4G7	40S ribosomal protein S24	0.997	99-133	NKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKSKD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5S1	Xenobiotic compound monooxygenase, DszA family	0.61	441-443	RGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5Y0	Uncharacterized protein	0.646	590-600	RKGTAPSPRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8J6	Uncharacterized protein	0.659	648-653	SRKIKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJA0	WW domain protein	0.997	237-269	KAERSAKKLSKKELKEFKQKRRERKEEKRRAWL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPR6	Ubiquitin-protein ligase Ufd4, putative	0.938	178-213	APSRKRKAPVRRDRSLDEPDRPTPSSPPRRAKRQRT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPR6	Ubiquitin-protein ligase Ufd4, putative	0.769	304-311	ARRQKKRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQG2	Uncharacterized protein	0.7	256-264	KKKPSEIKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRC4	RNA binding protein Rnp24, putative	0.902	30-41	PSKKALRKAKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRC4	RNA binding protein Rnp24, putative	0.853	267-278	RAKKSHKPKFRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTT7	U3 small nucleolar ribonucleoprotein protein MPP10	0.971	636-659	EKLRHRRRQKEKQKKANANAPPNK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTT7	U3 small nucleolar ribonucleoprotein protein MPP10	0.687	72-76	RKKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX51	Uncharacterized protein	0.994	560-607	RRALKEEKKAVEKAFRDVVRRARDEAKETRRSRRHEARDRRRRGRRQP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX51	Uncharacterized protein	0.878	421-432	GRGRNRHRRRGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXZ1	Uncharacterized protein	0.861	328-338	PKRRAARPKRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1N3	Lon protease homolog, mitochondrial	0.632	181-185	KKGRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G457	RNA helicase	0.995	567-587	QKGEREKRREKKRARKDRDRW
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G743	Ubiquitination network signaling protein, putative	0.744	617-626	KRSRLKKAKN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G743	Ubiquitination network signaling protein, putative	0.668	409-413	KKRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7S0	Uncharacterized protein	0.67	63-67	RKRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8W3	Uncharacterized protein	0.982	661-675	RKGWGRRKGRRKRQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8W3	Uncharacterized protein	0.956	417-447	KKPKVNPPGKGSVLTKKTNRRNKMRRKLVKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8W3	Uncharacterized protein	0.956	1247-1261	SSRRRGRRGRGRGGL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8W3	Uncharacterized protein	0.898	170-184	SARPAIKIPPRKRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA14	Lipase, putative	0.946	529-570	GKKSLSRIAQKVKQNPEERSENKKKIADKSGPKARSGRPSGT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDB0	Dynactin subunit	0.947	85-98	KRKAYKTKGRRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDJ8	Nuclear localization protein	0.718	79-86	RRRGRPPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUG5	Uncharacterized protein	0.649	72-77	RKRTKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXC6	Phosphoinositide phosphatase Pten/Tep1	0.774	616-626	RRSSKKHKDKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXI8	DNA replication licensing factor MCM2	0.615	135-136	RR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0K7	Condensin complex subunit 2	0.774	214-220	RRKGRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0M2	Uncharacterized protein	0.966	4-36	KRKLPARDRRESAAKRRASEAPPQPPAPPKKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0M2	Uncharacterized protein	0.881	656-672	KRGKNSKSKKADKNKDK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9Z4	DUF2040 domain-containing protein	0.909	79-101	KNKKPSLSSGPPPKRKPESGKPT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9Z4	DUF2040 domain-containing protein	0.876	424-457	ERARTRKTEKDVSSAKERYLARKREREEAAKREK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAU0	SacI domain protein	0.971	13-29	KKSIKKLFSRKKKGKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCI9	Phosphoglycerate mutase family domain protein	0.733	389-398	RRLPMEKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FFZ6	60S ribosomal protein L5	0.864	505-536	EKKSKEEWKAESKKYRSAKLSHEERKARIESK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGX5	Sulfhydryl oxidase	0.872	733-745	PKKSKDRRSRKDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGX5	Sulfhydryl oxidase	0.669	914-920	KSKKTHR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGX5	Sulfhydryl oxidase	0.649	934-938	RKSKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGX5	Sulfhydryl oxidase	0.621	1046-1049	GRGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJ07	rRNA-processing protein EFG1	0.995	260-286	PAKKPGKEDKKKEKKPKTEKVKVDARK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJ07	rRNA-processing protein EFG1	0.848	17-40	AKKSHLSKSHGVSKKGAPAPRKDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK51	Fungal_trans domain-containing protein	0.689	233-239	SRKRARE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLA6	DNA-directed RNA polymerase subunit	0.862	333-351	SNRPVKAIRGRLKGKEGRL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNN2	Protein kinase, putative	0.996	212-330	RNPPPRAADPPRNRPPPGPPPKFKHDTRFDRRDRERDRDRERERDRGRDRDERRDHRDFREPRDKRDTRDMRRDDRRHDYRDDRRRDDRRMDFRFERRRERSPEKPKKQKKIVLRPKAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNN2	Protein kinase, putative	0.942	660-687	ALRKGKDKEARRAEYQKEKEKRKASAPA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW88	SAM and PH domain protein	0.887	295-306	RERRRKHRHHRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWA5	Zn(2)-C6 fungal-type domain-containing protein	0.692	44-50	RRRVKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX47	ATP-dependent DNA helicase PIF1	0.689	424-432	KIKKNQKAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZG3	LigD_N domain-containing protein	0.951	86-98	AKRPHKRRRRTAP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G016	Uncharacterized protein	0.834	787-797	KPKRNGKRKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0N1	60S ribosomal protein L7	0.892	48-77	KKRKSQEQARAVRREELEKRKQANKEKRSV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0X8	Uncharacterized protein	0.917	189-245	LKKLEKWEKKLEEARHEAEWREKMKRREEREESHREAELRDELKKYKEREAARREAE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0X8	Uncharacterized protein	0.629	311-314	KKEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0X8	Uncharacterized protein	0.601	440-441	KK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G323	MFS transporter, putative	0.987	1132-1166	KKRIERIEREREADLKAAKKAQKAASKRERKERKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G323	MFS transporter, putative	0.868	1183-1193	FRRKSKRVKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G400	DNA repair protein Mus81, putative	0.702	104-109	KKPKKT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8W7	Uncharacterized protein	0.989	93-129	RRKGIPGPKPGSKRGLHQVGEVLPKPRGKPGPKKKPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDK3	GTP binding protein, putative	0.999	9-51	KNSKRTPVRLRHKIEKASAAKKRKERKLAKKNPQWRSKIKKDP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDK3	GTP binding protein, putative	0.612	86-89	RARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GE29	Ribosome assembly protein Noc2	0.961	90-109	AKGKKAKKTAVTPKIGKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GE29	Ribosome assembly protein Noc2	0.931	5-44	MKKSTKKFEKNHLKDVIERRKEFAKVKQRQQVKEKRKARN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GE29	Ribosome assembly protein Noc2	0.862	198-205	AKKKKKAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYU5	Mitochondrial DNA polymerase catalytic subunit	0.955	462-482	KSKKKGDPPRPAARQKKPGMP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I026	RNA splicing factor (Pad-1), putative	0.994	37-109	DRKDRDRSRDRDRKRRDRSRDRRRERDADGDEEMKSPRSEHGSANGSHRSRKRSRSRDSDRRRARRDRDDYRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I026	RNA splicing factor (Pad-1), putative	0.992	114-166	YRGGGRGRTRSRSPRDDRYYRPSGRSRRDDRDDDRRRRDRDRRRSPSARRRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I077	Class V myosin	0.885	1108-1117	KKPKPKRRSA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2G5	Protein kinase domain-containing protein	0.734	752-767	HSKHKRGDSPNSKKSI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5F3	TBP associated factor (Mot1), putative	0.892	720-730	AKGRRRKSEKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5W8	Uncharacterized protein	0.638	231-238	KNKLKDKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9U0	Uncharacterized protein	0.723	412-435	RRKERLDRPRENPSNTARTRPKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9Z7	Nuclear distribution protein NudE	0.635	199-202	RRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC16	Calmodulin-binding protein Sha1	0.865	1013-1039	KSRRARRIARTRNGSVSSKVIRKLPKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC16	Calmodulin-binding protein Sha1	0.787	213-225	KKRAAKRSPAAPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCP6	SNF2 family N-terminal domain protein	0.712	75-80	PARKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FD48	Mitochondrial 54S ribosomal protein YmL10/YmL18	0.961	52-75	KRIRRGRGPASGKGKTSGRGHKGQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGN6	SH3 domain protein (Cyk3), putative	0.657	168-174	RSKRPPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP24	AKAP7_NLS domain-containing protein	0.846	294-305	KIKLKEKKPKAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP78	Aquaporin, putative	0.995	514-538	PKKRRMRAKLKKQAKWRKRLRLGTH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQC7	ATPase synthesis protein 25	0.893	197-208	KIKLRRKARRAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRL2	WD repeat protein	0.725	198-203	KKRKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU95	Peroxin/Ferlin domain-containing protein	0.973	673-693	AGASTKEKRPKTRRKPNTKRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU95	Peroxin/Ferlin domain-containing protein	0.87	236-251	RRRRWVRLRVKKFPKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU95	Peroxin/Ferlin domain-containing protein	0.601	715-715	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVD9	Uncharacterized protein	0.956	117-131	RRRRRELRRRTKIRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXH2	Uncharacterized protein	0.805	133-144	KSARKRQKKQMK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZI7	N-alpha-acetyltransferase 40	0.815	29-36	LGKRKRGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G119	C6 transcription factor, putative	0.784	29-44	RKPHPPRQKRSSSTRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1C9	40S ribosomal protein S1	0.943	5-19	KNKRLSKGKKGLKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1I4	Uncharacterized protein	0.983	22-65	RDRHHRHHHRHRHHHASRSRSPERSSRRSRHHHSHHRHRHDRPS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1I4	Uncharacterized protein	0.879	330-354	KKEREREQRKKNERELRREEMMRAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3G8	Cell wall biogenesis protein Mhp1	0.993	332-355	PTRKQEKKKRSEEERKERKERKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3G8	Cell wall biogenesis protein Mhp1	0.913	929-942	RQRKSRSRPPKRPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G672	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase	0.923	76-94	RRAWLEKRRKEKRALERLE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6M1	Asparaginyl-tRNA synthetase	0.611	71-72	KK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6Q8	Homeobox domain-containing protein	0.693	423-428	RRKRPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6X4	Uncharacterized protein	0.658	155-161	RKPGGGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGJ6	Uncharacterized protein	0.634	1348-1357	WKKWLGIGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HU29	SET domain-containing protein	0.998	421-444	AKEKEKPSANKKSKGKGKGKKAKH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8D0	RNA binding domain protein	0.976	453-466	RAEKKIAKPKKKKT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK24	Dynamin-binding protein	0.913	878-894	LRRRAKAKEREENKRRL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK24	Dynamin-binding protein	0.789	1456-1463	QRRLKKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ71	Eukaryotic translation initiation factor 4C	0.935	3-16	KNKGKGGKNRRRGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU34	MFS domain-containing protein	0.866	501-513	KVDEKNRRKRIRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUB3	Uncharacterized protein	0.98	301-340	RGKRKRDDDTGYRPKGGNSGRGGRKKKEDGSYGGRRTSKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVB3	Uncharacterized protein	0.981	426-446	ARPPREKRRSHSKHRRHRSKT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVB3	Uncharacterized protein	0.898	601-615	KKHRKKSHSKKEDTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G418	Mitochondrial distribution and morphology protein 34	0.965	358-376	RHSKAHSRKRKKRVVDLRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G418	Mitochondrial distribution and morphology protein 34	0.953	1005-1076	KIRNARDEEIKKLRRADEEEKAEERRIAAEKLKKEERERLLRSMSAEEQRKFLEREKEKEQRRSMKKSTRKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G418	Mitochondrial distribution and morphology protein 34	0.635	745-748	NRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5I1	Ribosome biogenesis protein (Bms1), putative	0.945	1114-1174	KAAKRAAAQEERRKVYRAKVAENLEKKAEREKRERDEYWQREGKKRKNQDSEGGGGGKKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5I1	Ribosome biogenesis protein (Bms1), putative	0.711	10-18	RATKEKKKY
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5I1	Ribosome biogenesis protein (Bms1), putative	0.684	31-37	PGKGKRQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5I1	Ribosome biogenesis protein (Bms1), putative	0.639	413-417	KHKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCU7	Uncharacterized protein	0.647	174-180	PRRLHKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDY3	Uncharacterized protein	0.93	32-68	REKQKAEAKAKKELLERAKGKGPLNTGNQGIKKSGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDY3	Uncharacterized protein	0.705	10-19	KVKPLKAPKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HSN1	Uncharacterized protein	0.98	163-172	EKHKKKKKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HSN1	Uncharacterized protein	0.957	258-288	KRKATSARADSRTKALSPPRRRWRRDRRDEP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUK4	Elongation factor Tu	0.997	344-362	RRRRREERKRMKKEKARRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5Y7	Uncharacterized protein	0.821	53-61	LKKRWRKRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7I7	Uncharacterized protein	0.615	74-76	RRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FL13	Serine/threonine-protein phosphatase	0.782	501-510	IKKGRNKRNK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPL2	HEAT repeat protein	0.972	279-296	PIPKIKKPKRQSKKPAPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQD0	Uncharacterized protein	0.94	119-135	RKRGRPKGSKNQPKRQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU29	Uncharacterized protein	0.991	132-164	KKKQPGRPKKAKEVSKKPTPRSADGIGSRTRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVD0	DNA excision repair protein Rad16, putative	0.688	332-340	RRALRERKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVR7	RING finger domain protein	0.844	456-469	RARRRREEERRARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVR7	RING finger domain protein	0.678	124-129	RKKKHK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0D1	Gelsolin repeat protein, putative	0.691	952-959	RARGPKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0D1	Gelsolin repeat protein, putative	0.612	51-53	ARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6L8	Translocation protein SEC62	0.973	325-338	KKKKKSKKSEKTAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6P9	Uncharacterized protein	0.9	223-236	DQKLPGKKRTRRPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAD5	C2H2 finger domain protein	0.855	93-105	IRRSKQKKSKSRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD13	Uncharacterized protein	0.917	507-519	ERPPRPRKPGKHR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD13	Uncharacterized protein	0.676	102-117	PKGFKPPHFPGRPGDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEW4	Uncharacterized protein	0.883	140-156	KRQKRSPRRRDQKGDRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEW8	Uncharacterized protein	0.74	555-562	RQRKRKQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVB4	ATP pyrophosphate-lyase	0.799	466-487	RKDSSKGIGIGPAKFRGRRGAS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1L0	Cell cycle control protein (Cwf4), putative	0.86	622-631	MPRRVKKRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5E6	DUF3835 domain-containing protein	0.928	392-399	KKKKPKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGT7	Mitochondrial large ribosomal subunit protein L1	0.985	44-67	KSNPQAKNKKTKTKKKEKGAREFK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHE8	MYB DNA binding protein	0.621	725-728	REKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJ96	tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase	0.884	87-95	RKKKEKKEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJ96	tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase	0.734	345-353	RRERKRAEG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLF8	RNA polymerase Rpb1 C-terminal repeat domain-containing protein	0.924	3-21	PKKNKKGNNKNAKKAKDAS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP59	Integral peroxisomal membrane protein	0.603	481-481	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FR43	Drf_GBD domain-containing protein	0.803	403-438	RKDASTAERDPKGSRSRSRGRTFTWSRGGSSPSKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW49	RING-type E3 ubiquitin transferase	0.977	28-52	RGSRARGRGGRGGRGGREKQNRGQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW49	RING-type E3 ubiquitin transferase	0.863	771-780	GKKGKGKKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW49	RING-type E3 ubiquitin transferase	0.615	392-395	RRER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWH0	G-patch domain protein (Spp2), putative	0.905	419-483	RRRNGSGRDRSRSSDDRDRRRRRGVDDDKDRDDRRYYRDRDRDRERDRDRDRDRHRDKDRDRRHR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWH0	G-patch domain protein (Spp2), putative	0.746	332-342	KAAMRKGSRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWH0	G-patch domain protein (Spp2), putative	0.61	504-505	RR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWH0	G-patch domain protein (Spp2), putative	0.6	522-522	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ94	SWIB/MDM2 domain protein	0.991	146-172	ARPIRAGSTRKAAPVKKKKSKTSKKVK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ94	SWIB/MDM2 domain protein	0.781	119-125	PPKKKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3H0	Amino acid transporter	0.689	19-27	RSRRRLLRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4W1	DNA repair protein rhp42	0.99	486-503	EKPPDKSKKKGRKGKNKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4W1	DNA repair protein rhp42	0.666	756-773	GKTKGYRLPVEKIPKPGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6P1	M protein repeat protein	0.963	8-35	AKAEKLAAAKKRVAQLQKQKKKANKKGA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7V1	Mitochondrial ribosomal protein DAP3, putative	0.998	26-70	LKKKSKSMEGPAKYRQAKSAKMKKKKQVDRPRPPPVGERRALRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC51	Oxysterol binding protein (Osh1), putative	0.765	1111-1118	KRKRTKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC51	Oxysterol binding protein (Osh1), putative	0.681	1595-1600	RAKRRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCZ1	Telomere silencing protein Zds1, putative	0.967	512-565	KKPEKPEGKKSKDKKDSEGNRKSSWHWLLGHEDKEKDKDKKKEKDSDSKKSKAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCZ1	Telomere silencing protein Zds1, putative	0.719	300-314	RKGSLRKGERPPYSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTA8	Uncharacterized protein	0.953	191-206	KNHAGRRLNRKKKQKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4B5	MIP transporter, putative	0.94	622-642	RAMRKSKAKWKRRLHMHLGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F6U9	Ribosomal RNA-processing protein 36	0.999	245-358	QKEELKRKIRSTADRLRAIEDKKREEEIVAEHKKREKELIREGKKTTPYFLKKSDIKREMLKKKYEAMGSRERAKALERKRKKIAGKERKEMPWGRRGMEADMGAGGGGGKRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FID5	TFIIIC transcription initiation factor complex subunits Tfc3	0.979	789-802	PSAKRRRGRPPKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FID5	TFIIIC transcription initiation factor complex subunits Tfc3	0.973	684-699	RGRRRPTGKRRGRPRI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FID5	TFIIIC transcription initiation factor complex subunits Tfc3	0.962	1054-1072	RKAMGRRRKMKKFRIEKGG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FID5	TFIIIC transcription initiation factor complex subunits Tfc3	0.9	850-862	GRKRGRPKKDAGG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FID5	TFIIIC transcription initiation factor complex subunits Tfc3	0.854	580-594	ERLKTPAKPRGRRPG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FID5	TFIIIC transcription initiation factor complex subunits Tfc3	0.785	1254-1264	RSPRRKERVKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJD5	Uncharacterized protein	0.788	393-407	VERASRSKRAEKAAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6D2	60S ribosomal protein L34	0.992	104-135	RRVQKRRHGFLARLRSRGGRKILLRRRAKGRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB59	Uncharacterized protein	0.92	192-230	KKGRKRKVARSPDGSQTIGHKETGGSPHKRRKQSNLPPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBP0	Cytokinesis regulator	0.67	119-125	RLGRRKV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HU13	Uncharacterized protein	0.842	41-59	RKPKKRDPNQPNRAPTANK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HU13	Uncharacterized protein	0.601	69-69	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HU93	Uncharacterized protein	0.883	193-212	RKSGGNKGRKSRGNNREVRT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZU8	AP-3 adaptor complex subunit mu, putative	0.994	482-497	KPKKKKTKKTKSKKSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3F8	DHHC zinc finger membrane protein	0.901	933-953	RRHSRRRHRRHDDEHRSRDRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3F8	DHHC zinc finger membrane protein	0.857	1221-1236	KAERRERRQRREEARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3F8	DHHC zinc finger membrane protein	0.693	1015-1020	HRRRRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4A6	MIT domain-containing protein	0.905	1310-1320	RRRRPRRAVRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4A6	MIT domain-containing protein	0.616	1351-1354	ARSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4A6	MIT domain-containing protein	0.603	1349-1349	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I653	Uncharacterized protein	0.903	597-613	SKKKFGSKKLARRQSRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7B2	C6 finger domain protein, putative	0.885	681-687	KNKKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7B2	C6 finger domain protein, putative	0.858	165-195	RPASRVARKRSTSPSGRSRRSASQHKASRLG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7B2	C6 finger domain protein, putative	0.714	533-550	GKAIKSNKSRPAVISRKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7B2	C6 finger domain protein, putative	0.7	509-516	KAKKAKTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBK2	Uncharacterized protein	1	166-214	ATKKAKKAGDDKPKKKKKKFRYESKEERKLARTKQKMSNKRKADARRER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBK2	Uncharacterized protein	0.853	33-60	KRKLQRAKHAQELAEKRAREERREQRKM
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGB7	Uncharacterized protein	0.799	82-104	IDKRRIRHKYTARSEGTGRRRLR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGB7	Uncharacterized protein	0.611	158-160	RGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNF7	SHSP domain-containing protein	0.901	86-100	RHPKERRHGRRGRGF
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNX7	Developmental regulatory protein wetA	0.738	516-530	TKARREQEARDRRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNX7	Developmental regulatory protein wetA	0.695	144-156	PKTIRRREPNDRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPJ8	NTP binding protein, putative	0.743	441-449	KRRSAGKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPJ8	NTP binding protein, putative	0.74	207-217	STKPRDKKQKW
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPS7	mRNA-nucleus export ATPase (Elf1), putative	0.986	1064-1088	KFKAKKKKKMTRAQLKERETRRRLR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQX5	DNA_LIGASE_A3 domain-containing protein	0.655	507-512	RKNPKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT88	Amidase	0.74	14-26	IKQGVKKNRRQTR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVW4	Ubiquitin	0.805	603-609	RPKKKLK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G250	Uncharacterized protein	0.681	274-278	KKGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3J5	Transcription initiation factor TFIID subunit 7, putative	0.99	45-81	KIGRKPAGGANGDKPTPKKKASKGESAASKKRREQHR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3J5	Transcription initiation factor TFIID subunit 7, putative	0.83	89-111	PGSAGPKRIKLIPSKKPGVQSIR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3J5	Transcription initiation factor TFIID subunit 7, putative	0.625	16-18	KKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G485	Uncharacterized protein	0.666	245-252	KKGGKGSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4Y3	Uncharacterized protein	0.854	195-204	EKKRKRAPTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G710	Protein kinase family protein	0.834	722-737	KAKAKKPLPKGLSKSS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G710	Protein kinase family protein	0.642	760-768	PKPAAPPKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBR7	Uncharacterized protein	0.811	47-68	KRERAREKAEKEAAEKKAAENG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBR7	Uncharacterized protein	0.604	72-72	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBR7	Uncharacterized protein	0.601	79-79	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GFI2	Arsenite resistance protein Ars2, putative	0.915	140-163	EKERAKHGGRRPSDRVKGEREARE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GFI2	Arsenite resistance protein Ars2, putative	0.777	35-45	SQDRRRGRGRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0I6	Serine palmitoyltransferase 2	0.695	5-12	KRKNKNRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3Y8	ARS binding protein Abp2, putative	0.815	599-607	KPKRGRRKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F922	Eukaryotic translation initiation factor 3 subunit A	0.988	800-868	RHEEFEKRRKAAEREFEQKKKQRVKEVQDRRRRERMEREEEERRRREEEERVRREEEEKLAKEEEQRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FB95	SET domain-containing protein	0.968	102-131	ERQRRLREQSEAGDRKSKRTGTKGHKKKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FB95	SET domain-containing protein	0.963	456-477	RHPKAAESGGKQVRRKKAKSKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGC5	Uncharacterized protein	0.924	37-70	KTEKSAPKQQTKKTTAKRTRKTTTTSRKKPSKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGC5	Uncharacterized protein	0.601	24-24	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIU3	TBC domain protein	0.706	518-523	RKKRQR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FR22	Alpha-galactosidase	0.879	1646-1654	KGKRKNKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FR58	Uncharacterized protein	0.874	727-741	QPKRPKGAGRPPPGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTR3	SGT1 and CS domain protein	0.837	406-417	KKKEKPKSKNEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ07	Uncharacterized protein	0.98	363-386	RRNPSKKKGKQQKSAGRPPARGRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ07	Uncharacterized protein	0.979	424-441	KQSAGKKAAKKAKSRKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ07	Uncharacterized protein	0.662	292-297	RKRGRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ07	Uncharacterized protein	0.629	579-582	AKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ07	Uncharacterized protein	0.627	122-125	KRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ07	Uncharacterized protein	0.607	324-326	RSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1Q1	Kinesin motor domain-containing protein	0.948	442-473	QIKKPEIAKRASPLKRKSDTFKSPRPRSAKGL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G349	TPR domain protein	0.871	543-563	KMALAKKHVPIVKKRTKRFFR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4K0	BRCT domain protein	0.801	720-731	EARARAKKNKNK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4V9	Ribosome biogenesis protein NSA2 homolog	0.679	23-30	RTRKRAAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4V9	Ribosome biogenesis protein NSA2 homolog	0.658	54-64	RHAEKIQMKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5Y9	RSC complex subunit	0.997	211-265	RRRRKRGRGRREGGKDDGHKSNDPELRKKRGRPPRVDTPMEARIKAVLKGIRKFK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5Y9	RSC complex subunit	0.895	788-810	IEEKKRKEANEQAERERAAKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5Y9	RSC complex subunit	0.772	302-309	KRKSKRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6R1	Uncharacterized protein	0.728	204-212	ARRRNRRSA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAZ8	Uncharacterized protein	0.994	1089-1117	GGGGGGKGGEGKGKGNQKGDKGGKGGKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAZ8	Uncharacterized protein	0.896	870-880	RGKKAKAKKAA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAZ8	Uncharacterized protein	0.815	821-837	GRRHLSAREKRQLKKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAZ8	Uncharacterized protein	0.782	186-192	PKKSKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAZ8	Uncharacterized protein	0.673	925-934	RERRRAQHAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HT09	rRNA processing protein Pwp1, putative	0.964	252-261	KKPKKKKKTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HU05	DNA ligase	0.91	107-137	KRRRKSPEGRQTNGRKSSPVPEKTAPSPKKT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEW0	Serine/threonine-protein kinase chk2	0.695	656-661	KNGRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGK5	Zn(2)-C6 fungal-type domain-containing protein	0.971	164-190	PRKRGRPRKHPLPVPGGQAKIAKGRSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJS3	Nuclear segregation protein	0.93	262-286	IRRERQKAERDAFEREKKKKIADKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJS3	Nuclear segregation protein	0.897	362-371	GKKGKKGKKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX70	Hsp70 family chaperone Lhs1/Orp150, putative	0.981	964-991	SKKNGKKNNSKKDKKQQKQDKEEKKSRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZU4	Nucleosome binding protein	0.932	9-28	RKTKTRGVEKKKKDPNAPKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6P5	Nucleolar protein 16	0.982	7-29	KKKNRSAVPKLRRKRKTLPHGNK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G731	ABC transporter domain-containing protein	0.969	843-858	KAPSKAGGNRKKRKRT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZ58	U3 small nucleolar RNA-associated protein 25	0.951	4-24	PRGRGARQARGRGRGRGGRSF
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZ58	U3 small nucleolar RNA-associated protein 25	0.907	98-108	KGPARKKRKIH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I128	Uncharacterized protein	0.809	588-614	PRPKGAPRHGRNAILPRMMGKLGHKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2A5	Class I unconventional myosin	0.945	1599-1623	AKAKPTPPAPPAKRPVGRKPAPPPA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2A5	Class I unconventional myosin	0.921	1413-1457	TPRGKPVAARPVTKGKLLRPGAPGGGPSKLSGRPAAAAKPTPSPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2A5	Class I unconventional myosin	0.867	433-468	RRPVGGEKKSRGFGRSKATADVGDGRRGGGKPQVKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNN9	SNF2 family helicase/ATPase (Swr1), putative	0.983	1658-1674	QKKYKRGKEHRVKKKRL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNN9	SNF2 family helicase/ATPase (Swr1), putative	0.718	62-82	KKRKLTDSTSRRSRPPSPPWK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRS8	HECT domain protein	0.64	146-149	SKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSA9	60S ribosomal protein L13	0.955	195-226	RRLREARSEARLAGVREKRAKAKAEEAAAAKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSA9	60S ribosomal protein L13	0.918	29-49	PGRKHRRRQARLAKAAAVAPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT76	PHD finger domain protein, putative	0.964	340-363	PPKPKGRAAKAALPKGKGKEPLLR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXH0	Vacuolar membrane PQ loop repeat protein	0.667	110-117	KRREAHRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXJ0	Uncharacterized protein	0.988	145-166	RSPRKKRPIKQPMKPRSRRKSP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXJ0	Uncharacterized protein	0.86	226-242	KNREAREERERRRERRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZS4	Pre-mRNA splicing helicase, putative	0.71	89-93	KKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0K1	RNA polymerase III transcription factor TFIIIC subunit Tfc4	0.992	158-187	RRRRRRGGGRFSGRFGARGGKGIKRGPRKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0K1	RNA polymerase III transcription factor TFIIIC subunit Tfc4	0.794	608-614	IRRRKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2P0	Uncharacterized protein	0.723	173-184	KRRNREKEEAAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAG9	RING-type domain-containing protein	0.973	2317-2327	APKKRGRKRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAG9	RING-type domain-containing protein	0.953	2092-2100	KKKRGRKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAG9	RING-type domain-containing protein	0.906	2222-2232	ETKKRKIKRGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAG9	RING-type domain-containing protein	0.899	2126-2136	PKKRGRGRPRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAG9	RING-type domain-containing protein	0.64	163-166	RRRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCI4	Ribosome biogenesis protein RLP24	0.916	41-61	KMKRQPRKLKWTKAHRAARGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCI4	Ribosome biogenesis protein RLP24	0.858	111-130	TKRRLAGKLARDRKREEDRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDR6	DNA binding protein SART-1, putative	0.98	286-299	KIKKPKKKKAKSTR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDR6	DNA binding protein SART-1, putative	0.915	118-131	KKKQKKIEKERARK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDR6	DNA binding protein SART-1, putative	0.869	365-375	RAAFKKRKKMR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDR6	DNA binding protein SART-1, putative	0.835	71-87	AKRRREEKNAAIKKARE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDR6	DNA binding protein SART-1, putative	0.647	629-636	KTEKHLKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GG74	ARP2/3 complex 21 kDa subunit (P21-ARC), putative	0.743	25-33	RKEVRRRKI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVB8	Glycerol kinase	0.763	556-564	KRIKKLRRV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I251	Uncharacterized protein	0.627	253-259	AREARPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3U2	Serine/threonine protein kinase (Kcc4), putative (Fragment)	0.633	1083-1085	KKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F963	Transcription initiation factor TFIID subunit, putative	0.988	72-93	RKSGRASKSGSKARSRRKPKHK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCE7	Phosphatidylserine decarboxylase proenzyme 2	0.964	222-236	KRRRKLRIARLKRKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCE7	Phosphatidylserine decarboxylase proenzyme 2	0.833	776-791	KSREMEKKRIRKMLKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCE7	Phosphatidylserine decarboxylase proenzyme 2	0.769	144-151	SKRKPGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLD4	Homeobox and C2H2 transcription factor, putative	0.914	365-374	RKERRRRRKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLD4	Homeobox and C2H2 transcription factor, putative	0.64	228-233	RRGKIR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRW1	Ubiquitin-protein ligase	0.921	547-558	RRRRRRPRLGGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU69	SNF2 family helicase/ATPase, putative	0.893	146-164	KAKKGSSRKGGAGNERRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU69	SNF2 family helicase/ATPase, putative	0.816	1119-1125	KSKGKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXM4	Mitochondrial 54S ribosomal protein YmL24/YmL14	0.836	83-98	HGRTRRSWKPNVRRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZS7	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial	0.91	64-81	KQLKAEAKALKARKREKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G332	Conserved serine proline-rich protein	0.662	193-199	PKPLKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5G9	Uncharacterized protein	0.811	153-163	KKQRKRHEKKM
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5G9	Uncharacterized protein	0.659	217-222	RAARRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAC0	Uncharacterized protein	0.764	837-843	EARKRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GER2	Translation repressor/antiviral protein Ski3	0.931	926-946	PSKRGKKVPRRFLKAAIRAFK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HS75	Sister chromatid cohesion acetyltransferase Eco1	0.794	669-682	KRQKPPPPKTRHGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HS75	Sister chromatid cohesion acetyltransferase Eco1	0.621	762-767	PPLARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HS75	Sister chromatid cohesion acetyltransferase Eco1	0.611	758-760	RPP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0J8	Phosphatidylinositol 4-kinase (STT4), putative	0.789	1585-1595	IKRSKPEKKQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F790	Uncharacterized protein	0.686	118-125	KGNKRVRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUM4	Cell division protein Sep4a	0.736	55-69	RKASGGKMSKKMLKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXD7	Patatin-like phospholipase domain-containing protein	0.995	55-73	IRQRVRKPGRRRKAPKRSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FY24	Uncharacterized protein	0.795	602-622	ARSMSRFRTGRKSRSTPRPPS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FY24	Uncharacterized protein	0.724	750-784	RPPTRHGPPGKDNGKNGASDRIASRSPARQRSPRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FY24	Uncharacterized protein	0.684	859-868	RRGEQRRPRH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G059	Integral membrane channel protein, putative	0.995	1082-1105	NRERPKSRDKKIAKKKKPTSKPGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G059	Integral membrane channel protein, putative	0.663	662-666	RRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G167	Uncharacterized protein	0.709	8-12	KRKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2D1	Uncharacterized protein	0.903	76-97	RKLLARFREENGKKKPVEKRKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3M0	Chromodomain helicase	0.64	1043-1048	RTAKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3M0	Chromodomain helicase	0.629	1325-1334	RRGTREHEKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3R7	rRNA processing protein gar2	0.99	433-448	AKKAKKTEKAKKKSKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3R7	rRNA processing protein gar2	0.966	296-337	GANRRFKKTPWNKIEKKRLESGKAREKWTKSIEQEQKRRIAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3R7	rRNA processing protein gar2	0.959	6-52	KVTKRKAASAAAAAVSDPPAKKSKKAESKAVESPKQPAKPALKKSAA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3R7	rRNA processing protein gar2	0.924	94-126	KKTKSAKKDKKGEQKDGELNGADAKKSSKPKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3R7	rRNA processing protein gar2	0.898	183-199	KIPDSKKVKRKLVKKQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3R7	rRNA processing protein gar2	0.891	399-411	KSSDKKKGKKTKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3R7	rRNA processing protein gar2	0.682	72-80	AREVKPRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8N9	U2 snRNP auxiliary factor large subunit	0.984	85-135	RGDRRRRDYDDRERPSRRDRDLFDDRPRRRDRDRDAGRERKRSATPPRKRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8N9	U2 snRNP auxiliary factor large subunit	0.942	23-50	RDHGREGRDRGDRRRSRSPHHGSRPSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAK6	RNA polymerase II transcription elongation factor (Ctr9), putative	0.996	1038-1055	KTKRTKKKPSKRKKKAED
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAK6	RNA polymerase II transcription elongation factor (Ctr9), putative	0.971	1063-1093	SRRGRSTEPPSDGEAAPKKRRRLERRSAAKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAK6	RNA polymerase II transcription elongation factor (Ctr9), putative	0.857	976-999	AEIRRREEEVRKAREAEEERKKKI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBL5	Uncharacterized protein	0.937	132-144	LRKTTKRGRKRKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBL5	Uncharacterized protein	0.797	179-187	KRLRRRSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGV8	Rho GTPase activator	0.834	472-485	KEPRQPNRLKKKRI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUC9	DUF4604 domain-containing protein	0.949	144-155	SRKPKQKKKKIK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUC9	DUF4604 domain-containing protein	0.605	120-121	KR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZC2	MICOS complex subunit MIC60	0.648	110-113	ARKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I336	C-x8-C-x5-C-x3-H type zinc finger protein	0.993	341-376	KPAKAAAPKKKKSSPTKSSQPKVKKAPGKTSTKKQG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I336	C-x8-C-x5-C-x3-H type zinc finger protein	0.951	786-800	ERKKRLRKEERRRLR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3G7	Transcriptional regulator (Cti6), putative	0.792	420-433	STRKTGRPSRRGGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3G7	Transcriptional regulator (Cti6), putative	0.763	334-341	NGAKKRKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3G7	Transcriptional regulator (Cti6), putative	0.747	368-377	RRKGRSDRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I590	Stress response protein NST1	0.999	567-709	AKKAREAQKKKDKKRQQKQAKEEERARREAEKAAEEAAAKALEEKKQEEQRRKREEQRKKKEAEKKAQEEERLRKEAEKQKRLQEERERQAEAERKQREQKERERKKREEAKRKEREEREAREKKTKEERERKAREDQAKKDK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I590	Stress response protein NST1	0.993	187-200	AKKSKKKKGKKGRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I590	Stress response protein NST1	0.924	87-100	KKKQKRRQKEAARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBA2	KRR1 small subunit processome component	0.999	276-353	KERARKEEVMERQREKREEKMKEREKDFVPPKEKEEIEAEAKRKEKKKHKRKRAEAEGDVEGDGAETKKKKKKSKKER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIJ5	Cytomegalovirus gH-receptor family protein, putative	0.724	1036-1049	IRRIGRPGNLRHRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLJ4	PWWP domain protein	0.977	258-277	KEAAKAAAKAEKEQKKKKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLJ4	PWWP domain protein	0.966	299-365	KKSTKATKKRKKDAESEAENEKPAKTPKTTTKLKLTTPKTPASETKKPATKAKETKGKAAGTKKGAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLJ4	PWWP domain protein	0.903	90-113	SAKKAANGKRKSTGGNQKLSRKKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPJ9	RNA binding protein, putative	0.912	89-97	KKSKGKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPJ9	RNA binding protein, putative	0.835	144-159	RSRRRPGRDAPPRERK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRP0	RNA helicase	0.793	456-471	RGTRGATLKGRKFKRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUI5	Eukaryotic translation initiation factor 2A	0.985	530-550	KPLSKSAAKNKKKREAKKLKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX97	Mitochondrial export translocase Oxa2, putative	0.666	139-145	TLRKRWK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYS1	Uncharacterized protein	0.629	68-71	RKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2F4	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.987	179-224	ARRGERRRNQERATRAAPAPKSSTPRPDTQKRRPGPGRPPKRSNQV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2F4	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.928	559-578	EKSARGRKRKHDGDEPRTKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2F4	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.861	271-289	PKPKGRQPKSVSARRKHNR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2H7	CBF/NF-Y family transcription factor	0.876	415-426	GKRKRGGGRQKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3J0	Uncharacterized protein	0.775	217-224	RRKRRSPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5E9	WD repeat protein	0.996	581-627	RAKRVKEKIEKERESRIRGKKKVTAKVNKKLAEKLLEKEERHERRRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQZ7	RING finger protein, putative	0.785	740-748	RPGGRRGRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I163	COPII vesicles protein Yip3, putative	0.997	139-200	RRMRTAESKETQRKKGASSRPSLTEKRKDKSNGKIKGKDKDKGKNEKPITKGKAEKTEKRKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I163	COPII vesicles protein Yip3, putative	0.935	410-420	RGSRARRGRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7X2	Non-specific serine/threonine protein kinase	0.663	220-227	RSRISRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8A7	Autophagy-related protein 26	0.685	137-144	GRIHRRKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHG9	FSH1 domain-containing protein	0.722	310-321	KRRKIFALRSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FI15	Nuclear migration protein (ApsA), putative	0.798	470-496	APKRSNRFNKQEAFKKPPRPEMLGHGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIA8	Transcription factor BYE1	0.999	127-157	WEEAAKRRQQQAEEKKARRKKGKKGGKKARP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIA8	Transcription factor BYE1	0.772	28-41	KKPKSKSQSKDKPS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMT7	Uncharacterized protein	0.612	105-106	RR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ09	C6 transcription factor	0.746	29-39	EKKTATRGRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ80	DNA-directed RNA polymerase	0.824	507-519	ILAKRKSKMGRSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSY1	FRG1-like family protein	0.943	223-266	RFKPRVKASKESKAREKISRRELEEAVGRRLEDHEVKRLKRARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSY1	FRG1-like family protein	0.873	9-18	GDKPKKRKHR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU85	C2H2 transcription factor	0.6	113-113	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUZ1	DNA helicase	0.906	796-824	KDKVGHHPLFKKMERDRQRRKKEMDELRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUZ1	DNA helicase	0.879	756-768	GPKAKGGKKGVKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZY8	Ribosomal protein L24E	0.669	401-409	RSRRVRRLA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G052	60S ribosomal protein L26	0.772	123-134	GKGREARAKGKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G052	60S ribosomal protein L26	0.634	13-16	RKSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G069	Uncharacterized protein	0.955	225-238	KARNEDRKRRKKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G592	RTC4 domain-containing protein	0.96	250-266	GKPVKGKKKGTKRDARS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G592	RTC4 domain-containing protein	0.928	108-143	NRASPRKNGGRNATTDSPRTGSRKPARQQRRRSPKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G965	Uncharacterized protein	0.803	397-416	GDGGRRRRLGDFRDRRDLRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G965	Uncharacterized protein	0.753	373-384	RRKSRGRFRDGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G999	Ser/Thr protein phosphatase family protein	0.961	651-678	RGRGGFGGRGRGRGSDRGGRGGRGRGGF
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDG1	NADPH:adrenodoxin oxidoreductase, mitochondrial	0.734	519-529	ERGKQKGKLRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUR3	WD repeat protein	0.835	501-513	RKRHGRAAGKRGS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5A0	Uncharacterized protein	0.936	783-804	APKGPLSDARKGRARGPTRRKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5A0	Uncharacterized protein	0.635	683-693	KPPAIPDKPKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKI5	MFS transporter, putative	0.933	333-344	RRPRPRKRTKRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLD2	Uncharacterized protein	0.969	116-151	QKPRTDSRGRRPGPARFGAAQRGRSAGRDRPRRQRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUP6	Zinc knuckle containing protein	0.8	10-38	EKKATGTSGQKHKRPSSDVRGGGVKKPGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUX1	Uncharacterized protein	0.898	708-722	ASRKDTKGKKPERKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWK1	60S ribosomal protein L38	0.691	23-30	ARIKRNRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX58	Uncharacterized protein	0.825	46-62	RARRKRENDFQRRRRRN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FY76	EAF domain-containing protein	0.798	232-260	PAPSIRKSKPQTNPLRQQKRAPKPAQTSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G232	RNA polymerase I subunit Rpa43, putative	0.998	389-413	KTKKEKKEKDKDKPKSKSKSKKKEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G232	RNA polymerase I subunit Rpa43, putative	0.991	51-67	EASPKKEKKSKDKKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G232	RNA polymerase I subunit Rpa43, putative	0.99	19-42	RERKRKHKNKDHASPAKKRKHRDA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3F7	Uncharacterized protein	0.975	237-255	RIENRDARKGRKRKDRPWK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5V3	Uncharacterized protein	0.997	232-300	PRGRGRPPNTGTKSTSASAKKPTSTPGRGRGRPRKPESERKPPKPVSLNPDGTPRGRGRPRKSDGAVTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5V3	Uncharacterized protein	0.988	304-369	TPSKAKSAAANGTPGSRGRPRKSDAAATASAAKSPGRPKKAAAPELKKGATANDIQKRRGRPRKSG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5V3	Uncharacterized protein	0.708	202-208	KRKRGRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T5	Uncharacterized protein	0.788	29-40	RRVKRQRTRRKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9A4	Abhydrolase_3 domain-containing protein	0.808	728-741	RSALPSPGKRRHRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBH6	Histone deacetylase SIR2	0.655	341-345	KRKRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I289	Uncharacterized protein	0.626	259-265	DKAMKQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I289	Uncharacterized protein	0.611	255-257	KGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3Y6	Uncharacterized protein	0.978	80-105	KGRKRKAEATPSVAPKKRGRRAAASK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBZ2	RNA helicase	0.998	775-828	SKKKKVKLSNKDKKKLDASRERHEGRMWKKGRKERETPQKPQKKGGAKKGKSKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBZ2	RNA helicase	0.997	152-175	IIERRRERKKEAEERKKRKEQKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBZ2	RNA helicase	0.929	52-78	KRKREVNDAATGKTQKQKKQKRKQGAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBZ2	RNA helicase	0.656	139-146	KKGGDKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCI6	Uncharacterized protein	0.848	164-184	KKYKMKRGSRLKLLRRTLRER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FH96	3-ketosteroid reductase	0.878	397-405	RRRRRKRGA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHF8	Uncharacterized protein	0.74	251-258	PKIHRRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHF8	Uncharacterized protein	0.621	359-361	KRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPM6	Protein MAK16	0.997	280-303	RKPAPGAKRKRAAPPPKPRKKGAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPM6	Protein MAK16	0.913	127-161	KLAKEEERLGERIVPKLAPKIRRREDTRERKAEAA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVN1	G-patch domain protein, putative	0.82	30-50	RKLRKQREAEAKAKVPSKAER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVN1	G-patch domain protein, putative	0.613	140-142	KRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWG6	rRNA processing protein RRP9	0.982	12-46	RKRKREDRATAPASKKRGVSGNRDDKEKKAKGRKD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWG6	rRNA processing protein RRP9	0.906	198-213	GGRRPAPQRKKPKNLK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWG6	rRNA processing protein RRP9	0.839	546-561	HIKPGQAPKKSKSKAG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX93	Serine/threonine protein kinase, putative	0.811	287-311	SKRRRLGKLGNPEDKVKKEVAILKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G025	SRP9-21 domain-containing protein	0.993	155-169	AKGGKSKKKGGKGKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0W2	Phospholipid-transporting ATPase	0.956	738-758	RAKLIHKKRSTKGKKAMSRKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7H1	RNA processing factor 1	0.997	20-63	NKLRRQLLHVKRKRSKDEARRKERFGRKKEEAKDPSLRAERLRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HT05	WD domain protein	0.974	315-326	LARKRKRRKEKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I070	DAGKc domain-containing protein	0.897	1919-1926	ERKRKKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I070	DAGKc domain-containing protein	0.646	660-663	RKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3U9	THUMP domain protein	0.843	8-19	SKRRKGGDKWRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4P6	RING finger domain protein	0.949	119-134	RHGPRPRRRAPRPRAP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB13	Vacuolar transporter chaperone 4	0.784	666-679	KRIAKRFHAPKGKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD10	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.626	540-542	RKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGW2	C6 finger domain protein, putative	0.667	531-536	RGAKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HW14	Uncharacterized protein	0.847	286-316	KKAKRSPTHLPSPSGSKKRSSVFSRKNKAQP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXH6	ABC transporter	0.915	1000-1018	TDKEKDKGKDKQKPVRKRN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXH6	ABC transporter	0.822	1074-1083	AKGKPTKKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I353	Protein BFR2	0.648	335-339	KKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5D8	Nucleolin protein Nsr1 (Fragment)	0.988	31-62	ASQTPKAKGKEIARKLAAKEEKSSRKNKKKAP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5D8	Nucleolin protein Nsr1 (Fragment)	0.939	171-187	KAPAKAKKAEPAKKAKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5D8	Nucleolin protein Nsr1 (Fragment)	0.767	131-145	KTETKKAEPKKAEAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5D8	Nucleolin protein Nsr1 (Fragment)	0.61	232-233	KR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAI9	Uncharacterized protein	0.824	6-23	RGRRKPLPSKEQHRRPAT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCB5	Required for respiratory growth protein 9, mitochondrial	0.991	144-196	KKKRARSEKQSNSKQKAESSGEKNHKLPEKKKKREPWQIYKEALKNKFKEGWA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDB9	Pre-mRNA-splicing factor cef1	0.947	174-193	GKKAKRKARERQLEESRRLA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDB9	Pre-mRNA-splicing factor cef1	0.737	271-276	RKKRKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDB9	Pre-mRNA-splicing factor cef1	0.601	197-197	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG35	Formin binding protein (FNB3), putative	0.984	730-769	TSRSAKRYRRDSRERDRSRAARKDRERARDRASAEAEAKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG35	Formin binding protein (FNB3), putative	0.959	628-689	RERSYRKTSGLSPIRDRREDRDRDRERDRDRYRERERERDRDRRPPSHYERERRDREEERER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKH3	Annexin ANXC4	0.998	483-521	RRKKHKRKTSRDDRHDKDKKKDKEREKEKDKERRRRHER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKH3	Annexin ANXC4	0.889	48-80	PRIRSRSKSPSGRSVRERSRSRDSRAPSPAAGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNZ4	Uncharacterized protein	0.988	569-601	AYERARKDREKAVKDREKLIKKREKAAAKEAKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNZ4	Uncharacterized protein	0.726	671-683	PRQGEAHKPKKDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP54	Replication termination factor 2	0.937	206-217	KKAPGSKKRKKH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP54	Replication termination factor 2	0.829	262-269	KEKKKRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ33	C6 finger domain protein, putative	0.689	40-46	PRGPKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZC8	Uncharacterized protein	0.866	287-306	SPPRQSRGPRPHKRIGGFRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZC8	Uncharacterized protein	0.623	317-319	KRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G109	Uncharacterized protein	0.947	418-444	RRRADLAARREERRARRAYRAAARRYR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1D1	Oxidoreductase, short chain dehydrogenase/reductase family	0.874	385-406	KEGAVKRALEKKEREEAEKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1D1	Oxidoreductase, short chain dehydrogenase/reductase family	0.743	435-441	RRSRKAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7U6	DNA mismatch repair protein	0.659	206-214	GRGGASKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9J6	Origin recognition complex subunit 1	0.944	74-88	RRRRSSRPARKARKI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUJ1	AMPK1_CBM domain-containing protein	0.976	620-640	EEPKKKKRSSGFFKKLKEKFK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1D7	Uncharacterized protein	0.834	85-96	SSRRSKRARARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3A7	Lysine--tRNA ligase	0.992	31-58	LKRRQKLREKEAKKKEKEAAAPPKAEKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4H1	Ribosomal small subunit assembly protein	0.908	100-109	LAKKSKKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4H1	Ribosomal small subunit assembly protein	0.855	283-306	LLRKFDEDKKKIEEMKKQRGRLRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4H1	Ribosomal small subunit assembly protein	0.647	275-280	KRKERQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I564	RING and UBP finger domain protein, putative	0.985	701-712	SKKKKNRGKGKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9B0	Dolichyl-diphosphooligosaccharide--protein glycotransferase	0.987	723-739	KGHKKKRASKRKGPRVL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBU2	Transcription initiation factor IIF subunit beta	0.955	155-168	KREARKKDRKKRWE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG72	BHLH domain-containing protein	0.846	261-270	KRRRRRASHN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG72	BHLH domain-containing protein	0.604	274-274	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLG3	CCCH zinc finger protein	0.982	273-284	ATRKPKKKKRRH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLG3	CCCH zinc finger protein	0.975	353-439	RVEERKKVHEEAQRARNEALKQKQKQREEAKQKQKEARAKQEQAKEERKAAAEGSENPMDAAAKARQKADKLRRKLMKEEKRAAKAE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLG3	CCCH zinc finger protein	0.867	623-636	KPAEKKAKEKAGRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLG3	CCCH zinc finger protein	0.763	38-53	GGRGAGGHHRGRGRGY
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLG3	CCCH zinc finger protein	0.616	346-347	KR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQY5	Membrane-spanning ATPase, putative	0.897	71-82	PRRGGRRRRQRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSY2	DEAD/DEAH box helicase	0.879	3-22	PKKKAGARGEPKPGTKQAKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSY2	DEAD/DEAH box helicase	0.717	196-207	KKKQEREKLKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTH5	GRAM domain protein	0.9	1078-1091	GKSGSKTGKGRRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTH5	GRAM domain protein	0.713	76-83	KGRRWRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1Y0	Uncharacterized protein	0.802	82-92	DSRRRNPRRRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1Y0	Uncharacterized protein	0.688	592-599	GAKKQRAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1Y0	Uncharacterized protein	0.669	615-627	RARAIKSLKAAKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1Y0	Uncharacterized protein	0.644	470-474	KKKPI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1Y0	Uncharacterized protein	0.601	413-413	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4M8	Uncharacterized protein	0.881	160-175	EGAPPPTTKKAKKKAA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4M8	Uncharacterized protein	0.637	28-33	KPVKKT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6U2	FNIP_N domain-containing protein	0.762	341-349	KRKKIKEKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA82	BRCA1 C Terminus (BRCT) domain containing protein	0.673	533-537	KKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA82	BRCA1 C Terminus (BRCT) domain containing protein	0.656	16-20	RKRRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBC6	Rab-GAP TBC domain-containing protein	0.767	718-747	PPKDQKEEKKHLKEYKRMMAQSREADKRRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC98	ELMO/CED-12 family protein	0.747	270-279	RKKKHNPEKW
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC98	ELMO/CED-12 family protein	0.746	761-769	SPEKGRKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F769	Cytochrome b5 heme-binding domain-containing protein	0.73	237-248	ARPKRGEQAKGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAH6	Uncharacterized protein	0.994	550-577	EKANKKREQLKRELEAKSKAPAKKKRKF
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAH6	Uncharacterized protein	0.907	325-365	PRKSPTKSPSPSPEKPAPKPTSKGLGVIGGPKPTKKEPPRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAH6	Uncharacterized protein	0.847	466-486	SPQKPKPRGKLGTIGGGARSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIN9	Oxidoreductase (Msc7), putative	0.919	702-716	VRGRRKRRAAANTKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIN9	Oxidoreductase (Msc7), putative	0.744	764-770	SGRRRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJN2	Ribosome biogenesis GTPase Lsg1, putative	0.98	655-671	SSKKHFKGGKKKAKKTR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK38	Uncharacterized protein	0.864	70-87	KHGQSRKRGRPRMDIGQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK38	Uncharacterized protein	0.6	92-93	RR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSJ4	SRP54 domain-containing protein	0.916	232-247	SLKKAKPKATGKKMRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSJ4	SRP54 domain-containing protein	0.722	211-219	RVSRRARKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT14	Uncharacterized protein	0.993	748-774	KHMRPEHKWNKPAKDKKKRATRVRKGP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT14	Uncharacterized protein	0.63	966-970	RRGGP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT14	Uncharacterized protein	0.603	974-974	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUP7	Uncharacterized protein	0.705	857-875	RRARDERERIRLNERRERL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUZ0	Ribosome biogenesis protein ERB1	0.675	257-272	KRRFLPSKHEAKRVMK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWI2	Noc1p protein, putative	0.768	115-132	PKPRMRRPSLHRPESPRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXK5	Uncharacterized protein	0.874	1206-1232	KARKIGDGLRRAKSELVKRRDSLRRKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXK5	Uncharacterized protein	0.807	1173-1184	DRKKMRDPRRKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXK5	Uncharacterized protein	0.804	1107-1136	RKGKHEKEIRGLGKEILWLRARLKREEKFR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G841	Pyridox_oxase_2 domain-containing protein	0.842	541-552	RPPVKRSKRARK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G841	Pyridox_oxase_2 domain-containing protein	0.686	504-514	RQTRGSLKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9N4	Response regulator, putative	0.779	854-862	HPPRKPKKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEK8	Uncharacterized protein	0.804	159-168	PRKRTRHRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HS23	CENP-T_C domain-containing protein	0.741	83-93	TPGRDRRKSGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HS23	CENP-T_C domain-containing protein	0.72	350-358	GRKEKKISR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1X2	Phosphatidate cytidylyltransferase, putative	0.608	145-146	KR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3U6	40S ribosomal protein S30	0.989	10-37	RAGKVKSATPKVEKQEKKKVPKGRAKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5N2	RNA binding protein Nrd1	0.972	435-471	PGRRGGDPRDARRRGNDYRQRSPAGRRRRTPTPPRKD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5N2	RNA binding protein Nrd1	0.844	399-422	GGYRRRSRSPGWDRRRDVSPPRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I682	DNA-(apurinic or apyrimidinic site) lyase	0.967	324-366	PAKKRATNGRGKATVKKEEAEDKPTKKAKEQSAGRRRSTRLTR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I682	DNA-(apurinic or apyrimidinic site) lyase	0.703	255-262	WGKGKKNK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8B0	Uncharacterized protein	0.86	262-272	RKRERKLKEKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8B0	Uncharacterized protein	0.605	315-315	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8B0	Uncharacterized protein	0.603	317-317	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAY3	Nucleotide-sugar transporter, putative	0.99	91-119	KERSHRRQKRKKQRRHLDARIAGVKASKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC39	Uncharacterized protein	0.996	168-203	KPLDPEDEKRRRERRHREREARHRDRDGKSRSSKKT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC39	Uncharacterized protein	0.901	98-119	KSRRPAPSRPSNKPPSRPPKER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC39	Uncharacterized protein	0.712	145-157	RSRSHDVRRPRRN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGI9	Rad2-like endonuclease	0.986	487-506	PKKKAKPAPKKTTTKGKKKT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGI9	Rad2-like endonuclease	0.803	712-726	PEKSKARARVHPRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGI9	Rad2-like endonuclease	0.62	805-807	RRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJI0	CYCLIN domain-containing protein	0.921	406-421	AAKKRRLEREKREKEA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPV7	Uncharacterized protein	0.814	282-292	KTKKGPKRGPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWB3	U3 small nucleolar ribonucleoprotein protein Lcp5, putative	0.898	306-320	PKESKKERAKRRAQF
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWB3	U3 small nucleolar ribonucleoprotein protein Lcp5, putative	0.853	380-391	EKRRKKIDSWKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWB3	U3 small nucleolar ribonucleoprotein protein Lcp5, putative	0.842	343-365	RLTRRAKGSGNVLEKSRKRRLTE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWH3	Uncharacterized protein	0.997	145-164	ERKRKKKERRLAEKRAKAKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0U0	Golgi matrix protein, putative	0.949	14-30	KPKNKKNKKSAARNKAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G237	Topoisomerase 1-associated factor 1	0.861	567-576	SRRRAIRKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G237	Topoisomerase 1-associated factor 1	0.76	339-348	KWNKPRQKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G237	Topoisomerase 1-associated factor 1	0.651	1020-1028	RKAQAKRIR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G237	Topoisomerase 1-associated factor 1	0.602	956-956	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3E5	Ribosomal protein L19	0.97	2736-2764	RARARELNAARRIGRHRGLGKRKGTKDAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3E5	Ribosomal protein L19	0.963	2810-2856	HKRALIEHIHKAKAEKARERVLKEEMDAKRAKTRAARERRQERISAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRE5	RNP domain protein	0.994	300-325	EGRKRGSGRGRGRGRGRGGRFGRGGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRE5	RNP domain protein	0.635	359-365	KPRSRPQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I526	C6 transcription factor (NirA), putative	0.674	13-22	RKIHKDKAKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9V3	C6 zinc finger domain protein	0.761	26-31	KRRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM84	60S ribosomal protein L8	0.844	223-253	SGKKVAPAPYPQGKAGSSKKAAKNPLIEKRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM84	60S ribosomal protein L8	0.829	466-480	ARQEKKRKAVEKAIK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNA2	RNA binding protein (Rbm8A), putative	0.989	123-153	PPPSKGKGGPPKGTRGGRGRSRSRDRSRSPG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSS0	Serine-rich protein	0.857	534-553	RPRTRRREGSRSPQRRPQQR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUF5	Ribosomal assembly complex component Ipi3	0.936	530-549	KDKLARRARKEERERERREA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUI6	Ribosome associated DnaJ chaperone Zuotin, putative	0.991	293-365	KKFRQQERAGKDKRRLEKEAEAKRLAEEKEQARIEEERKKKEAEEAAKVEREANKKAKEAAKNAAKKNKRVLK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUI6	Ribosome associated DnaJ chaperone Zuotin, putative	0.904	256-271	KRHIEKKNANARRKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUI6	Ribosome associated DnaJ chaperone Zuotin, putative	0.877	120-136	IKRAHRKKVLRHHPDKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVV0	Alpha-1,3-glucan synthase	0.893	1735-1746	SSERRGRRKIRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVV0	Alpha-1,3-glucan synthase	0.64	1116-1120	RKLKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.998	1910-2020	RRAERRAKRSSKHAAELREAEERRTRRREEREAREQRAREEEERERERKREEKRARRAAREERRAQEEQEAREAEARADAKAAERRERRRTREAEEMNGGSRHRSKSGRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.986	1379-1407	LEQAKKDKEKEKKEEREKEKEKEREKEKQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.961	1867-1881	EARRIRREERKKRRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.955	1563-1634	GAAPPKKPSRREGRAKEDIDTPRAKERSPTALARSKSDATRRHRHRASENEGERSSTSDRERRAEKSSRAKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.949	1705-1719	SSKRRKEGRRSEKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.942	345-354	SKKKNKKKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.893	271-282	HKKKKGGAAAKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.884	518-525	KKDKKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.846	1168-1177	KDKKKSKKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.809	977-993	QKKREKQLKAKGLPIPG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.809	1834-1850	SLRKPSRPDPPERRRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.777	907-919	QKKREKQLKAKGL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.768	1497-1507	KKTKKSSKSKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.757	838-848	KKREKQLKAKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.752	2109-2118	MRRLARRRAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.75	398-404	KKKKDKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.736	770-780	KKREKQLKAKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.728	1750-1759	KAKKQRSKSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.711	617-625	KKDKKSTKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.702	588-593	KKKGKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.696	1811-1824	RHHKRSTNAPKKAE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.687	2038-2043	RSRRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.686	550-555	KDKKRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.685	1435-1454	KSKSTKVSSSKKESAAPRPA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.654	2131-2135	RARRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.635	1111-1115	KRREK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.629	1544-1547	RRER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.626	1048-1051	KREK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX12	Uncharacterized protein	0.603	1428-1429	KK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYG0	tRNA(M5U54)methyltransferase	0.907	9-23	RHESKRRRKAAEKAN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ50	Uncharacterized protein	0.711	59-63	KKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9Q5	U3 small nucleolar RNA-associated protein 11	0.974	221-241	RELRAARKSKKRAAEARRNKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9Q5	U3 small nucleolar RNA-associated protein 11	0.819	278-286	KWKIRERKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9Q5	U3 small nucleolar RNA-associated protein 11	0.678	44-54	KKAKLQRLREK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEF4	Uncharacterized protein	0.783	75-88	RKAKREIRKLMRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUN6	Fungal specific transcription factor domain-containing protein	0.854	14-33	KRKIHIETRFGRARRSRSRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HX77	Uncharacterized protein	0.884	218-227	KRKRRKSAGI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I266	5-Methylcytosine G/T mismatch-specific DNA glycosylase	0.998	242-265	KAKQKSRRKRAARKARRAQRRASE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I266	5-Methylcytosine G/T mismatch-specific DNA glycosylase	0.958	119-132	RRKRFSRKKRAIRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I266	5-Methylcytosine G/T mismatch-specific DNA glycosylase	0.755	78-86	RQKAPKRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FH67	DUF1713 domain protein	0.997	328-358	VKRQRKLKMKKHKYKKLMRKTRTLRRKLDKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FH67	DUF1713 domain protein	0.914	75-92	QKREGKSSRRKGRDNGRH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FH70	APH domain-containing protein	0.608	298-299	KR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FI80	NmrA domain-containing protein	0.955	322-336	GKAGPARKKRKVDGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIW6	Double-strand break repair protein	0.941	526-539	TGRRTRGKKRFKPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIW6	Double-strand break repair protein	0.877	582-597	RASRGRGRGRGGRAAA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLN7	40S ribosomal protein S8	0.969	8-44	RHKRSATGAKRAFYRKKRAFEKGRQPANTRIGNKRIH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNU5	Serine/threonine-protein kinase cbk1	0.992	849-864	PKVHKKKKEKKRPRDK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNY0	Zinc knuckle domain protein	0.996	609-665	LPRSPPPRGPPRQPPRRGRGSDRGGRGGGRGRGRGGGQNGDAYRPMPSAAKKAWNKH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNY0	Zinc knuckle domain protein	0.605	45-46	RK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU53	MYB DNA-binding domain protein	0.996	75-118	ARGRESTPRPVKRTRTEKTERDERERQARKAEKKAGKAKKNKVA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU53	MYB DNA-binding domain protein	0.803	440-457	RAKGRTKKDEPEKKGNWR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU53	MYB DNA-binding domain protein	0.715	640-646	SAKRRKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU53	MYB DNA-binding domain protein	0.688	51-55	RKRKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU53	MYB DNA-binding domain protein	0.604	64-64	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUG3	Uncharacterized protein	0.994	10-71	KAIPKFSSFKPKAAPKPEADKTREHRRRESPVSERREHHERSKHRSRHRSHRHRSRSVQRSP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FV90	Peptidase (PNG1), putative	0.695	372-377	KKRREN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVF7	Uncharacterized protein	0.906	39-54	KTKKKGKNGSKGKDKT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX28	ERCC4 domain-containing protein	0.991	248-301	PKKQRKTGKATAVDKEAKEAKARERAAAKAERERIREEEKAKKQKLKEEKAKEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2R8	Universal stress protein family domain protein	0.982	274-287	PSAKREKKKKKRLA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4F7	Uncharacterized protein	0.81	470-506	RRREEEEWKREERNHARREAHLRALEAEREKARRSWL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4F7	Uncharacterized protein	0.633	516-520	KAKNK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4J7	5-Methylcytosine G/T mismatch-specific DNA glycosylase, putative	0.94	1011-1022	RRRRPKRRTERR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4J7	5-Methylcytosine G/T mismatch-specific DNA glycosylase, putative	0.927	201-230	STVKSRDKDRDSKKDTDKEKKRHSRSSHGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G575	Protein FYV4, mitochondrial	0.972	229-250	GERRRAEVRAKKRSEERRKGIA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6J1	RNA binding domain protein	0.757	144-150	RHKKRRT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7W3	C2H2 finger domain protein, putative	0.996	174-200	KEREEEEAREREEKRRKRNEKRRKAKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G808	HLH transcription factor, putative	0.982	972-989	RNVRKEERKRRRSAKHRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9D6	RNA helicase	0.925	15-30	PPKKKSRTDKDAKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAN4	Component of oligomeric Golgi complex 3	0.866	732-745	KHKGKPISKKGKGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCA3	Signal transduction protein Syg1	0.643	26-29	KKKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQG3	DEAH-box RNA helicase	0.943	38-67	EKEERRRKLKEELRASQPKVSAKKQKRLDK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQG3	DEAH-box RNA helicase	0.909	188-198	LKKRKRAPKVK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQG3	DEAH-box RNA helicase	0.744	4-13	PKPRQRKNKH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2J0	Uncharacterized protein	0.617	209-211	PKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3J4	C6 transcription factor, putative	0.768	60-69	GYKGPSKKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I475	C2H2 transcription factor (Seb1), putative	0.798	596-603	RPLKKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F6X8	Mediator of RNA polymerase II transcription subunit 6	0.903	294-325	VGKGPKAAEKEKEKTPGTPDADNKLKRKKSRV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEW8	DNA repair protein Rad7, protein	0.979	80-107	RKKRKRKETATLNKIKQSKAFARRKSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEW8	DNA repair protein Rad7, protein	0.841	174-187	KAVLKKRGPKNSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGD9	Transcription factor TFIIIB complex subunit Brf1	0.948	357-368	EGKKPSKGRKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGD9	Transcription factor TFIIIB complex subunit Brf1	0.915	573-582	GKPRKRRRGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGD9	Transcription factor TFIIIB complex subunit Brf1	0.846	446-458	RPKGRPKGSKNPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIR6	Chitin synthase activator (Chs3), putative	0.977	89-133	NPGGRRPPPGGRGGRPMNRPPPQGRMRPSPGGPPPNGYPDRRKGP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJI5	DUF803 domain membrane protein	0.783	666-680	PGKTQRAKRQGRTRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM19	Uncharacterized protein	0.653	153-162	RRARENRQKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSC4	Dolichol phosphate-mannose biosynthesis regulatory protein	0.986	157-173	SSKKKAAKAKAAAKKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWY5	Uncharacterized protein	0.988	156-172	NARRKKRRAVPEKKRRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYK2	Uncharacterized protein	0.902	330-356	RKKRAEEEERRTKKLLEAEDKAKRKKQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G024	Isoamyl alcohol oxidase	0.683	594-599	RRRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1F9	1,3-beta-glucan biosynthesis protein	0.74	356-362	RRPPRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2C4	DnaJ domain protein	0.92	147-171	DRKKQRSKATDEKKRAKAEPSDSHR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2C4	DnaJ domain protein	0.678	185-196	AERAKYRTKTRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7K6	GYF domain-containing protein	0.914	301-322	GKGIQKKPKWQNKNKNKNRTKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7K6	GYF domain-containing protein	0.798	248-267	KDIKKAKDAAEKRDAERKAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTS8	Inner centromere protein, ARK binding region protein	0.898	818-842	RKKEQEEREARRKEEQKREQERKRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTS8	Inner centromere protein, ARK binding region protein	0.747	640-654	EREEKRKQKELEDRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTS8	Inner centromere protein, ARK binding region protein	0.691	666-687	ERQKAAQHKASLEKAERERREA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTS8	Inner centromere protein, ARK binding region protein	0.662	721-730	DRRPVRPTRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTS8	Inner centromere protein, ARK binding region protein	0.605	732-734	APK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTS8	Inner centromere protein, ARK binding region protein	0.603	698-698	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTS8	Inner centromere protein, ARK binding region protein	0.601	663-663	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZU5	OTU-like cysteine protease	0.854	118-132	RGKKPNRQKARLARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZU5	OTU-like cysteine protease	0.789	21-32	QKKKSATKKTRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I471	Telomerase reverse transcriptase	0.883	384-397	HERRPKIPKRLRGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I471	Telomerase reverse transcriptase	0.771	3-10	KKRKRPAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I471	Telomerase reverse transcriptase	0.743	808-821	QRSKPSKRFGARAA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I471	Telomerase reverse transcriptase	0.672	686-693	RRRTVKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4V5	C2H2-type domain-containing protein	0.775	185-196	AKREVPKKKHTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCR6	DNA methyltransferase Dim-2	0.751	1130-1138	KPKKQKARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUS7	DUF2431 domain-containing protein	0.635	49-59	KKGGGAGGKDK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVC0	Iso_dh domain-containing protein	0.82	1186-1197	RNKATSKKKDKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1M5	Uncharacterized protein	0.966	427-457	RSARKEREGSPKRKSPEPAGGAGSPPVRKKH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1M5	Uncharacterized protein	0.924	349-361	RPRAKKPRRPNRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G780	PARP-type domain-containing protein	0.991	191-223	VKKRGRPAKSGAPAEKKTEKEAKPAAKGGKRKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G780	PARP-type domain-containing protein	0.986	143-172	APAAKKGRAGAKGKAKKEDTTPATKKAKKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G780	PARP-type domain-containing protein	0.979	240-272	PEPRPPKRGRKSAGAEEPVAAEEKPKRGRKKAA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G780	PARP-type domain-containing protein	0.823	282-296	APSETKPTRGRKKAS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G780	PARP-type domain-containing protein	0.747	119-128	FRARATKKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8B4	TGF beta receptor associated protein 1, putative	0.643	12-15	KRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8B9	Uncharacterized protein	0.678	668-675	PRARGRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRL0	DNA damage repair protein (Rad9), putative	0.943	1413-1423	KPGRGRKRKRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRL0	DNA damage repair protein (Rad9), putative	0.685	1091-1097	HRKSPRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRL0	DNA damage repair protein (Rad9), putative	0.663	801-805	RKKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTJ4	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	0.992	106-127	GGGKKKGKKDKKEKGQNTHRKF
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBJ2	RRN9 domain-containing protein	0.995	360-392	PRKRRGTTTLERSRSRGRKRPRAISRSKSRGRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBJ2	RRN9 domain-containing protein	0.765	518-528	PKPKRTRSRPQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBJ2	RRN9 domain-containing protein	0.642	556-562	KGKGEHR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIB9	Uncharacterized protein	0.92	55-88	KRRQWRVREKIRRSARRVGEAIRTPLTPRFAKSA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNG6	ABC transporter	0.609	686-687	KR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNI4	AMP deaminase	0.714	297-302	PRKRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ97	Uncharacterized protein	0.962	745-758	GEKKRKKNKYGRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ97	Uncharacterized protein	0.792	128-136	PDKRGKKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FR14	Sigma-70 region 2 family protein	0.814	92-100	KRKKAKGKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTH1	Uncharacterized protein	0.848	112-119	RRPRRKRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTH1	Uncharacterized protein	0.749	132-140	SRRRPGRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTH1	Uncharacterized protein	0.64	151-154	RRRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0L6	Uncharacterized protein	0.942	114-130	KKRRNQGGRRKSAKEKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4W6	Cell cycle control protein (Cwf19), putative	0.998	14-94	KERKEHRSSRDKDRERDRSRERRHRHHHHHRRHSRSRERERDRDHDRHRHRDDEERHRHKRSRHSSNGDSHEHSHKRRHRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4W6	Cell cycle control protein (Cwf19), putative	0.717	669-686	RWHRGGDKRVDGFRKRWR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9Q0	tRNA(His) guanylyltransferase	0.662	179-184	RKLRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGH0	Uncharacterized protein	0.827	63-79	HKNKRAKKASSADSKGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGH0	Uncharacterized protein	0.746	201-220	KKRKIASEKEATNHPAKKRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGH0	Uncharacterized protein	0.626	36-41	AKPVKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYR6	Uncharacterized protein	0.889	4-30	PRRAPPRKGGSSTNSKEGKKKQNTKAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I198	INO80 chromatin remodeling complex	0.952	603-642	SRGRGGRTSRGRRKPAGSTTSTPRRNGVASARNRGGRSRT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I198	INO80 chromatin remodeling complex	0.884	569-583	GPKKDRKKEREERHK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9C8	Protein OS-9 homolog	0.819	926-946	EDKPAPETAQKKPLKEKMKRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAV1	Kelch repeats protein, putative	0.995	3-35	KKDKKSAEKKARVAAKQSKKAAQKEKKHKAKGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAV1	Kelch repeats protein, putative	0.615	383-388	PRAPGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBH1	WD repeat protein	0.998	395-409	GRRRKKRKRGKGKDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGP0	HDA1 complex subunit	0.979	452-476	KKRKENEAGIRPRRERRLYRGKRRQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPV6	Uncharacterized protein	0.867	601-642	NREGRIRNPKRTKAQIEADRAAEAAKKTDTEPPKAGSRKRKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPV6	Uncharacterized protein	0.812	471-487	PRGRGGYGGRGGRRPRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTM1	SNF2 family helicase	0.887	195-233	RMERDRLPLGQIKKREREELKLQKQREKERMEAEKRSRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTM1	SNF2 family helicase	0.673	910-914	KKKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU26	U1 small nuclear ribonucleoprotein 70 kDa	0.686	187-195	KGWKPRRFG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX98	Branchpoint-bridging protein	0.936	44-64	RSPVRAEAPVDGVKKRKKRNR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYC3	FK506-binding protein	0.679	308-313	QKKLKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3F3	DUF4210 domain-containing protein	0.926	475-489	RRKREKKSRRTQSPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6E2	CHY zinc finger domain protein	0.816	725-741	RKYKRRGGTSTNPAKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6E2	CHY zinc finger domain protein	0.633	628-631	RKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4L1	Uncharacterized protein	0.841	18-39	KKLMRRHVMKGKNAGRKLQRAS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I546	Ubiquitin	0.995	73-99	LRGGAKKRKKKVYTTPKKIKHKRKKTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8M6	Two-component sensor protein histidine protein kinase	0.804	465-475	PEAKAKEKKKW
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9T1	Autophagy-related protein 2	0.645	1769-1776	GKKLRLSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVB4	Diacylglycerol O-acyltransferase	0.998	172-224	KEKKSKKHKKSKDSKESKESKKSKKSKKSDADDKSDTETSKKKRKESKKRKHG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZL9	3'-5' exonuclease/helicase	0.917	537-553	KPGKKPDKKLDKKPDRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZL9	3'-5' exonuclease/helicase	0.719	563-581	ERKHNGAIKKDTARPDKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1J1	Uncharacterized protein	0.722	259-265	ARRKRNR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAS7	Serine/threonine protein kinase (Fragment)	0.815	57-77	RSPRPRRSVTRSRSRTRSRSP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAS7	Serine/threonine protein kinase (Fragment)	0.789	159-177	RDKRHRTRSRSPYRDVRKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAS7	Serine/threonine protein kinase (Fragment)	0.611	88-89	KR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD24	Uncharacterized protein	0.944	56-73	KKKSKSKPKTRAQRLRQE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEL2	Mitochondrial 54S ribosomal protein RML2	0.927	356-404	GRGKSKGNVDPKSPWGLPAKSGYKTRPKWRVNKAVVVPRPRNQGKRRRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEL2	Mitochondrial 54S ribosomal protein RML2	0.926	88-128	WKGRPVHKLTFPKRGQAKGGRNNTGRVTVRHRGGGHKRRIR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUV7	Stc1 domain-containing protein	0.799	248-266	PRPRPRGNRGFAKISGPRF
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5R9	Ankyrin repeat protein	0.95	543-566	GKKGKGSGKRGRAGQDHAKPEQKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5Z8	Protein SQS1	0.967	471-497	NDREKKKIKKQKREELRTQGLLGRKSG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5Z8	Protein SQS1	0.922	441-450	LRKKPKGRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5Z8	Protein SQS1	0.659	591-602	GRARAHGGGGKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5Z8	Protein SQS1	0.651	7-13	AKARARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5Z8	Protein SQS1	0.612	399-402	GRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5Z8	Protein SQS1	0.603	396-396	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I605	Histone-lysine N-methyltransferase Clr4	0.725	429-434	RKKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I640	Transcription factor RfeD, putative	0.943	164-197	RKDKIQRPRKSSITQNARKPKHERTKSKEYGRRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I669	Sodium/calcium transporter, putative	0.688	129-134	KPRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGF8	Uncharacterized protein	0.999	114-146	EKKREEQRRKDAEKTEKNRKKREKRKAGKNKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKK0	Uncharacterized protein	0.983	511-531	ESRKRTRASKDSGKRRRERRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT65	FHA domain-containing protein	0.998	10-154	DRRRRRTPSVSPDAAKERRRKDRDEEYSSTRRRDDGRSSKDDRRRRDSHSPDSKSSYRRDDRRRERRDRSRDSVDARRSRRGVSREDSHRRRHRDRGHDERDRPSKRPRSRLRSHSPAPRLRRSRSPPTHSRSASPRALKRSKGP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUH6	Flap endonuclease 1	0.997	362-395	LKRKHEEKLEEQKKRKKEEAKAKKNAKAKPRGTA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1G7	Nuclear localization protein NPL6	0.944	90-107	TSAIPRKRRLGRPPKNRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1G7	Nuclear localization protein NPL6	0.886	129-145	KRRRGRPAASGGRWARN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1I1	DUF3824 domain-containing protein	0.994	275-317	RARSHHRSKSRRRSESVDWDRGSHRRHRHRHRRRSRSRSSSHS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1I1	DUF3824 domain-containing protein	0.989	581-597	KYAKKKERKKAEKERRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1I1	DUF3824 domain-containing protein	0.972	340-367	RNKSKSRDGRGDRRSRSRHRRGSSPSEG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1I1	DUF3824 domain-containing protein	0.97	397-419	IERHRSKSRSRRGERSRSRSRIR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1I1	DUF3824 domain-containing protein	0.947	546-564	SARRRHRHKHHGSRSRSRH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1I1	DUF3824 domain-containing protein	0.899	440-462	KNKAKKENEEGRQRRSRSRSRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1I1	DUF3824 domain-containing protein	0.639	376-382	PAHRNKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8I0	NOL1/NOP2/sun domain protein, putative	0.899	354-362	GKKRKRGKQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAR5	Chromo domain-containing protein	0.972	105-116	ERKRKRRAKRIR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBN3	Cell wall biogenesis protein phosphatase Ssd1	0.809	505-514	REKEEKKKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCP0	RNA helicase	0.891	14-21	KKRKRKHK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCP0	RNA helicase	0.81	571-588	GRRAYGSQPKGARFKRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDV3	DUF2263 domain-containing protein	0.748	76-82	LPKRKRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWQ1	Uncharacterized protein	0.932	354-372	PPSLGKKKPPLPPPPKKPG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I169	DUF2786 domain-containing protein	0.997	16-75	ARLARQEARLRHKKLRALKRRLERKRSHIDSFSKRTKKHQDPRPAPGRKPAKEKPPRTPA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I169	DUF2786 domain-containing protein	0.732	266-284	KKSEKAAARKAELARLAGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4W2	Plus3 domain-containing protein	0.966	33-68	PPRPSSSSPQRSPEPAPAMARKGTAKPVKRSRKARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4W2	Plus3 domain-containing protein	0.909	212-239	KRQREQKGKRDELRRRDAATRKTDRRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4W2	Plus3 domain-containing protein	0.874	164-178	EEARAQAKKNKRKAS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCU2	Uncharacterized protein	0.709	563-570	KGLRRGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCU2	Uncharacterized protein	0.622	226-228	RKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FFP2	Vacuolar import and degradation protein 21	0.835	596-610	RSRLKDRKAREKERS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FFX6	Rho GTPase activator Rga	0.828	135-148	RRRKKKTTQQAKRN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP04	Fungal specific transcription factor domain protein	0.78	724-731	HTKRKRKV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ32	ABC multidrug transporter	0.795	510-519	PKKRNRKVKQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ34	Uncharacterized protein	0.918	370-384	GKDKSRKKPSKPVRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRX6	Uncharacterized protein	0.748	1421-1429	RKKNGRRKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRX6	Uncharacterized protein	0.724	818-833	GGAAKGLLAKGKSKFR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSR9	Uncharacterized protein	0.696	64-71	VRRKSGRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUG0	Proteasome regulatory particle subunit (RpnE), putative	0.913	199-224	RKISKRYFARKPKKSPEQLEKEKKEA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUK8	Uncharacterized protein	0.9	41-60	RRFIRRHVMRGKNRKRIAPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVB5	HEAT repeat protein (DRIM), putative	0.999	2569-2619	KERREGRRVKRRIEAVADPEKVGREKKRRNERKREKRKEKGLEFRGKRRGW
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX69	Uncharacterized protein	0.912	841-860	HEHLKSGKANRKDRQSRHRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0M6	Ubiquitin carboxyl-terminal hydrolase	0.676	588-592	RRKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G156	Mitochondrial import inner membrane translocase subunit TIM54	0.636	150-154	RKFRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G495	Glutamate decarboxylase	0.601	169-169	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4A9	Nucleolar GTP-binding protein 2	0.654	499-502	RKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDF1	Spastin	0.87	930-937	RKGRRKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDU0	Uncharacterized protein	0.996	195-221	PKKKQRKNNKRRVNHRDRAKRKEKRIA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GE94	C6 transcription factor, putative	0.85	245-268	GRAVVKPAPPGQGPKAPKAAQKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GE94	C6 transcription factor, putative	0.613	163-166	KERK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GFA0	Uncharacterized protein	0.68	899-912	RRRHGHGHGHHHRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HY57	Calcium permease family membrane transporter	0.721	150-162	RPLRKKSSTIRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HY57	Calcium permease family membrane transporter	0.675	102-114	KPAVLRRMSSKKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HY57	Calcium permease family membrane transporter	0.612	394-399	RRGEHR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F733	HhH-GPD family base excision DNA repair protein	0.988	427-450	KRTGKRKGARESAPKAKKSKARGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F733	HhH-GPD family base excision DNA repair protein	0.871	38-46	VLPKKKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBF5	Uncharacterized protein	0.637	289-294	RLKRER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCA2	Probable E3 ubiquitin ligase complex SCF subunit sconB	0.641	573-576	KRRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDK1	Putative transferase CAF17, mitochondrial	0.858	650-704	KNHSKKTNGTPRKGAKDRLSSPITILPRPSSAKKESPVRAERSSQSPRRRSPAKT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDK1	Putative transferase CAF17, mitochondrial	0.708	962-970	KKHKLRSKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FF37	Serine/threonin protein kinase, putative	0.814	526-538	SKSKRRSSDKKRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM58	Potassium/sodium efflux P-type ATPase, fungal-type, putative	0.685	248-258	RKPNRSLSRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FS68	Uncharacterized protein	0.962	75-120	ARREQRRARRKAEEEEQKRIREAYGANAGESHRRRHRHRRPQPSPP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYR2	PX domain protein	0.969	899-914	RKRRAKKRDHLRRAAG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5S8	Alpha-1,3-glucan synthase	0.957	1698-1721	RKLSLGRRAGPGQGRKRLSKKPPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5Y5	DnaJ and TPR domain protein	0.644	423-436	KLTKEHHPDKAKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7J2	Uncharacterized protein	0.952	52-76	EKRKKKHSWRWQTRARLGSKARRNG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEY3	Uncharacterized protein	0.996	22-48	KKARDATQKKNPPKKQSPRKRRKQKTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGX1	NUC153 domain-containing protein	0.988	611-625	EKQARKKGKKRKGAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGX1	NUC153 domain-containing protein	0.981	501-519	ARKERERKQRRKEKLKASK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGX1	NUC153 domain-containing protein	0.891	561-572	QRKEERRKKREQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGX1	NUC153 domain-containing protein	0.867	691-710	RGGSRESSKKQKRPSKNEGG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGX1	NUC153 domain-containing protein	0.849	5-19	GKKKSKGSGGGKAGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGX1	NUC153 domain-containing protein	0.714	676-681	RKRRRN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGX1	NUC153 domain-containing protein	0.609	715-716	KK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGX1	NUC153 domain-containing protein	0.602	720-720	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HS10	Oxysterol binding protein	0.86	218-226	HKRRRKRHQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBH8	DNA mismatch repair protein	0.954	195-209	KPSKKRKRPSMPAKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBH8	DNA mismatch repair protein	0.789	145-159	ARKASVRGKTTKRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC99	Lysophospholipase	0.802	819-830	RKKRDRLRREMK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEY3	AB hydrolase-1 domain-containing protein	0.853	380-391	KGTGKKKVKKVR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJT5	Uncharacterized protein	0.695	455-460	RRRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJT5	Uncharacterized protein	0.651	506-509	PKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM23	BZIP domain-containing protein	0.896	1511-1533	KRRRTATAGPSSREKERARRKAA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM23	BZIP domain-containing protein	0.824	299-334	PAAKGKGKKNTSTKATNSSTRRKAEDSPANKGSNKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM23	BZIP domain-containing protein	0.736	756-768	RKAKEAKDRMKEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNB3	Nudix hydrolase domain-containing protein	0.755	451-459	LKRRLRGRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNB3	Nudix hydrolase domain-containing protein	0.637	690-693	RRRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNN0	Uncharacterized protein	0.993	153-203	RKKKRKEKKRMERDQKQLEKDQKQFAKRIKQLEEAQERREGRSSSRRLIKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSR4	Uncharacterized protein	0.987	174-297	KRDERERIRQEELRKQKELEEEKAKIKAEEQRRQREIQRRKEEEEAAKEKEREEQRRAERERLREERRRLDEEREKEREERYERRRREEQDRYRDRDRGRDRDRSRVYDRGVDRSPRQRDSRKT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSR4	Uncharacterized protein	0.965	374-402	RERSASHHPERPRDRKSSRSRSRIRRPSG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUE4	CBS/PB1 domain-containing protein	0.921	74-99	IRKKMEADLNKKRHHPTKARHTRKAP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZQ8	RNA exonuclease 4	0.999	299-314	SPAKKKRKPKKKSRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZQ8	RNA exonuclease 4	0.856	41-65	VKRRRTESVSGKKIEGQRRTLKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6N8	Uncharacterized protein	0.966	341-375	PRSKRAAPAKRTKANEQKKRAPSPPSTTVRRSTRT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7B5	tRNA-splicing endonuclease, putative	0.988	2131-2162	PRPPQRPGNGIRPPPPPRRKKEVDPFIRPKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7B5	tRNA-splicing endonuclease, putative	0.981	923-980	QKKAEKAKAAAAVPAIPKPLKAPAKPLVNVESFREKREKEKEAKKRRDMAELARLKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7B5	tRNA-splicing endonuclease, putative	0.971	2032-2073	PTKRKRTDSPPKDAPKGSKSRKSDQAPAPAPAPAPAKGARKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7B5	tRNA-splicing endonuclease, putative	0.899	1049-1070	SRKKLLKQRAPVKKIKQVRSAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA50	Uncharacterized protein	0.999	46-76	AAKLREREKRLREKKKRKVEREAKAREERKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDI5	Uncharacterized protein	0.676	401-409	KVGRPKGSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDI5	Uncharacterized protein	0.655	461-468	KSRGRPNR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GF90	WD_REPEATS_REGION domain-containing protein	0.895	7-33	RSRAPERPRERLNTMGHERAKKRRLSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HST9	Uncharacterized protein	0.889	22-39	WKRNGARLRPPLKTKKKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0K4	Uncharacterized protein	0.756	907-917	REKKKSGWKLK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I190	SnRNP assembly factor	0.934	592-607	RRKLPGTKKKGKVAAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FA20	Uncharacterized protein	0.664	452-456	RARKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCI0	PHD finger domain protein	0.929	212-229	QRRRVTNGAKGSKKRRRN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCI0	PHD finger domain protein	0.789	300-309	KKRRRVYRKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FID9	NIF domain protein	0.998	637-658	AEQQAKQKPAKKKNKKKKKNAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FID9	NIF domain protein	0.997	598-631	QRKKARKEERKAAASLRKRERKAAAKAAKKAEEQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FID9	NIF domain protein	0.678	27-33	GKRQKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPX1	tRNA-dihydrouridine synthase 3	0.943	367-380	PPKKKQKRQKIKRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ63	Uncharacterized protein	0.903	694-711	SKPRREKGTRHASRRPPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ63	Uncharacterized protein	0.788	396-408	HSAKRRKISHGGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ63	Uncharacterized protein	0.778	554-580	KHKERQRKQELSRKLENAKGVARKITK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ63	Uncharacterized protein	0.744	737-753	RQARSRRDQGRRSPTRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ63	Uncharacterized protein	0.721	963-975	RPHVRPQARKRQP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVS8	C6 transcription factor, putative	0.752	108-115	RAPRKPKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ11	Spc7 domain-containing protein	0.805	177-197	KERRERERKAILEQREARRKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G515	Protein kinase (NpkA), putative	0.973	23-40	RKREKEEKKRAKAEKQRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G515	Protein kinase (NpkA), putative	0.836	433-447	KAGMERRRKRETPEA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC64	Uncharacterized protein	0.625	22-25	PKKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEL4	TPR domain protein	0.606	10-10	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGY2	Pre-rRNA-processing protein IPI1	0.938	6-28	KKKNEKKKDFQKTKLKVGKARPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXM4	Uncharacterized protein	0.873	311-333	ERQLKERERRDEPRRQRSQRKNR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0P8	BTB domain and ankyrin repeat protein	0.973	1522-1547	RENRGKGGRARGSSNRRGRGKGPAPA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0P8	BTB domain and ankyrin repeat protein	0.929	1578-1607	PNGKQKDPAAGSNAHRGGRGGNRGRGKARA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0P8	BTB domain and ankyrin repeat protein	0.692	645-651	KKEKRAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBU4	Uncharacterized protein	0.998	729-761	APRKPATARKAAPKGRKAPKAATKKTAGKKSPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBU4	Uncharacterized protein	0.716	676-681	GKKRRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM35	MFS multidrug transporter	0.783	352-357	KRRRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMP2	Kinase	0.639	1120-1122	KKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPQ3	Translation elongation factor eEF-3, putative	0.995	1033-1057	KKQKKLSSAELRKKKKERMARRKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQL9	Serine carboxypeptidase	0.937	594-606	GKKKKLQKRRFKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT52	Signal transducer	0.978	290-312	PEKEEKEPKRKKKSEDKEKPDEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT52	Signal transducer	0.911	112-134	DRLAKKRKAHESLKLAAIRKRVK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT52	Signal transducer	0.806	202-211	AKRKEKHKPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT52	Signal transducer	0.731	145-151	SRPKKKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT72	Uncharacterized protein	0.992	325-362	RARKETEREREERRARKNERDRLKEERKKKIQELRGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUU2	Protoheme IX farnesyltransferase, mitochondrial	0.704	123-128	RRRKRL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2M1	JmjC domain-containing histone demethylation protein 1	0.772	1410-1425	RSKPRGSNSAKRARPG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6P7	Uncharacterized protein	0.997	116-193	PRPRKDGSNRTKNGRDENGRRKRRPKPSAFAKEMEIAEKRRQEAEARRKEREARQKEREAMMRAKKPDQFGKRRLGRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6P7	Uncharacterized protein	0.77	21-28	PPAKKKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HX69	MFS transporter, putative	0.895	552-572	RFERLQEKEKKKEEKRNEREA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HX69	MFS transporter, putative	0.656	291-296	RKERKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I210	Ulp1 protease, putative	0.968	861-876	GAEKGKKQKKKPARSL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I210	Ulp1 protease, putative	0.922	1160-1173	SRDKKGKGKSEKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I210	Ulp1 protease, putative	0.826	331-344	KKQGKAKRNGRDKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I210	Ulp1 protease, putative	0.663	601-608	KPRKWAKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I210	Ulp1 protease, putative	0.601	616-616	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F947	Cytochrome b561 domain-containing protein	0.952	613-629	REARRRDRERRGSRRRH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F947	Cytochrome b561 domain-containing protein	0.921	565-578	HRPRRRRSTSRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F947	Cytochrome b561 domain-containing protein	0.654	735-739	RRRRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G002	DUF1752 domain-containing protein	0.662	204-210	PKQGRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0Y9	HMG box domain-containing protein	0.978	135-156	DKPRVNRPPRARRRAKQAKPDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5Z6	80 kD MCM3-associated protein	0.857	48-67	TKPRGRGRGAGATAKSGRGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G627	Mitochondrial Rho GTPase	0.979	408-420	TRPRKRRKRPGRV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G648	Uncharacterized protein	0.767	32-43	PRRRGLPEKRKI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9D5	RNA helicase	0.961	134-158	KESKKTKKEKQEKQDKKEKTQKKDK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9D5	RNA helicase	0.958	686-705	GKGKGRGRGGGRHEREKKAG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9D5	RNA helicase	0.703	4-19	KRDRDSKGQGAPAKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAQ7	Uncharacterized protein	0.978	68-87	PRNPRPKKAPSKKPAKGGSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTC0	Small nucleolar ribonucleoprotein complex subunit Utp14, putative	0.99	436-471	LRKHRELLFREEVRAKRIKKIKSKSYRRVHRKEREK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTC0	Small nucleolar ribonucleoprotein complex subunit Utp14, putative	0.966	14-28	DDGPRKAKPRRKAGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTC0	Small nucleolar ribonucleoprotein complex subunit Utp14, putative	0.854	495-517	NDRKRAEARMGAKHRESKWAKGL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTC0	Small nucleolar ribonucleoprotein complex subunit Utp14, putative	0.836	658-667	KADKPKRKKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTC0	Small nucleolar ribonucleoprotein complex subunit Utp14, putative	0.812	143-156	KSKSKRPSGGKKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1N8	Uncharacterized protein	0.844	10-21	YKKHRREKGRIA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I673	PAPA-1-like conserved region protein	0.852	331-344	NRLLKKQAPKRRGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I673	PAPA-1-like conserved region protein	0.77	310-322	MARRRKNLSEKRN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC30	Chromosome segregation protein (Pcs1), putative	0.952	80-96	ARAKPAAKGRPRAKKAP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC30	Chromosome segregation protein (Pcs1), putative	0.937	136-154	GRGKKTGRPAGTRGRKKTV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC30	Chromosome segregation protein (Pcs1), putative	0.831	42-67	VKKQRGRPRSSGHGTTETKKGPTKHR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCG8	Ubiquitin-like modifier HUB1	0.991	4-36	RRRSRSPRRGPEGDRERPRKSHGGFRWKEKRRD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCG8	Ubiquitin-like modifier HUB1	0.965	91-115	RDRPSNQERGQDRDRKREKKEKKPA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCG8	Ubiquitin-like modifier HUB1	0.807	65-86	DDGRPGDRRRDGDRDRFRRRDN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCG8	Ubiquitin-like modifier HUB1	0.604	62-62	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHG0	Uncharacterized protein	0.994	271-287	GKKNKKGKKDKKKQRGP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNP6	DnaJ domain protein	0.974	630-656	RPRERKRRRLALAKRQRQLEKQIAKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP95	Nuclear protein export protein Yrb2	0.652	196-200	RRKRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPU9	RNA binding protein, putative	0.969	158-224	GSRRRRRGGGGGRVRRSDVSKPPPDHIDRYVPGQRSPERRNGSGRRPGQRREERNDSSNRRTANGRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPU9	RNA binding protein, putative	0.624	17-21	GPRPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUI4	Uncharacterized protein	0.956	362-383	APARPDAHRRRKRASLKLTRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW98	Endoplasmic reticulum DnaJ domain protein Erj5	0.85	382-393	ATRKRGKRSNRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW98	Endoplasmic reticulum DnaJ domain protein Erj5	0.837	65-97	RKKSRMLHPDKVKRAFIANSSKDKAKAKGSSKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW98	Endoplasmic reticulum DnaJ domain protein Erj5	0.802	236-254	RQKRMMDKENRKENKKGAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1K6	Zn(2)-C6 fungal-type domain-containing protein	0.832	12-24	PPRRRRAHTKSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4A5	Uncharacterized protein	0.965	179-203	LRRRREIEAREERRRERREARSRGD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8E3	Uncharacterized protein	0.794	509-530	SPPGSGRESRDDRRERHKNLKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HR12	Phosphotransferase	0.77	140-149	RKARRQRVKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I387	Sec2p domain-containing protein	0.816	231-245	RRDGEKRKRLDRLEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP69	RNA polymerase II subunit B1 CTD phosphatase RPAP2 homolog	0.765	32-48	PRPAGPRRQQKQKQPPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5P2	C6 zinc finger domain protein	0.929	85-108	KRKCSKARLAQRAGADRPAKRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6K8	PtaB protein, putative	0.735	821-833	VKPSPRIGGKRQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBG6	DNA replication ATP-dependent helicase/nuclease	0.85	1601-1635	KRSPSQKKGPRNPLSPVQPRQAPKGVKIPEKRGAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBG6	DNA replication ATP-dependent helicase/nuclease	0.687	141-146	RGKKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC90	SNF2 family helicase/ATPase, putative	0.93	454-467	ARKGKSGKGRKNKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC90	SNF2 family helicase/ATPase, putative	0.78	336-348	KPRRRLIRGPKNR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGS0	cAMP-dependent protein kinase pathway protein (Som1), putative	0.978	632-651	KPAPKGKKDTKDSRKRPKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAL4	Uncharacterized protein	0.848	292-301	GRRRRGPRRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FD21	Mitochondrial hypoxia responsive domain protein	0.796	241-260	KNEKKDEKEDKEEKKEEKKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FFQ8	Amino acid transporter	0.956	338-349	PGKKKRKHKERG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG21	5'-3' exoribonuclease	0.981	410-456	RRRRQTEERRHRNQQRRKEEDRMRNDERARKRRRSSPTYDSPGKSRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN96	Structure-specific endonuclease subunit SLX4	0.986	98-142	LKEKPKKKTKRVTHGKDKTSGETTEKARKPAEPKKRQKRDTNKQQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN96	Structure-specific endonuclease subunit SLX4	0.981	639-678	SRPAKPSKAGSAGSRSKGSKRTVERKRDQAPKPASKRQNK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN96	Structure-specific endonuclease subunit SLX4	0.794	309-315	KKPRKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPL6	ASXH domain-containing protein	0.977	53-68	SPAKRPKRNPKRGAKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ60	Uncharacterized protein	0.833	85-99	RAKKTRAIRRRLTKH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQC6	Hexokinase family protein	0.746	1479-1492	GKRAKAARSPSPTP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQC6	Hexokinase family protein	0.68	1561-1566	KRRRMR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU76	Peptidyl-tRNA hydrolase domain protein	0.843	179-196	ARIKMKKHLSNKKSSRRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5J9	Telomere_reg-2 domain-containing protein	0.686	808-818	KRRRQREEQRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G702	Ribosome biogenesis protein Kri1	0.994	594-606	GGSKKKRKRSKKH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G702	Ribosome biogenesis protein Kri1	0.989	302-349	RREEKSSRKKRREAEQQKREEEKKQREAEKNRLRKLKMEELEEKVKKI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G702	Ribosome biogenesis protein Kri1	0.958	533-557	PFRDPEKKQRDQKKLGKKARVKQWR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G702	Ribosome biogenesis protein Kri1	0.946	405-413	HKKKRKPKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G702	Ribosome biogenesis protein Kri1	0.932	451-468	KSKGQERREKKREARKEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G956	Origin recognition complex subunit 2, putative	0.979	169-185	TPKRGRGRPKGAKNKRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCU0	Fibronectin type III domain protein	0.696	321-326	AERKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GH23	Uncharacterized protein	0.949	996-1029	PKAKEGKTSQASGWRGLKRASKAQPRASRSRRRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GH23	Uncharacterized protein	0.906	86-128	KKGLLSKSRKIWKTVLKRVVKLRNPKYVKKFKHTWGKDESRGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GH23	Uncharacterized protein	0.894	154-166	VRRKGKRVRHVKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GH23	Uncharacterized protein	0.675	814-822	PRSKRSPAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HSK7	Uncharacterized protein	0.642	582-587	KKQKQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2S8	Uncharacterized protein	0.796	52-74	RKTRQRSRSSKGLRSNAHRSRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGX1	Phospholipid metabolism enzyme regulator, putative	0.922	353-364	RPKKEKKRQSRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGX1	Phospholipid metabolism enzyme regulator, putative	0.618	867-870	RSRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FV34	Nucleolar GTP-binding protein 1	0.894	1067-1096	EKRALIRNEAKQRKSLKNRAVIPRSAKAKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FV96	RED_N domain-containing protein	0.994	521-536	GGNKRKRGPKKRKGNK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FV96	RED_N domain-containing protein	0.653	218-222	KVKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVA4	Uncharacterized protein	0.855	380-394	KLKKRHARRMEKFKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVR0	Uncharacterized protein	0.697	156-167	RPSFRSREPRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZQ9	Homogentisate 1,2-dioxygenase	0.656	445-452	RHFKNPKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0Q5	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.983	552-592	RDERKRSKSRSRSRSRSIEAPRGPAAQGRGGHAHRPRPFRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0Q5	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.761	382-388	KKPRKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0Q5	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.652	776-782	KKRSERK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G549	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43	0.904	751-767	ERLARKEKMRADPGKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G549	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43	0.614	369-373	RPGGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5M5	Uncharacterized protein	0.996	273-311	RDRHQSAARRHHRRRERREGERPRAHRSSRQSSPRKRER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5M5	Uncharacterized protein	0.958	159-182	KPRKKRNFKETAKQKLLRRRKEEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G669	FF domain protein	0.894	498-523	KKKVEREKREKALAEREKRVEEEKIR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G669	FF domain protein	0.713	107-118	RRRREPEDRPKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8D9	mRNA splicing factor RNA helicase (Cdc28), putative	0.985	118-168	RERRRRRDKEKDRGRTADEDEGWSRREKQDARKRDRSREGDRHRSRKLRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8D9	mRNA splicing factor RNA helicase (Cdc28), putative	0.88	77-88	EKERKPKAKKDD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G967	Ubiquitin C-terminal hydrolase family protein	0.875	755-773	WGRAKDRDKAKGRQKDRDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAC3	Uncharacterized protein	0.994	50-77	KRGKGSRRGEEQRKKKRESSREKGNRGG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB50	Chloride channel protein	0.82	74-84	RRRAKRKEGSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GFW8	Histone H2B	0.989	4-49	KAAEKKPSTGGKAPAAGKAPAEKKEAGKKTATAASGDKKKRGKTRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HT43	rRNA maturation protein (Nop14), putative	0.853	885-901	KESKAYERERKLRQGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HT43	rRNA maturation protein (Nop14), putative	0.843	832-874	KAEYKREKKGAMRELRKDANFIAREQLREKKERDAAYEKKYRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYQ7	Uncharacterized protein	0.999	14-43	GKLKLKGLKVKDGRVEKKKKKKEKKEHAER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYQ7	Uncharacterized protein	0.679	88-98	RRKRLNDRLKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5N7	Uncharacterized protein	0.837	241-254	RRRKAGASRVSKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5N7	Uncharacterized protein	0.779	359-383	PRRELPFKRTRAKDQNKSPPAEKPP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I602	Condensin complex subunit 1	0.694	183-190	ARKGPKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDH8	40S ribosomal protein S23	0.819	4-21	GKPRGLNAARKLRNHRRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDH8	40S ribosomal protein S23	0.702	180-187	KEKKEKPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJN8	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.955	488-521	HPGRGGRGGRGRGGFDRGSGRGRGGRGGSWDSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJN8	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.953	414-439	KRKLKQKKKDKKNVNNDASGSGRARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPX8	Peptidase family M20/M25/M40 protein	0.783	206-219	RRKEDKDRKHSRKV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW04	Ribosomal RNA-processing protein 8	0.961	381-409	FGKVTRKKAQIGAKKPLSKTQQKKQKKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW04	Ribosomal RNA-processing protein 8	0.939	75-91	AGKGNTKKDKKKGKMPG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW04	Ribosomal RNA-processing protein 8	0.877	43-51	QKAKKRKRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FW04	Ribosomal RNA-processing protein 8	0.843	140-148	KNKRRKKNK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZQ4	Heterochromatin protein, putative	0.931	96-129	GRPEKPTVGRKRKSLNEAKATPEKTTQKKPRKSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G037	Uncharacterized protein	0.854	171-188	RRRHRSYPRPRRLPARAI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G360	Transcription initiation factor TFIID subunit 13	0.985	264-296	GKKAKGKGKRGARRDSDATEGTASKKRKVGKGE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G360	Transcription initiation factor TFIID subunit 13	0.85	102-132	LKKPGDWRTRQKEERRRTNMAEPRARAARHK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G407	Chromatin remodeling complex subunit (Chd3), putative	0.936	261-278	LRKRKRHSPVVRRSKRQR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G407	Chromatin remodeling complex subunit (Chd3), putative	0.667	1370-1378	GKKIQKARP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4Q4	AB hydrolase-1 domain-containing protein	0.781	712-719	SPRRSKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4Q4	AB hydrolase-1 domain-containing protein	0.723	324-329	KKRRPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6N4	Uncharacterized protein	0.998	443-477	KDRKERKRLAEKRRLLEKAKMKGRKGKKATKNAAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB69	RNA helicase-like splicing factor (HRH1), putative	0.854	183-195	GRRRKDRHRSRSI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEU9	Uncharacterized protein	0.732	203-212	KEKTKRRQRH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1Q0	rRNA processing protein (Ebp2), putative	0.996	348-374	SKKMKAGGKKAGGSKRLGKSRRKAGRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1Q0	rRNA processing protein (Ebp2), putative	0.987	23-43	RQKKLVKAAEKKKSKKEKKDE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1Q0	rRNA processing protein (Ebp2), putative	0.986	302-334	GKDKKRSGGGPNLKRQKKNEKFGFGGKKRHHKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1Q0	rRNA processing protein (Ebp2), putative	0.82	233-279	TKKAAAEARRQRDLKKFGKQVQIAKLQQRQKEKRETLEKINSLKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4M2	Uncharacterized protein	0.917	8-24	KKRKRASDRHERPSKKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I628	Peptidyl-prolyl cis-trans isomerase, putative	0.866	44-50	PKKKRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7C2	rRNA biogenesis protein RRP5, putative	0.961	124-136	KKKSRKSKTKGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7C2	rRNA biogenesis protein RRP5, putative	0.869	15-46	AARQPQKRARVGEEEQKRDHKKPSTKASDKRT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7C2	rRNA biogenesis protein RRP5, putative	0.867	1505-1512	KKKRKNRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FA31	Zn(2)-C6 fungal-type domain-containing protein	0.892	12-30	RKGKQDSSSATAPRKRRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBU0	Ribosome biogenesis protein Noc4, putative	0.954	9-29	AGSKKRKKGTKEKETAVPSSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG66	Nitrogen permease regulator 3	0.982	205-215	RKQKRKKKKPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKR5	RING-type domain-containing protein	0.779	85-94	RPHRRRREKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLQ6	C6 finger domain protein, putative	0.921	48-67	RKAKEAKPPRVAPRLSKKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNS9	DNA helicase	0.985	1488-1557	RAPSRGSPATSMRGRQRTTAKGTAKRTWRKKTADSGTKRKASGPRTSGPKGGKSSTSYAKKGASKGTSKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNS9	DNA helicase	0.782	208-214	KRGKKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNS9	DNA helicase	0.755	259-280	RKRTLLKKQSQSPKKVPAKTNA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNS9	DNA helicase	0.724	336-342	PKSKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNS9	DNA helicase	0.692	1317-1325	GKPARRERR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNS9	DNA helicase	0.657	1251-1256	GKAKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUC0	Zn(II)2Cys6 transcription factor	0.768	44-61	SRRRGPPNRHAEALKKQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVN3	ATP-binding cassette transporter	0.9	1424-1433	WKKKRALKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1F8	Brix domain-containing protein	0.973	372-400	HKKTKEKEQRKKEQKENVERKKAEKAKAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1F8	Brix domain-containing protein	0.679	4-9	RRVKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1F8	Brix domain-containing protein	0.673	242-248	RHKDKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1G5	Ribonuclease P protein subunit	0.959	47-76	RNRRRLQRLRKKEYFLRKQKPKPLSAREKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G491	37S ribosomal protein Rsm22	0.732	826-835	WKKHADKKKV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5G7	C6 transcription factor	0.811	38-48	PARKRGPKSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBY0	Urb2 domain-containing protein	0.914	159-166	KKGKKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYZ1	Ribosome biogenesis protein NOP53	0.994	279-311	KKRPERKTQSQRNKIKRRKEAERKAKWEEQMKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYZ1	Ribosome biogenesis protein NOP53	0.774	410-417	QPKKAKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYZ1	Ribosome biogenesis protein NOP53	0.71	16-22	RKGKKAW
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8B4	Phospholipase	0.982	193-207	RTRLGRKKKKSKRPP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8B4	Phospholipase	0.904	520-536	KGKKKSRRSSIGGLRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8B4	Phospholipase	0.722	1691-1696	RRRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDV6	ATP dependent RNA helicase (Dob1), putative	0.969	381-398	AKRKGKGKDKKLNKGGTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDV6	ATP dependent RNA helicase (Dob1), putative	0.93	23-35	KPRPKKDKAKKRQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FE83	Uncharacterized protein	0.995	179-203	SKKKKKEAAKKEKEAAKKEKEASKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FE83	Uncharacterized protein	0.988	3-26	KKGGKKGKGGKGKSGGSGGGAAKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FE83	Uncharacterized protein	0.898	681-702	LEKRKKGGLFGWLKRKVKGDKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEZ4	LDB19 domain-containing protein	0.846	81-101	SKDKRRSLGRSSRSKERSAHK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIG3	Uncharacterized protein	0.735	426-441	RRVRQALNVKAPKKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FII4	Peptidyl-tRNA hydrolase domain protein	0.997	112-135	AAIKAERERKKKASKMKKSRRKYR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIQ9	Ras-related protein RSR1	0.989	187-209	RKREGPNRHDRKRERKRDSKRKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJ31	Ubiquitin carboxyl-terminal hydrolase	0.868	181-190	RIPRRRRKGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ78	Casein kinase, putative	0.894	64-74	KPVKKKKIKRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ61	Carnitine acetyl transferase	0.85	781-796	RERSEKPARRRPVGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G101	Uncharacterized protein	0.927	145-163	KRRRSKTNKRGQQKKTKTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2D4	RNA-binding La domain protein	0.995	676-728	RIKPNRQGGSRNHGRDNRDWKERRAEDQKRGFRGGRGGRGGRGGRGRGNGRDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4J0	Transcription elongation factor 1 homolog	0.826	3-17	KRKKSSRQPQGPKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9F8	Palmitoyltransferase	0.693	529-540	REAGRPPPRVRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC66	Uncharacterized protein	0.815	310-334	PKQKRRTSSKDRSSAHASPPKKSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQZ3	tRNA-binding domain-containing protein	0.992	338-357	QKKEKKEKKEKKEKQPKAAP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQZ3	tRNA-binding domain-containing protein	0.915	280-294	KEEKERKKKEKEAAA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRD9	AAA domain-containing protein	0.958	20-47	DQKKDKPKYEPPPQPTTRIGRKKRKAAG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HSR4	Methionyl-tRNA synthetase	0.993	616-644	KLKALEAEKAAAKKAAKEREKEKKRLKKQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I427	Integral membrane protein, putative	0.775	480-502	GVSRPRSRTRSTSRHSSKRGLRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FB17	Serine/threonine-protein kinase TOR	0.86	2889-2904	KRKARRASLQKKPDAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FB69	Asparagine-linked glycosylation protein 10	0.97	457-476	KPVEREKKDTKKKGKASRKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC76	Steroid alpha reductase family protein	0.78	287-303	GKERRYRKEFGGKYKAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FD96	CorA family metal ion transporter	0.948	634-647	SRKQRKRISAKKKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEV7	Uncharacterized protein	0.713	55-67	KGKKFQPRWSRRI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK27	Ribonuclease P	0.872	200-208	LKKRKRRTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK84	RNA binding protein	0.996	116-132	KKDKKKNKKKEKKEKQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK84	RNA binding protein	0.993	34-54	EARKKLKREEKQKKKESKRKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK84	RNA binding protein	0.962	75-88	QSKKEKKEKKKAEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK84	RNA binding protein	0.894	255-289	GKSENRKAKLKQKNQKLDEERKRALQEQKKQPSKD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSY8	Importin subunit alpha	0.611	38-41	KQKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXM5	SPX domain protein	0.775	143-153	AKKHDRKRGTR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G227	AIF-like mitochondrial oxidoreductase (Nfrl), putative	0.99	432-466	PKKEKSLPRRLKKKRPMLPNPAAPQPAPGPRRPAH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2C3	SAP domain protein, putative	0.984	220-264	KSRKRGRGDNEQGGRGGKRRDFNGRNRNRRDRRGNGGGNGGNRKN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4H7	N2,N2-dimethylguanosine tRNA methyltransferase	0.968	85-109	KKEKLEKKKQRIAQNGFAKGKKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5E0	PHD finger domain protein, putative	0.967	9-46	PTPRAARPRSKAPFKGGRPSDPERSEGPPLKKRKYIPG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5E0	PHD finger domain protein, putative	0.763	204-213	KRGRGRPPRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5E0	PHD finger domain protein, putative	0.656	1154-1159	RRRWRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5E0	PHD finger domain protein, putative	0.614	880-882	RKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7D5	Nucleolar protein 58	0.999	456-491	AEKKEKKDKKEKKDKKEKKEKKDKEEKKDKKKSRKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7D5	Nucleolar protein 58	0.965	500-519	DKKKRKRDSEVGSSKKKSKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7D5	Nucleolar protein 58	0.642	88-91	GKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB08	Uncharacterized protein	0.978	469-483	AKPRPQKGRPRKKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB08	Uncharacterized protein	0.975	356-373	PKKGRRGRKPGRSSATRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB08	Uncharacterized protein	0.966	199-214	GKKGKASKAKKPRASK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB08	Uncharacterized protein	0.956	293-304	PKQKRGRKGKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB08	Uncharacterized protein	0.929	533-552	KPVSKKATKKKTALKTKKST
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB08	Uncharacterized protein	0.811	253-269	RGKKSTKSKTKNSKVKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7C7	Uncharacterized protein	0.67	510-513	RKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7C7	Uncharacterized protein	0.636	146-150	KKQKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8Z6	DNA excision repair protein (Rad26L), putative	0.988	91-133	KNRKSLKRKRAIAESRKARSAGKNSIVGRRPRNNDAGPSRKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8Z6	DNA excision repair protein (Rad26L), putative	0.741	283-292	KRMRKMRRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8Z6	DNA excision repair protein (Rad26L), putative	0.713	53-61	RAPARRRIR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG27	PUM-HD domain-containing protein	0.991	14-60	HGGKRTKVKDAVKSSKSAKKGAPVAVPKSKSKNGVKSSKPEKKSKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG27	PUM-HD domain-containing protein	0.921	146-178	KAAKPNADLIARSKKLWERLRRKSHVPKDERKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJK8	Poly [ADP-ribose] polymerase	0.983	100-135	KKKKDDKKDDKASVDDKKLSKKSKKSDKEDKAPKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN72	PUM-HD domain-containing protein	0.74	1336-1346	NKRSHHRRRLK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN72	PUM-HD domain-containing protein	0.727	1368-1374	KKGKRQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPK7	Uncharacterized protein	0.985	197-251	RAKKKSPPIKKEKDGKETNGTADKAGKGPVKNGTPSPVKKTVKDKKAKAGKGVKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0D2	ATP-dependent bile acid permease	0.988	386-424	KALRRKAGASPDAPKKKENEPQKLKNKILSFGRKKKKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0S1	Histone acetyltransferase	0.986	549-564	SSRPRPKNRKRKPPKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0S1	Histone acetyltransferase	0.612	513-516	RRTR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4A6	PHD transcription factor (Rum1), putative	0.73	419-427	RRSKRLRKD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4T9	Uncharacterized protein	0.869	842-858	IRNERRSAQKRKRDASR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4T9	Uncharacterized protein	0.865	884-892	PRRRKTKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4T9	Uncharacterized protein	0.837	164-177	PRKRGRPSLRGARG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G685	Uncharacterized protein	0.736	48-61	RSKRGGYRSARKHR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G685	Uncharacterized protein	0.729	173-182	KARERRERHK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD25	Small nucleolar ribonucleoprotein complex subunit Utp15, putative	0.95	371-392	DRKKAKQEKLRGKGWEKRLRGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD25	Small nucleolar ribonucleoprotein complex subunit Utp15, putative	0.722	409-413	RKRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0I3	Suppressor protein SRP40	0.997	507-534	RSWKKRRRDAAKEKRQRENRKKGMKGRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0I3	Suppressor protein SRP40	0.994	124-160	RHVKRGWTEPASAKREKRQKGDKKRQKDDKKPKTQAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0I3	Suppressor protein SRP40	0.992	58-111	KLKKKLHGSILKGKKFKVEEARPRKRSREEEKEEEAVGKQPTPEKKKSKKRKSE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0I3	Suppressor protein SRP40	0.858	252-282	KSSKKPGQKEGVKATVKSKKGPSDTTPSKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0I3	Suppressor protein SRP40	0.828	187-196	KKEKKSKKNK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0Q1	Cytochrome b5, putative	0.652	168-173	KRRASR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8J9	MYB DNA-binding domain protein	0.849	281-292	KTRGRSRKKLRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8J9	MYB DNA-binding domain protein	0.712	215-222	RKRKEGKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FA76	SAP domain-containing protein	0.747	306-318	KKKRMTSKEGKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHQ6	Zn(II)2Cys6 transcription factor	0.625	392-395	KRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIZ7	Uncharacterized protein	0.998	222-240	GKNKAKKKGNKSKKKKKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIZ7	Uncharacterized protein	0.928	33-63	AKNKNKNNDKNKKNAGGDNGAAANKKKKSRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIZ7	Uncharacterized protein	0.81	96-103	KSKKRKRD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJE8	DUF814 domain protein	0.987	150-175	KKERKEERRLREEKKAEEKRAKKQRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJH3	AT hook motif protein	0.805	48-72	RKLKDKANGKSSGSTPNTPSKRKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRK3	RNA-directed RNA polymerase	0.974	25-51	RRPRHRGSRGRGDHRNRRMREERVRKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRK3	RNA-directed RNA polymerase	0.829	185-201	RGRREHRGRIRFKPPPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUL9	40S ribosomal protein S9	0.906	178-190	GRPGRVRRKKARA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FV18	60S ribosomal protein L4	0.994	186-208	QKSKKIRAGKGKLRGRRHRQRRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXA3	HMG box domain-containing protein	0.805	82-96	RSKRRYRWHPKKHPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXD3	Uncharacterized protein	0.993	553-603	RGRQRHSPRKMSPRHSPRRPPSPAPRALGHSPKRVSPKRLRSPAPPPRAKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXD3	Uncharacterized protein	0.933	688-719	KKRQKRKEKYWRQHCRKAAKEQMERRPVPGKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXD3	Uncharacterized protein	0.844	229-253	RRQRSSSRRASLRSRPRPSPAPAMR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXD3	Uncharacterized protein	0.797	450-463	VREKGRKVSKPIKM
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0C7	Uncharacterized protein	0.792	501-515	AKRRGEERRLRVRQR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0C7	Uncharacterized protein	0.782	199-206	RRPRKKAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0X9	Uncharacterized protein	0.777	46-60	KKGKATPGKGTPKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4Q6	RNA exonuclease, putative	0.978	562-583	MRKKKEEEEAKRAADKKRKKEE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9B2	Chromatin-remodeling ATPase INO80	0.981	1631-1655	PAPKRGRGRGPGKGTSKRAKTTKER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9B2	Chromatin-remodeling ATPase INO80	0.975	467-491	PPSRRKSGRIGTSSRPKKSKEKKQA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9B2	Chromatin-remodeling ATPase INO80	0.971	1577-1590	AKKGGKKAAPKRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9B2	Chromatin-remodeling ATPase INO80	0.962	307-330	LKKSKKRARESEISEGLKRKRRRH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9B2	Chromatin-remodeling ATPase INO80	0.948	372-430	KERKKDMQRKRRRENTVRLETQKKLEAERKANKAEDSAEKEKFLREAEKAQKKIRTTKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9B2	Chromatin-remodeling ATPase INO80	0.775	517-531	PRKESLKKEGKGARS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HY14	DUF2013 domain-containing protein	0.909	470-489	KPKIKPEPPMARRSRGRRLR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HY14	DUF2013 domain-containing protein	0.652	578-584	EPPKTRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1S3	F-box domain protein	0.677	22-28	RPKKSRQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAZ3	MFS transporter, putative	0.602	102-102	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FG41	Nop domain-containing protein	0.991	295-321	KGPRALPAPDDKPSRKRGGRRARKAKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHG4	C6 zinc finger domain protein	0.728	63-69	KRRPRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHG4	C6 zinc finger domain protein	0.634	311-316	KRVSKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIT0	ATP-dependent RNA helicase DBP10	0.999	849-932	NAAGGKRYRHRKEQAPKAADPLRHDYEKKKKKLEAAKEKQNAGSGGGASRAKNELRNNEDIRKARKLKEKRREKNARPSKKKRF
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIT0	ATP-dependent RNA helicase DBP10	0.898	348-356	KKNPKKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIT0	ATP-dependent RNA helicase DBP10	0.873	823-838	AWKKGKRIGRLPRVGE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ48	Vacuolar membrane-associated protein IML1	0.748	728-738	RRSRKQQRPRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT80	Uncharacterized protein	0.96	23-32	RPKKKRKKTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT80	Uncharacterized protein	0.677	196-205	RRAEEEKKAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUL8	BZIP transcription factor (HacA), putative	0.925	48-102	KKPVKKRKSWGQELPVPKTNLPPRKRAKTEDEKEQRRIERVLRNRAAAQTSRERK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUP0	Transcription initiation factor IIF subunit alpha	0.981	23-53	RIRRPRAADPLVRPKKRPGPRPPNAAPAPRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUP0	Transcription initiation factor IIF subunit alpha	0.946	415-437	KEKREKEARKVLGKRVRKALQRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUP0	Transcription initiation factor IIF subunit alpha	0.933	471-523	RKAEEEKNKKGKESDKNGGGSAKGGDTPSGRPKHTDALKKASGLPARKRPGSP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUP0	Transcription initiation factor IIF subunit alpha	0.781	534-542	SRKKPKSKH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZT9	Uncharacterized protein	0.982	495-525	KKPVQREREEAKKPEEKKVKRKLELIKPRLP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G708	Acetyltransferase catalytic subunit (NAT1), putative (Fragment)	0.964	597-624	RRKALKKAKKEQQRLEKAEAEKRDAKRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G844	Uncharacterized protein	0.948	272-293	GRPPGTPKSDDPNKKKRRRTAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC54	Uncharacterized protein	0.612	339-340	RR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC54	Uncharacterized protein	0.606	343-344	RK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GGQ5	Lectin C-type domain protein	0.662	632-635	RRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HR94	Mitochondrial 54S ribosomal protein IMG1	0.765	61-70	RPEKNKKKLK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HR94	Mitochondrial 54S ribosomal protein IMG1	0.638	182-185	RKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HV80	Glucan 1,3-beta-glucosidase D	0.996	84-156	AEPAPIRSSPRHERGGESSKRRERERSKAKESPATSPIKKKDRERDREGHRRRERAPDDGSPTKGGRVRERRH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HV80	Glucan 1,3-beta-glucosidase D	0.907	173-190	RGMRRQRRRERDRERERE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HV80	Glucan 1,3-beta-glucosidase D	0.898	238-252	RKEEKKQRRRERDRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HV80	Glucan 1,3-beta-glucosidase D	0.738	313-318	AKKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HV80	Glucan 1,3-beta-glucosidase D	0.685	42-49	RRQRARRH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HV80	Glucan 1,3-beta-glucosidase D	0.677	262-267	RKSRKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I0L6	C6 finger domain protein	0.726	152-162	DKKGEAEKKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2Z4	RNA 3'-terminal-phosphate cyclase (ATP)	0.666	399-404	RKRARS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F6U4	Snf1 kinase complex beta-subunit Gal83, putative	0.664	440-451	RKVKIPVKHLRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLA7	rRNA processing protein, putative	0.993	220-274	GKRKREEEEEEPQKKERGLKRAKGPNPLSVKKPKKAKEDPSTQGLKQKKDAGKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLA7	rRNA processing protein, putative	0.987	294-310	GEGAHKKRRRRHKSAKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLA7	rRNA processing protein, putative	0.662	151-154	KKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLI3	MRC1 domain-containing protein	0.765	428-440	KKDAKPRRALTKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLI3	MRC1 domain-containing protein	0.74	872-881	KAAKEKKEKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLI3	MRC1 domain-containing protein	0.731	222-240	KRKEREEKERIEAEKKAAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLI3	MRC1 domain-containing protein	0.687	270-277	RPARKASK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRI3	Histone H1	0.998	93-209	KGPSGPVKLAKKEPAAKPAAKPAAKKATAAKPAAKKATTKKTEKAEKPAKSTTKKAAAPKKAAAKPKANTAKPRKASAAAPAVVDQPKVLGKTKSGRVTKTPAKPAARKAAPKKKEA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FS67	PHD finger and BAH domain protein (Snt2), putative	0.697	1089-1099	HKKKTDREKEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FS67	PHD finger and BAH domain protein (Snt2), putative	0.641	795-799	RGKKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FS67	PHD finger and BAH domain protein (Snt2), putative	0.606	587-588	KG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUB8	Mediator of RNA polymerase II transcription subunit 19	0.891	406-418	GKKRRKKDNIPRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUH8	Anaphase promoting complex subunit 10 (APC10), putative	0.982	262-278	AKKRRRRKNMHKSKSQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUV4	mRNA-capping enzyme subunit beta	0.853	406-444	PAKRKRTRYAEPPIYARKAPGTHGRSPMLPARRPPIPKH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G092	40S ribosomal protein S12	0.99	769-841	RRMRKPDVRSPRRARDMEREKESKRAARRGSPSPVTSQRKAARSPPPNRHQESSAKEIRREKKRDGAGVQRDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G092	40S ribosomal protein S12	0.968	1090-1178	RRIKEEAKKAEEERVAQEKRLAAEAEKARIAKEEEEAKEAAEKAARLAREKAEEEERKRKEAEQRRIRQAEDERQKRLEQERIRVAKLR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G092	40S ribosomal protein S12	0.918	978-1002	ELQKKKRRVSEGPQKEKVNGAAKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G092	40S ribosomal protein S12	0.9	901-922	PKRRRLIAGRPPQDREKKKSSM
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G092	40S ribosomal protein S12	0.738	299-306	KERRARKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G092	40S ribosomal protein S12	0.626	927-935	GREEAPRPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G092	40S ribosomal protein S12	0.604	970-970	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G092	40S ribosomal protein S12	0.601	973-974	GR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G092	40S ribosomal protein S12	0.6	968-968	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G242	Pre-mRNA-splicing factor	0.719	756-761	SKKRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G383	Uncharacterized protein	1	323-377	REERRNAVRATTPPKGAQKRKAEVSKEEKFRAKKRRIKAKHERREAKKKRTGRNN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G383	Uncharacterized protein	0.848	245-252	RKKPPKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3Z6	Uncharacterized protein	0.787	66-76	AAKRNSKKRAA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G450	HNHc domain-containing protein	0.828	116-128	RKNRAEKPKRLAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G501	Rho guanyl nucleotide exchange factor, putative	0.816	1174-1180	KPRKKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5H7	Peroxisome biosynthesis protein (PAS8/Peroxin-6), putative	0.994	627-644	PPKRRRRKANRRRLRNRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5H7	Peroxisome biosynthesis protein (PAS8/Peroxin-6), putative	0.646	2020-2030	GKNSATGKGKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G604	G-patch domain-containing protein	0.929	250-264	SNGKSKEKKKEPRRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G604	G-patch domain-containing protein	0.887	298-307	KKKKKGLKAD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTT7	Uncharacterized protein	0.952	181-203	PAKGNKTPKTPTKESKRKGRPPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4E5	BRCT domain protein	0.999	97-133	KLWKRKTKKKATKAGKKGKSAKSRKGGAVKSPENFRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4E5	BRCT domain protein	0.616	86-89	RPKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I604	Sterol desaturase family	0.956	309-343	RKAIQASRKKIKERNGSSSSKVTPNKGRSRRRRDS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7J6	18S rRNA factor 2	0.988	251-294	EREAKRRIEDARARKEEKAFLAGVEKGKVVEGIRKKKEEKKKAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8Y3	Histidine kinase	0.913	73-89	RSRKPRRSRRLSKILAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAC0	Forkhead domain protein	0.971	32-71	PARQRAGQARRKKPAETEGKRQEGKAKIDEKEKQQQKQRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAC0	Forkhead domain protein	0.948	758-832	KRRGPGRPPKDGIMSKRERAEIAREQKLAAKREANGGVTPPPSNKTKVGRPRKDSDPEEAAMVKPEKRKYTKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAC0	Forkhead domain protein	0.797	864-873	PPVKKRKPSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAC0	Forkhead domain protein	0.745	974-980	KEKKRRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP72	J domain containing protein	0.927	475-489	PPKIGKAKQKRAKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP72	J domain containing protein	0.881	532-539	TAKKGRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQJ2	Protein kinase	0.604	228-229	KR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTF4	Transcription initiation factor IIE subunit beta	0.974	258-280	NKVVKARPKVEMKKTKKPRRSGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXQ9	Uncharacterized protein	0.85	603-616	KHRRRAEKRNSKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0J4	Elongator complex protein 1	0.954	1181-1199	RKTSRTRRKEERKRASGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA11	Uncharacterized protein	0.954	1083-1107	SKRSKSEDRRPRRSSSEDRGRKGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA11	Uncharacterized protein	0.651	128-145	RSRSKTWKTLTKVKERIK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GF13	NAD dependent epimerase/dehydratase, putative	0.695	451-460	ARVAHARKRL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I568	DUF2156 domain-containing protein	0.821	38-46	KKQKKRKHH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIF7	Chromosomal organization and DNA repair protein Mms21	0.844	415-423	RRRRKGGRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLX4	Uncharacterized protein	0.784	139-149	RRKPSKWKKIG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPG1	Catabolite repressor protein (CreC), putative	0.661	173-177	KRRKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRQ5	Uncharacterized protein	0.893	305-325	KILSEKSRRWWKRSRRNMGRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRQ5	Uncharacterized protein	0.801	276-288	ERFPRRGRGRLRL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU58	PDCD2_C domain protein, putative	0.602	111-112	RK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUD6	BZIP transcription factor CpcA	0.824	538-554	KRARNTEAARKSRARKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUD6	BZIP transcription factor CpcA	0.699	517-524	IRKREKPL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FV47	Uncharacterized protein	0.701	126-130	KKKKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXL6	Uncharacterized protein	0.999	333-353	KKKAKKNKGKKRKANHRNRGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXL6	Uncharacterized protein	0.996	652-667	GMAKKKHAKKKKRARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXL6	Uncharacterized protein	0.969	775-785	KKKKKKSSKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0W7	Uncharacterized protein	0.688	136-146	RKPRASGNKSA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0W7	Uncharacterized protein	0.661	150-156	PGSGKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5S9	MFS domain-containing protein	0.858	307-319	RARSRGTSRKKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G887	tRNA(Ile)-2-lysyl-cytidine synthase	0.733	408-415	WPKKKGHR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1Y9	Histone acetyltransferase	0.699	239-245	GAKKRPA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3B8	Uncharacterized protein	0.963	141-170	RRKNNKMRAVLVGKQRAKSTKKAKGTKRIK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3X6	Type 1 phosphatases regulator	0.983	149-164	PGPHKHKKSKRRKPSP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGJ8	Uncharacterized protein	0.998	84-100	APKKKNRKKKSKKKASK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHW1	Cupin domain protein	0.985	423-440	KRTGSKRKSKKSKSKSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHW1	Cupin domain protein	0.764	293-300	SKRKRAGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHW1	Cupin domain protein	0.714	626-634	KGRPRGKQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHW1	Cupin domain protein	0.67	263-274	KGAAAQRKAGAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHW1	Cupin domain protein	0.667	319-324	AKKSKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTF2	Uncharacterized protein	0.721	9-18	RKRTGGKAPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTM5	Low-temperature viability protein ltv1	0.946	443-457	KETRRKGAKAKRGKN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTM5	Low-temperature viability protein ltv1	0.78	339-344	RRKKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXN2	Zn(2)-C6 fungal-type domain-containing protein	0.983	97-113	PAPARRRQKKPRRPKDA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXU4	Uncharacterized protein	0.724	73-79	RRRSKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYE3	RNA binding protein Pym	0.974	143-166	KEKKARALRKKLRQARDLREKKDK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYE3	RNA binding protein Pym	0.941	93-106	KNAKKREAKKRAKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1A2	BZIP domain-containing protein	0.956	13-36	KPRRSRRPRPVSERRREQNRIAQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2Q0	CCAAT-box-binding transcription factor	0.991	59-99	PKKDQKKPKNATVNEGKKDKKSEQKKPAKQDSAKGKKRDRN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2Q0	CCAAT-box-binding transcription factor	0.945	937-951	GKDKARKGKKGAKGP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2Q0	CCAAT-box-binding transcription factor	0.937	581-604	KSKANQKGGKFGKGGKKHQSKNEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2Q0	CCAAT-box-binding transcription factor	0.871	1096-1107	DKSGRSKRRKLK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6K3	Uncharacterized protein	0.856	733-775	RRRRLEKEDSLGRKVGGLWRGRGPFSKKGCFGRPGREGRVRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB18	Transcription factor	0.913	61-71	PSRPRRKKARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB18	Transcription factor	0.797	967-977	AADEGSKKKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB18	Transcription factor	0.608	964-965	RA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GG58	Smr domain protein	0.987	231-243	KGKRKTKKKKGKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYH2	C6 zinc finger domain protein	0.922	81-95	PKDRRRRKSKNVAKT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I641	Flavin-containing amine oxidase, putative	0.658	282-286	KRGRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJC5	Uncharacterized protein	0.971	80-104	RGHRPKRGRPSKAEAERRRAAAQAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLS1	Urea amidohydrolase	0.997	261-331	PPRSGKRRRTGEHIKTAAKEVASPVSTKKASPEKKPKRGAAAQKKEEKETPSSRKSIGGATDNKRGKKKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLS1	Urea amidohydrolase	0.977	118-140	GAKSEAGEKKKRKRAPHDPNAPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLU0	Dihydroxy-acid dehydratase	0.926	561-579	KKRRKEWKAPELRVKKGTL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP19	Small nucleolar ribonucleoprotein complex component (Utp5), putative	0.989	827-842	PPKKSKLSKGKKGGRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP19	Small nucleolar ribonucleoprotein complex component (Utp5), putative	0.881	99-109	REQQSKKKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FP19	Small nucleolar ribonucleoprotein complex component (Utp5), putative	0.653	485-490	KKPKPN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FY53	Small nucleolar ribonucleoprotein complex subunit (SOF1), putative	0.989	389-437	RRIRRHRRLPKVVKKAGEIKKEELAALKRREENVRKHSKPGSMPRRSER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0T5	Uncharacterized protein	0.961	977-994	EAAPRKSIGKARKKRAAG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0T5	Uncharacterized protein	0.787	910-917	PRRRSRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5Z2	Sas10 domain-containing protein	0.995	591-621	NKGLAPKRNKDVRNPRVKKRKKFEQKQKKLG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5Z2	Sas10 domain-containing protein	0.717	3-12	KKRKASGRGS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5Z2	Sas10 domain-containing protein	0.664	372-382	KSKKLSRAQRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5Z2	Sas10 domain-containing protein	0.628	549-554	RKADKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8C9	Cell pattern formation-associated protein stuA	0.775	382-406	RRSVSPSKTDSPSKKSSSPRKSRQT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G977	WHIM1 domain-containing protein	0.893	316-343	EKIRLAIPRFEGSEEKRKRRDYRLARKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I087	H/ACA ribonucleoprotein complex subunit CBF5	1	444-480	KKKRKRHDGETPEERAERKRKKKEKKEKKERRKSKQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5S6	Ran exchange factor Prp20/Pim1, putative	0.963	4-33	KASKSQKRRAQSPEPPPKRVKSTVRRPRKQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC21	ER membrane protein complex subunit 6	0.83	110-122	EKKSGRRVIRRKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQH8	Chitin synthase	0.929	157-169	PSQKRRRRRLSRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRR7	Uncharacterized protein	0.892	946-961	KAHKQKNKRISRKRLS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVD5	Actin cytoskeleton-regulatory complex protein PAN1	0.987	985-1040	REKREREERLKKAEEEDAKREQERQRRLADERSPAPSPAKPAGKKPPPAPPSRKGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVD5	Actin cytoskeleton-regulatory complex protein PAN1	0.948	1114-1140	KQGKIKKQEEKRRKEAADREAKEKEAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVD5	Actin cytoskeleton-regulatory complex protein PAN1	0.801	1402-1438	PPPGAPTGAPPPPPPPPGPPGPPPPPPSGAPAAPPPP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FY88	Uncharacterized protein	0.999	228-281	ASPKSRKKPGKKRRLVLRKRAAAAEAAKLSEAEKRNKRNREKKIKRRQKAREQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8D3	Nuclear migration protein	0.701	633-642	PRSAKRPLRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDN4	Uncharacterized protein	0.955	64-148	HDDKKKIPRPCHSIRREPPTPKTPNKFTPRLVKTPVKKTPIEKTPVEKKTPKKTPASEAAKTDPKRQTRSSAAHRRQASTPSKKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDN4	Uncharacterized protein	0.924	570-590	RRRGRNRSRPSSRRGPQGTGS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDT3	Bromodomain protein	0.798	465-478	RGRKAPGKTSKKGA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQS0	WD40 domain protein	0.955	584-599	GKKQKKKWSKGKVKDK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HU56	Histone-lysine N-methyltransferase SET9	0.682	289-293	RKKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWQ9	DUF2293 domain-containing protein	0.999	292-323	EKRDGPLPSKRMKRKRRVKSSKGKAAKKVKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWX3	Uncharacterized protein	0.755	319-334	KHRKSHPQKFNKRNGE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F6W4	Glucose-methanol-choline (Gmc) oxidoreductase	0.831	512-521	RKRSSKKRKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FI26	Polynucleotide adenylyltransferase	0.72	461-472	RGGRGGGRGGRH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FI26	Polynucleotide adenylyltransferase	0.636	1046-1050	KKHKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZV4	IQ calmodulin-binding motif protein	0.829	666-674	VKKGKKKFH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G472	Sec23/Sec24 family protein	0.613	111-113	KKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC87	Uncharacterized protein	0.656	331-339	KRLKEASKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1Q8	QDE-2-interacting protein	0.834	301-313	KNRTKASKAKKRQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I277	Rho-GAP domain-containing protein	0.653	618-624	GRKGPPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9D1	mRNA splicing factor RNA helicase	0.901	843-873	AEKEREKERNDPSRRKKEIEAGTGGRSAVRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9D1	mRNA splicing factor RNA helicase	0.605	916-917	RK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCJ9	Ccr4-Not transcription complex subunit (NOT1), putative	0.687	3005-3010	PKKKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM14	C2H2 transcription factor	0.934	525-547	KTTKRGRPKKNRPDMEERHDKAA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMJ5	Uncharacterized protein	0.948	40-50	REKKNKKRKRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMQ6	Cyclophilin-60	0.78	244-253	KRSRRGGRNK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ86	Uncharacterized protein	0.922	383-395	KKSEKRLKKGKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQE4	RNA interference and gene silencing protein (Qde2), putative	0.86	766-779	SGGKGKGKGKEMKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQE4	RNA interference and gene silencing protein (Qde2), putative	0.82	577-599	KKNKKGQRVPRVKVIAGLARKTR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU71	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase	0.616	550-553	RARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVK0	Uncharacterized protein	0.826	237-273	RRGDAGPPPRPNLRHAGPPIRSAPPPPPPPPPPTPAP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVK0	Uncharacterized protein	0.787	280-295	LIARRSGKKMPSRYRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVK0	Uncharacterized protein	0.735	61-70	RPRRAAPRGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVK0	Uncharacterized protein	0.674	99-105	RKRKHAP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVW0	RING-type domain-containing protein	0.996	760-862	KERSSRREEERDSRRHDRDRDRDRDRDRDRDRDRDRARDRDRDRERERERGRDREKDRKRSRRDRSGSPADSEYSRHASRRTKRHRDDSRGGDRDRNGDKLVR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVW0	RING-type domain-containing protein	0.917	683-695	RERRRERHRKKSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVW0	RING-type domain-containing protein	0.821	644-672	SRSPSRARERSRSRSPSQQQPRSHRHRHR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVW0	RING-type domain-containing protein	0.821	875-911	REARNRERLLKEQQRREAMIAERDGKSSRRRESRPDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0U8	Mediator of RNA polymerase II transcription subunit 20	0.82	287-300	QHRRRRAGENSKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G609	T5orf172 domain-containing protein	0.709	118-131	KKRNTNRPGSRPSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAD9	Ribonuclease P complex subunit Pop1, putative	0.968	136-169	RLRLETARRLQGLNAKTKARRAASKSKREKEMRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAD9	Ribonuclease P complex subunit Pop1, putative	0.939	183-210	PRVPKIKKNKLSHPAPAESKFKKRQRGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAD9	Ribonuclease P complex subunit Pop1, putative	0.929	93-114	RRRTASHNVKRVPRRLRARAKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAD9	Ribonuclease P complex subunit Pop1, putative	0.759	349-355	RKAKKPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAD9	Ribonuclease P complex subunit Pop1, putative	0.669	127-132	RRRKPT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GG82	EF-hand superfamily Ca2+modulated protein	0.734	4-20	KRRGPSNPAPTPRKGRQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HS67	Multicopy suppressor of stt4 mutation	0.923	305-314	KQKRARKKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXZ2	Uncharacterized protein	0.813	174-187	RIHKREEKLKRREA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4I2	BRCT domain-containing protein	0.983	14-57	PKRAGRGRPRATPATAAEAKAAAVPKPRGRPPKARTAAAAEPKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4I2	BRCT domain-containing protein	0.953	264-290	SGLKAKPVRKAAGTGRGRKPAAAKENP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4I2	BRCT domain-containing protein	0.78	141-154	KRKVGRPRMKPVEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4I2	BRCT domain-containing protein	0.728	164-172	APRPRGRPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4I2	BRCT domain-containing protein	0.714	1529-1540	AARRKSLAFKPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5T2	Uncharacterized protein	0.898	72-86	SPKKRGSQRGRRLRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F973	COX assembly mitochondrial protein	0.846	54-68	RAKRNREKARENRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAC9	P-type phospholipid transporter	0.999	1410-1477	LKRIDAKKKQKKDAEEEEAAPSKSKEEAEERKKLKAEKKAEKKAAQKEKKKAKEAAKKEKKQDEGKPA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAC9	P-type phospholipid transporter	0.999	1758-1831	SLLKKTLKRKETAKKKSEREWRERLEGVAKGKDARQAKREENLRKRKEGKGAGKGKARPGFEGSFKAKVGGKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAC9	P-type phospholipid transporter	0.989	1606-1639	RPARNRQELIEARRQKAEQRKKHKKELRQKAKEE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAC9	P-type phospholipid transporter	0.902	1345-1362	RKKQTKEQARKAKKAKLD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAC9	P-type phospholipid transporter	0.641	1746-1753	KRAHGERV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAV9	Trimethylguanosine synthase	0.638	1097-1102	HPKNKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAV9	Trimethylguanosine synthase	0.635	1041-1048	ERRFAREK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAV9	Trimethylguanosine synthase	0.604	377-378	KR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEE6	SPRY domain-containing protein	0.978	51-77	RSKRNKRDSRKKREAKGLDPDNMPPKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPY8	Uncharacterized protein	0.991	521-540	MPKGNAAAPKVGKKKKKARK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYI7	C2H2-type domain-containing protein	0.657	319-325	GKNHKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ15	DNA excision repair protein Rad2	0.917	89-99	AGRKKRREGRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ15	DNA excision repair protein Rad2	0.827	1122-1131	RAKRRAPRRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ15	DNA excision repair protein Rad2	0.693	492-501	RKSQPRPKPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZU7	Uncharacterized protein	0.869	186-196	KKAKKFKTKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2P5	Uncharacterized protein	0.919	461-488	KVMKSRELIKIGKRRIYRVVRPKRLGKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2P5	Uncharacterized protein	0.709	25-40	KHEKISRASRKDSRSP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3S2	pH signal transduction protein PalA, putative	0.617	954-956	RKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G445	Signal recognition particle subunit SRP72	0.988	643-653	ASSKKKKKGKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G445	Signal recognition particle subunit SRP72	0.98	555-578	ARKRPASDKEGAAKKRVRKSRLPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G445	Signal recognition particle subunit SRP72	0.907	595-611	RDRSTYRPKGKKGKQRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HSW5	Uncharacterized protein	0.746	247-255	RNRSRRGKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HSW5	Uncharacterized protein	0.69	292-301	RRRFRERSPH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HSW5	Uncharacterized protein	0.625	196-198	RRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HSW5	Uncharacterized protein	0.608	220-221	RR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HX51	PlsC domain-containing protein	0.694	714-720	RGQRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I502	L-ornithine N(5)-monooxygenase	0.937	175-185	KHKKKKRTKAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I652	Small nucleolar ribonucleoprotein complex subunit, putative	0.896	476-508	KLKNRGRGRNSALRRYLRKRGQPNVIDEKRLKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I652	Small nucleolar ribonucleoprotein complex subunit, putative	0.639	518-522	RAKAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I652	Small nucleolar ribonucleoprotein complex subunit, putative	0.61	51-53	KLR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F858	Elongation of fatty acids protein	0.755	287-299	TGKSGRPRRNTGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEU0	Uncharacterized protein	0.866	144-152	RRRRKRLKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKC7	Uncharacterized protein	0.7	259-268	GKLDDRKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKC7	Uncharacterized protein	0.603	8-8	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLX0	DNA ligase	0.792	692-702	RRKRIKRTTKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN93	Mitochondrial 37S ribosomal protein RSM27	0.998	85-108	KLRGKGRPKKKRTAAESRTAKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FR30	Uncharacterized protein	0.995	211-227	PRSRPDSDKKKKKRKSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSS4	Uncharacterized protein	0.788	76-101	ARAGPGRANGRWIRTDARGTVRRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTJ2	COP9 signalosome complex subunit 6	0.951	281-293	PEKKKGPKSKKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTQ9	RING finger domain protein	0.919	346-358	KRKKKNKDKENGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXU8	Uncharacterized protein	0.846	414-451	KTPPRTRSTRTPRRSPAKSEQSTRTPSRGKEAKAVPKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G031	DnaJ domain protein	0.994	191-212	DWQKGHKKDKGEGGKKKKKMKV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G031	DnaJ domain protein	0.784	142-173	RRRRQMKARLQEEGRQQRKEEEEIEERKRKRD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3F9	CT20 family protein	0.907	275-300	SRAKQKEKKGAGTGGGTATRRTGRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD41	Serine/threonine protein kinase, putative	0.69	246-251	HLRKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GFM9	Uncharacterized protein	0.979	349-368	SRRKRPSQQKRKRQARRALK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQR2	RNAse P Rpr2/Rpp21 subunit domain protein	0.857	275-292	PRTDRRSKKLPERKAEAA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2Z2	BZIP transcription factor (HapX), putative	0.911	60-93	PRPKPGRKPATDTPPTKRKAQNRAAQRAFRERRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8N4	Phosphatidylinositol:UDP-GlcNAc transferase PIG-C	0.982	716-735	ELRSARASSRRRRRKGAWKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9C2	MFS multidrug transporter, putative	0.918	527-540	KRIPRKAAKKKDEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAT1	NAAA-beta domain-containing protein	0.634	347-352	RELKRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FFQ4	Carboxylic ester hydrolase	0.93	102-117	RAHALRKKLKRKLREE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHS4	APH domain-containing protein	0.766	184-194	RDGRSRRWKKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMI6	Uncharacterized protein	0.69	359-366	KEKKHRWK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPI7	Mitochondrial mRNA processing protein PET127, putative	0.882	120-135	KSSRNKQRKKSKNAAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPI7	Mitochondrial mRNA processing protein PET127, putative	0.774	68-84	KKPVTRPRPPVRKQPVG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPI7	Mitochondrial mRNA processing protein PET127, putative	0.759	90-104	LHKAGVRGSKPKPAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPZ6	COPII-coated vesicle protein	0.744	173-185	NPWRKFPKGPRLR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQT5	J domain-containing protein	0.958	64-76	KRKRLRKERRIKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQT5	J domain-containing protein	0.682	662-666	PKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVN5	40S ribosomal protein S15	0.99	48-78	RARRRFNRGLKRKPMGLIKKLRKAKQEAKPN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXP5	90S preribosome component RRP12	0.993	1223-1263	PNGRRGLGMPKQHGSPGGRVVKRKGGPNRSGRGAIRGGRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXP5	90S preribosome component RRP12	0.986	1003-1014	RKERERRKRKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXP5	90S preribosome component RRP12	0.635	1123-1126	KKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXP5	90S preribosome component RRP12	0.601	1184-1184	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYI9	C6 transcription factor	0.636	14-18	RKRAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G072	RNA helicase	0.987	98-122	RKAKSSDKPAEDKREKKKKNRRTSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G072	RNA helicase	0.98	148-160	KDGKKEKKRKRKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G072	RNA helicase	0.765	851-858	RKGQKAKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0P3	C6 transcription factor, putative	0.811	47-55	KRRRRAHAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1D2	Nucleolar protein 58	0.998	554-595	KKDLKKAKKEAKKAAKEDGKKRKRTDEDADKSEKKKKKKSKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1D2	Nucleolar protein 58	0.928	456-466	AKKEKKDKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1D2	Nucleolar protein 58	0.914	505-516	KKHKSKKSKKDG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1M8	Uncharacterized protein	0.983	89-103	EGPPKKKKKKALAKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2J2	Uncharacterized protein	0.72	439-444	KPRKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3B1	Probable lysosomal cobalamin transporter	0.998	989-1009	GGEKKKKNNKKKNKNKNKKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDX3	Uncharacterized protein	0.833	306-319	KVIIKRPKSKRLEP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2Z7	Pre-mRNA-splicing factor CWC24	0.98	306-324	KLNRLLEKKRERARKRREK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2Z7	Pre-mRNA-splicing factor CWC24	0.852	17-31	KKRSAKAKSSLRKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2Z7	Pre-mRNA-splicing factor CWC24	0.76	55-62	RRIKRRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3A1	mRNA (guanine-N(7)-)-methyltransferase	0.99	207-250	PAAAPDRPVSKRKRQEERHQKLRRRGRTPPSVFSRRDRSPRRGN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3A1	mRNA (guanine-N(7)-)-methyltransferase	0.929	263-302	PSPAPRRSPTPEAQARQRKRPGGGARMGIANREVLRRRQE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I523	EH domain-containing protein	0.933	461-493	HKHMIRIIKKHPHKHHEGDRKRWRNEITEKERK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8X5	Phosphatidylinositol 4-kinase	0.717	277-285	RKAWRGKKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8X5	Phosphatidylinositol 4-kinase	0.654	327-330	KRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAC6	Uncharacterized protein	0.986	29-48	KPDKASKKKAQKNKRGPKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAP6	Transcription elongation factor SPT5	0.884	107-114	RPRKRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAS3	Uncharacterized protein	0.99	70-130	RERGRDRDTARDRGRDRHRDPKPHRRQWENRSERRTRSPPPSRRGALSDRDPPPRRRDPSP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBI9	Pescadillo homolog	0.984	616-683	SKKQSAQSKKHAAKKRKEEEELERQKMMMSRKKRKLLDKMLHSNKKKDEEAQKLRSKRRKLEKVAEKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBI9	Pescadillo homolog	0.616	50-51	KK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMM6	Uncharacterized protein	0.661	204-210	RSRARRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMM6	Uncharacterized protein	0.603	219-219	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSH9	Uncharacterized protein	0.784	284-303	LKEKFEKGHRPRQSGKQAIR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVI9	DNA repair protein Rad4, putative	0.698	10-19	QRGRGARGRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYT0	Ran exchange factor Prp20/Pim1	0.983	60-120	KTTQRKTAPAAARKSAKAEPSAAAPATKKRKAEAEEEAPPREQKKARVAAPPPAPKPKPKV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0Y1	ATP-dependent Clp protease	0.607	598-600	KEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2R4	SLD3 domain-containing protein	0.986	383-396	KTKKRKSKKKKLAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2T5	DNA repair protein rad14	0.978	288-321	EEDKKRRREAKFKTKLQDLKKRTRVEAYRRNRKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3M8	Uncharacterized protein	0.999	54-77	EKKSRKDKKEKKEKKEKKKAKRTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3M8	Uncharacterized protein	0.996	176-189	SKKKKKKEKRAKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3M8	Uncharacterized protein	0.949	379-399	PSKSTKGNENAAQKKKKRKNR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3M8	Uncharacterized protein	0.875	100-112	RGSESKGRGKKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3M8	Uncharacterized protein	0.766	426-432	KKKKKPA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G452	AT DNA binding protein	0.936	188-198	TGKRKRGRPRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G452	AT DNA binding protein	0.916	145-154	PKRRRGRPRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G469	C-5 cytosine-specific DNA methylase, putative	0.683	1414-1420	KKRKLSA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G469	C-5 cytosine-specific DNA methylase, putative	0.607	1423-1424	KG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G508	Poly(A) polymerase	0.842	542-552	TRPKKKIVKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G594	Membrane bound cation transporter, putative	0.965	373-385	RRLRKAFRKKRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G594	Membrane bound cation transporter, putative	0.927	478-493	AKRKIRPWRKNKERER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6J6	Uncharacterized protein	0.99	327-365	QNEKNAREQRRVARRAGRGSSRREERQEKKKEKETKKIR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HY19	DNA damage-binding protein CMR1	0.988	51-77	SSGDGKSKKKAPPKRVKKEEESPVPRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYM2	DUF4211 domain-containing protein	1	78-105	KKKEGKKKKKEKKEKSREKRKRKKGSKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYM2	DUF4211 domain-containing protein	0.962	178-216	RKSRRGQGSKEDTPKGKEPRSGKSAGHKKPDAETRTPLK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEB9	Dienelactone hydrolase	0.941	412-427	KPRLEKKPPKDKGKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLB2	Uncharacterized protein	0.891	694-709	QKVKYAKEAEKRRKKQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNX3	Type I phosphodiesterase / nucleotide pyrophosphatase family protein	0.986	89-114	SSVKIGKKERRQRRREMKAAYRRRHE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FS78	Enhancer of polycomb-like protein	0.668	232-239	IRKTRGRD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FS78	Enhancer of polycomb-like protein	0.625	244-248	EKLRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXL3	Uncharacterized protein	0.75	689-696	SKGKRKGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXL3	Uncharacterized protein	0.672	1192-1198	LRKVKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXM9	Peptide-methionine (S)-S-oxide reductase	0.946	688-718	KGSPRRRKLGIAKKGVSFTPKKTQAKVPKRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXM9	Peptide-methionine (S)-S-oxide reductase	0.637	657-660	ARRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0V7	HECT-type E3 ubiquitin transferase	0.955	2840-2886	KKRQKQLEEERKRREEERAERERQERIAKEEEEKERRRKEEAEAARR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0V7	HECT-type E3 ubiquitin transferase	0.688	3256-3261	RKGKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8X4	Peptidyl-prolyl cis-trans isomerase	0.982	383-426	RRRPDERESYKPSRRERSRSRSPKRREGYSDGPRERRHDDYRRN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9E1	60S ribosomal protein L18	0.987	155-184	PHSGKKPYVQSKGRKFERARGRRRSRGFKV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCY6	Uncharacterized protein	0.962	31-67	RRKLQNRLNQRARRERKVIEDLQKGIVRRPRGRPKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1I8	Sfi1 domain-containing protein	0.877	194-209	KTPPKRTKGNGKRGKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1I8	Sfi1 domain-containing protein	0.688	788-801	KRRRQDAYAKVRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I451	Sec1 family superfamily	0.993	669-690	TPPGKPPKEEKEKKKKKHHFFK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8E7	Uncharacterized protein	0.997	15-75	DKKRKRHAEEQSSKGDKANGAGNAPSDGSSKKRKKNKEKYNKNKGKKDKQDDAEKPAEPPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8K2	Monooxygenase	0.795	459-476	RRKAMWRRKNEQAAKKIA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F925	Uncharacterized protein	0.954	53-75	RPALRAKKGSRRRIDGRRVSRTR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCJ6	Uncharacterized protein	0.987	1165-1196	RKIKEPLPEKRKAPSKTKKTKNIAKEAKVRRV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FF02	Uncharacterized protein	0.964	161-190	TDNGRKKRKSSTKSSGGEGTRKSNLKPGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGD4	Non-specific serine/threonine protein kinase	0.683	822-829	GKKRFSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJD9	Uncharacterized protein	0.905	451-461	LKKAKREKKRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJF1	Uncharacterized protein	0.794	232-262	RKRGRPRLQPAPTKDDKPLEESKPGVKLGHK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJF1	Uncharacterized protein	0.607	351-352	KK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSV3	Uncharacterized protein	0.815	96-105	RKHRRQRRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSV3	Uncharacterized protein	0.72	128-135	RRTRRGKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G635	C2H2-type domain-containing protein	0.958	73-94	GRNAGGHGYKGRRPGRFGRRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDF6	Bms1-type G domain-containing protein	0.791	23-49	KSKHATKGALKEQAKGKVENRERGSRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HSY0	Cell cycle control protein	0.843	25-43	RKRSPPSRSPSPNRRRSPP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVP8	Pentatricopeptide repeat protein	0.859	282-300	KEIRKEWKARKKEEENQRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HX40	PHD transcription factor, putative	0.98	384-413	TKGSAAAKKPTAASSKKGTATKKAAPKKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HX40	PHD transcription factor, putative	0.973	435-464	SKTPAPKKQGSASAAGSPAPESKKKRPKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYH6	Serine protease	0.917	789-800	ERKRASRKKQRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4S8	Uncharacterized protein	0.999	258-310	SKLKKEKKQSKDKTKEDKKEKKEKKEKKRSKTDSASDDAKKEKSKKRKKDEKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4S8	Uncharacterized protein	0.996	184-209	KEERRKRRKSEKSEKKEKNASKKEKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4S8	Uncharacterized protein	0.995	119-166	KEEKKKSEDSSEEKKKSKSKRKRDDDEEESKEARALRKEEKRKKRKTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4S8	Uncharacterized protein	0.875	218-228	REERKKDKKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F776	SWR1-complex protein 5	0.997	85-100	KAKERKKKNKKKGKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F776	SWR1-complex protein 5	0.85	55-67	RPAKRRKVGAGKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F776	SWR1-complex protein 5	0.649	261-267	KLRRPLR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBD0	Ribosome biogenesis protein SLX9	0.925	46-63	KIEKTNSKPSKRRRASKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBD0	Ribosome biogenesis protein SLX9	0.777	99-111	RTRPGAMKRKEKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMD2	Beta-ketoacyl-[acyl-carrier-protein] synthase I	0.999	645-698	GQKSAKKSAVKGMADDGTKKGKKRKADAEDEKDKEPKKKKKKDEPKPKVPKPKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMD2	Beta-ketoacyl-[acyl-carrier-protein] synthase I	0.975	518-545	KPGKIKLKKSSSTGKNAKGKKPEKDGKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMD2	Beta-ketoacyl-[acyl-carrier-protein] synthase I	0.948	604-624	AKQEKARKKKEARDAANRAKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8U6	Uncharacterized protein	0.91	209-239	RRKRSPEPEPKSSKEDERRQHGVRSPKKPRL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8U6	Uncharacterized protein	0.627	398-401	NRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HSY4	ATP-dependent DNA helicase	0.978	864-877	PKKRARPPKRPPKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HSY4	ATP-dependent DNA helicase	0.632	138-142	PRWKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HU97	WD domain, G-beta repeat containing protein	0.633	140-143	HRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HVT5	Origin recognition complex subunit 4	0.635	110-114	RKPPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXJ1	Mis12-Mtw1 domain protein	0.865	226-250	RNKEMRTDKAKKGQRRSSLGMRGRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXJ1	Mis12-Mtw1 domain protein	0.829	184-193	PRRKRGKPSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXJ1	Mis12-Mtw1 domain protein	0.645	117-121	KRGRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYX0	Microfibrillar-associated protein MfaP1, putative	0.996	403-497	RRKGPTGANASAVRERRRSRSRTPPRRRSRSRSFSPRRDRYNDRSRYRDDDRRDRDRHRDYDRRDRSRSRDRYRDDDRNRRKRSPSPYDDRDKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYX0	Microfibrillar-associated protein MfaP1, putative	0.612	249-252	RIKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1G5	Adenylyl cyclase-associated protein	0.987	356-380	RGKSPAPPGKKPKPESMRAKKPPRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1I2	SNF2 family helicase/ATPase PasG	0.984	148-163	EARKGSKGKRGRPKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7K0	Uncharacterized protein	0.986	177-225	VKRRKGVRPPPAPAKAIAPKPAPATKPFPKKEEPAPEKKEEQQEKAEPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7K0	Uncharacterized protein	0.968	370-383	GRRRGKRKVMKKKT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7K0	Uncharacterized protein	0.864	410-428	PPKKKPAINSGPKSKGGPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBM3	Uncharacterized protein	0.998	509-539	KKGPQGKNKKLDAKKAKKEAKEAKEAKKAKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FH88	G-patch domain protein (TFIP11), putative	0.902	174-189	AQRRKRKEQRKQQEGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK55	Anucleate primary sterigmata	0.778	1493-1513	LRARLEKERMRREVSRARGSS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK55	Anucleate primary sterigmata	0.704	1475-1486	DRDGARKRLEER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK55	Anucleate primary sterigmata	0.637	1518-1527	RRTRSSTRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FK55	Anucleate primary sterigmata	0.616	1466-1472	KAEREAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FL26	Phosphodiesterase	0.704	976-989	RRRSRLRLAFWRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLA1	WD-repeat containing protein slp1	0.964	124-158	SKERTRERVTKERAAKEKTSKEKVPKEKASREKVA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTI0	Uncharacterized protein	0.819	42-51	GRKTQKRKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3W8	Probable acetate kinase	0.639	456-461	RRKESK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6G5	Ubiquitin carboxyl-terminal hydrolase	0.992	590-635	SKKERHKEEKERKAAEKAAEKEKDKAEKLRRKEMDAKAKEDHKREE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6G5	Ubiquitin carboxyl-terminal hydrolase	0.914	654-698	KRNASDADKEKSKENGHPKNHSHGLGRFKRGSKSIGHKLVKEKDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6G5	Ubiquitin carboxyl-terminal hydrolase	0.636	753-761	EKISHGKWK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCF9	Uncharacterized protein	0.927	514-525	RRERRKRRSRGH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCF9	Uncharacterized protein	0.82	242-260	KAPSRRRSRSLSRERIAHK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRK2	Uncharacterized protein	0.989	33-65	RSARKKRRELKEERDKGRAENEAKAKEKAKKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I556	AAA domain-containing protein	0.987	222-240	KGQKKGSGKRKSLPKKKKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I556	AAA domain-containing protein	0.973	535-554	KSKQGKGEVGGKRTKRRKRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I556	AAA domain-containing protein	0.676	1118-1125	KRARKTRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I556	AAA domain-containing protein	0.616	109-110	KR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5M8	Uncharacterized protein	0.951	38-63	KQRRLDEKKRKRDIFRARRVALERIK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAD5	18S rRNA aminocarboxypropyltransferase	0.872	9-25	FSRGGKKFASKPRPRPS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FF67	Serine/threonine-protein kinase RIO1	0.998	522-571	KKQPRGKRFEDKDAKRDHKRQVKEEKREQRAKKMPKHLKKKLVNQSSRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMM9	Protein BCP1	0.795	206-212	RPKKKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNR7	SNF2 family helicase/ATPase, putative	0.999	753-772	KPEKRKKKHKKHRKEKKKGI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNR7	SNF2 family helicase/ATPase, putative	0.993	215-234	KPKQRSRRKRSGKKKQQKTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTE2	Uncharacterized protein	0.974	619-656	ARRPAAPLSKPLKRSNGKKKDRHGAAPVLPVSRAKDEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTE2	Uncharacterized protein	0.647	671-679	KGDGGRKQH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTI4	THO complex subunit 2	0.953	2258-2391	EEPHEPRESSSRRGGHSRDENRRRERRERDSFGPGNENQGRLKPPPMNAGAPPPPPPPPGGPAEDRRWGGGRGENRERNRDRDRGDREYREGGSNILPRKRGRPGGDENHGGHHEGGGRGARVGSESKRARRGP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTI4	THO complex subunit 2	0.93	56-74	RGRGGRRPSRGGRGPSGRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTI4	THO complex subunit 2	0.727	2226-2249	RSSSRREEHRERAREYDRESRRRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTI4	THO complex subunit 2	0.693	2073-2094	PPSGPPPPRAPPSGPGFGGERG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU63	Structure-specific endonuclease subunit SLX1	0.959	302-316	KQPRKKRTKKPAKQG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX89	Ima1_N domain-containing protein	0.801	156-170	ERSKTGRAARKARNR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1M1	Uncharacterized protein	0.795	498-511	VKKQIKKIRHVKPP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2G2	Ubiquitinyl hydrolase 1 (Fragment)	0.826	611-624	PEAVRGRRKDGKPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2G2	Ubiquitinyl hydrolase 1 (Fragment)	0.782	45-64	KRRKVAEPRRPASFASRARH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2G2	Ubiquitinyl hydrolase 1 (Fragment)	0.734	1253-1263	KRQLRQSRKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G328	DIL and ankyrin domain protein	0.967	2077-2101	RSKSKAKPPEPAEKRFRPPSPKRRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3N1	Disrupter of telomere silencing protein Dot5, putative	0.968	5-38	RKRKAPAEPAPTEKKPKVAQKAATKGRPRASAKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G496	Uncharacterized protein	0.993	294-340	EVAPRKKSKKHSSKETGKTESSQDAGDKPKKSKHGDEKKRKKAEKAV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G496	Uncharacterized protein	0.876	269-284	PKGSKAEREERKRKHQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G496	Uncharacterized protein	0.741	223-233	DARKPPRPQPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G496	Uncharacterized protein	0.666	37-44	ESRKTKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5L0	Uncharacterized protein	0.992	161-192	KKRKATGQPKTTSKNAPRPKKARVQPKKGRRT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5L0	Uncharacterized protein	0.936	226-242	APRAPAKRAKRAPLRRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6M3	Uncharacterized protein (Fragment)	0.766	108-120	GAAGPGRRSRKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6M3	Uncharacterized protein (Fragment)	0.622	441-443	RKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8Z3	DUF1665 domain protein	0.916	7-26	KKRKVLDSLKNARPKKKFRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEH1	Uncharacterized protein	0.959	83-104	RKLARYKKTERRLRRERKWMRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I378	DNA polymerase	0.992	1321-1409	RRLKIKEERRRNRNNNKAEKRKRESMNSNGSRGSPEGTARPKKKAKSSGGDAKGGDTEYKAEKDKRRKRRSSGPDSSDNKAKKVKNGDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I378	DNA polymerase	0.77	1260-1267	KKGKKRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9M3	Nuclear envelope protein Brr6, putative	0.813	154-164	RRVQKRRRRDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAU3	Protein kinase	0.721	508-520	LPRQKGSARKPSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAU3	Protein kinase	0.72	569-578	RKKGRDRSPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBQ1	Epimerase domain-containing protein	0.664	230-235	KKARRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEU6	Protein SIP5	0.998	554-582	RRKKAEKEAKKEAKRREKEAKKAEKSLRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEU6	Protein SIP5	0.656	79-91	ARRLERERVARLK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIN5	Phosphatidylinositol 3-kinase VPS34	0.734	226-236	EAARKRAIRLK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQU7	Uncharacterized protein	0.999	242-279	RRNRWMAWRKRKARAERAAQMKSLKNKKKASKKGKGGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQU7	Uncharacterized protein	0.602	80-80	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTH0	Uncharacterized protein	0.999	1002-1042	RPNKAKGKGKAKRARGKKRTLAELKKEGMKNAKAKAKYLRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVA8	J domain-containing protein	0.852	170-179	RKKRRRDGMK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVS6	Tafazzin	0.703	416-431	RPRPSPRRVGDVRIRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZD4	Translation factor GUF1, mitochondrial	0.91	682-698	RRRKLLEKQKEGRKKLK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G089	Uncharacterized protein	0.865	126-138	PKRKSRRPWHRHK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G089	Uncharacterized protein	0.68	546-554	HIGRGRHRH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G089	Uncharacterized protein	0.664	1198-1203	RKRNRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0Q6	Uncharacterized protein (Fragment)	0.635	8-10	KRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3I2	Uncharacterized protein	0.982	813-849	KPKTKSSRRKSAPATSTKQKAPKKDTKKEPQRRSERL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3I2	Uncharacterized protein	0.978	441-456	PGRSKTHRRRRRRRER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8T7	Uncharacterized protein	0.724	105-112	PKKPHRRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA89	AdoMet-dependent rRNA methyltransferase SPB1	0.995	678-729	SRPNKPITKAAAAAIKEKLRAINARPIKKVMEAKGRKKFKAAQRLEKLRKKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA89	AdoMet-dependent rRNA methyltransferase SPB1	0.994	751-805	MSKAAKKKPKQNVKLVVAKGANRGISGRPKGVKGKYKDARMKKDIRAQKRLAKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA89	AdoMet-dependent rRNA methyltransferase SPB1	0.986	373-388	SKKRKERRKENERKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA89	AdoMet-dependent rRNA methyltransferase SPB1	0.766	236-241	KKKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA89	AdoMet-dependent rRNA methyltransferase SPB1	0.761	482-490	KLRAKKARK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA89	AdoMet-dependent rRNA methyltransferase SPB1	0.676	6-23	KHGKGRLDKWYKLAKEKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA89	AdoMet-dependent rRNA methyltransferase SPB1	0.665	325-339	RVREKFGLAVKKGPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA89	AdoMet-dependent rRNA methyltransferase SPB1	0.631	587-590	KSKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCK1	Pre-mRNA-splicing factor prp1	0.865	123-134	RRRKARREARER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHU3	Uncharacterized protein	0.729	160-172	KRMIREHNRKKAI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FL74	Eukaryotic translation initiation factor subunit eIF-4F, putative	0.948	626-690	RKRKEEEEARKAMEELSLKEKEEKEKAEKEKAEKEKAEKEQAEKEQAEKEKAQKEAAEKEAAAAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM36	Protein required for cell viability	0.956	867-893	GRRSRKPEAQRLRRKQLDKERRQKERE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPH0	F-box domain-containing protein	0.73	28-37	RKKRASVKRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU83	Non-specific serine/threonine protein kinase	0.683	602-615	KPKSTAKSESGKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU83	Non-specific serine/threonine protein kinase	0.625	208-210	KKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWZ2	Uncharacterized protein	0.917	461-477	TAIPRRKRPDPRKHVAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYM3	Mtf2 domain-containing protein	0.916	155-174	GKENFEPVKERRKKKTEDKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6M9	Uncharacterized protein	0.691	465-471	VKGKKER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6Q5	T5orf172 domain-containing protein	0.746	471-476	RKKKRI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCH5	ATP-dependent DNA helicase II subunit 2	0.958	557-571	KKVPPKAKGRKRNRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYD5	BZIP transcription factor, putative	0.741	178-193	RRRNTAASARFRVKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I366	Uncharacterized protein	0.61	208-209	KR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F897	RING-type domain-containing protein	0.795	656-666	RIRRRRWRAPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F897	RING-type domain-containing protein	0.69	321-330	KPKKLPASKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9F8	SRP40, C-terminal domain protein	0.88	387-400	KGFTKEKNKKKRGS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9F8	SRP40, C-terminal domain protein	0.725	5-20	KSEKAEKAGKAASKAS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBE3	C6 finger domain protein, putative	0.828	3-17	RPKRPGAPEPKRRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC81	Uncharacterized protein	0.991	412-451	QRGRGRGRGRGDGFRGRGGRGEFRGRGRGRGEFRGGRGRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC81	Uncharacterized protein	0.902	15-25	EPKGAKKKRAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCH7	SWI-SNF complex subunit	0.78	199-209	KKPASKRPRPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEY2	Zn(2)-C6 fungal-type domain-containing protein	0.636	60-66	KRPAPRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEY2	Zn(2)-C6 fungal-type domain-containing protein	0.606	72-73	RK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLW8	C6 zinc finger domain protein	0.806	69-77	KRGGPRKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FM89	Uncharacterized protein	0.744	5-27	KRKTKAEDLARVRNNQRRSRQRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPL7	Ceramide synthase membrane component (LAG1), putative	0.841	53-63	KPHSKRRRSRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPX6	Histone h1.3	0.904	158-183	PKRQRKKGTAVKVATPKKMAKSPKVK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPX6	Histone h1.3	0.819	118-127	SKKATPKRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQI9	Uncharacterized protein	0.86	41-55	GKVQRRRRESPRGRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVE7	Uncharacterized protein	0.989	25-52	RGRGRGREGGRGWGGGRGRGRGRGRGGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVE7	Uncharacterized protein	0.972	139-174	APERGNRFPRHNRPLKEKFKKDDPAKKPPVDKGKAP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVE7	Uncharacterized protein	0.857	87-107	GTDRDRGRAHARRGYRGNKRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0X1	Uncharacterized protein	0.887	86-98	KTPRKPRARKGAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0X1	Uncharacterized protein	0.79	121-129	KPKTPRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1C8	Uncharacterized protein	0.886	388-399	KKVRRKRRELRN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1K1	Methionine aminopeptidase 2	0.996	74-86	PKKKKKRKKSKNK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.989	3445-3458	AKSKKKGKKGKKNR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.989	3893-3904	KKSKKDKKKKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.988	3311-3323	KSKKKAKKDKKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.988	3705-3717	KAKRKAKKDKKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.985	2474-2486	SKKQKKKAKKAKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.985	2690-2701	SKKSKKKKRKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.984	2921-2933	PKKSKKKGKKNRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.984	3633-3645	KSKKKSKKDKKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.983	3207-3219	KSKKKAKKDKRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.981	2797-2810	SRKKSKKEKRKSKQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.978	3122-3133	KRKAKKDKKKRQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.976	1669-1680	KKKRRRRSKRDS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.974	3985-3997	KKKNKKDKKNKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.926	2568-2579	KKAKKDKNKKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.922	1151-1169	RKRDIERRRREKEKESGRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.903	325-341	RPPKPSKPGKPNKPSKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.898	1721-1737	KEKRKSKDKESEKEKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.87	1223-1241	RRQKRHEELRDKRRAERRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.859	722-741	ALKSRHRNRSRSPMRQKSRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.845	688-702	RSRRRSRSRSRSWER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.816	559-573	PRKHNYKRRKIPGDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.779	592-600	NRRRRSKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.767	1690-1697	SSRRRRKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.679	931-935	RKKKD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6T2	Involucrin repeat protein, putative (Fragment)	0.622	164-167	KERR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8C4	Uncharacterized protein	0.999	68-86	EKKKKKKRSKKPKSKRGLN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9G0	Uncharacterized protein	0.971	301-334	RRRGTRTKPAKAAKQEPPKGPKLGGSRSARAAMR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9G0	Uncharacterized protein	0.808	228-245	KKARPGNDGKSWRNRKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9G0	Uncharacterized protein	0.785	15-24	VKKRKFLRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTU9	Uncharacterized protein	0.798	414-423	RRPKRARAAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1S9	Ribosomal protein S15, putative	0.86	256-283	HNKRNLRLLVHKRQKLLRYLRKKERGGP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4N0	Uncharacterized protein	0.63	134-138	HSRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4T4	Glutamine--tRNA ligase	0.986	27-66	LKKRMQKRAKKAASAQRAQENEGKPKKEAAPAKEKPKPKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F7K9	UBA/TS-N domain protein	0.796	769-787	KPAPKPASRPVQPKKPAPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FES3	Zn(2)-C6 fungal-type domain-containing protein	0.769	59-65	RRKRGKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSY7	CCR4-NOT core complex subunit Not4, putative	0.928	762-772	KQKKKGKKHRH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSY7	CCR4-NOT core complex subunit Not4, putative	0.917	87-103	KHRKAAAAKKKEAEKRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSY7	CCR4-NOT core complex subunit Not4, putative	0.833	1124-1136	KSQAKKERRLKAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSY7	CCR4-NOT core complex subunit Not4, putative	0.675	1160-1165	RKRKTK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTI1	Uncharacterized protein	0.902	214-236	KEARDVGNKSSSKSKSPWKRKRH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTI1	Uncharacterized protein	0.724	272-282	ARRRQARREQR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUG7	Cir_N domain-containing protein	0.994	171-300	DKSEKEHRHRRHRHHHRDDESRRSRHRSSRYDEEDDRRSSHRRRHRSRSAARSRSRSPDYKRSSRHSDERRHRSRRSPSPYREKSRRSPSPYSRNRTYEQRSRSKSRSPYRKPAESPGRRNYSRRSPDRY
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVI4	Conserved glutamic acid-rich protein	0.64	420-423	PKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYF0	tRNA wybutosine-synthesizing protein 2	0.747	20-33	GGRPAAKTKRDRPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4F2	Cap binding protein	0.827	9-21	HGGRGGGGGRKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I280	Uncharacterized protein	0.885	870-880	RERRRKKAERR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I4K8	C2H2-type domain-containing protein	0.685	195-200	RPRRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I586	Uncharacterized protein	0.663	29-36	KRRAKTPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC19	Uncharacterized protein	0.722	634-641	RRRKGQRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCQ7	SprT-like domain-containing protein	0.631	454-458	ALKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCQ7	SprT-like domain-containing protein	0.601	452-452	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FL99	Uncharacterized protein	0.983	677-708	KGRGRGARDASEKKPRNKSRTRSIFGRKKSVP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN29	DNA repair protein (Rad1), putative	0.756	206-212	SKKEKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQP9	Uncharacterized protein	0.977	865-933	HKSTTARRKEKKESEGKSTTNKEKARKKNFLMTLGKAKSKGKRSLVETRASLRAHQERQKKGGRRGNRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQP9	Uncharacterized protein	0.931	448-473	NKKTRKKNRQVEKALQTVKKKERKKN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQP9	Uncharacterized protein	0.874	691-698	RRKKRREK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQP9	Uncharacterized protein	0.673	757-762	KKAKKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRE0	Dolichyl-phosphate-mannose--protein mannosyltransferase	0.842	16-32	RTGRSRSRSPNPKGKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTS3	Uncharacterized protein	0.977	750-764	KESSKKRRPSFKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTS3	Uncharacterized protein	0.935	183-195	RRHRKKEEKERRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTZ2	SUN domain-containing protein	0.975	116-136	RSTRRSAASKSPGRRRGRPRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYB0	Uncharacterized protein	0.995	729-743	KKRRRRKKRNTKSKH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0J1	BZIP transcription factor (MetR), putative	0.746	194-210	KRRRNTAASARFRVKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3T7	Telomere and ribosome associated protein Stm1	0.994	246-286	APRGRGDGPRGRGRGGRGGRGGRGDGPRTGGRGDGPRPAGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3T7	Telomere and ribosome associated protein Stm1	0.918	33-62	EKAAPRHGKRDAPKEPAAAAPRGGARNNRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3T7	Telomere and ribosome associated protein Stm1	0.762	224-234	KGKREKQRKEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5K6	Uncharacterized protein	0.963	767-784	KAKSKEDRKAKPKPRAKT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5K6	Uncharacterized protein	0.77	136-154	RKPGSAIKDRPRNVLRRKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWH5	LEA domain protein	0.805	21-53	KGVKSPSSKGSPAPGTPSKRTPQKLGSKAKEQA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HWH5	LEA domain protein	0.768	64-78	PKAAPQTPKSGKKGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HXE5	BHLH domain-containing protein	0.793	333-358	RTKKAKTSSNEKARRSSSDAGSRKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FF18	Elongation factor Tu GTP binding domain protein	0.797	167-176	AARKKKEAGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FF18	Elongation factor Tu GTP binding domain protein	0.704	77-88	KKAKELKKQQPA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FF18	Elongation factor Tu GTP binding domain protein	0.625	351-359	ASKPAGDKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPQ0	F-box domain protein	0.858	1884-1900	ERKKRERSSSRFAKLKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPQ0	F-box domain protein	0.631	609-612	RPKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ37	BAR domain-containing protein	0.748	210-220	YPRKGKTRMPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ37	BAR domain-containing protein	0.683	329-348	KREVRDISRPRSVSVHRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZ37	BAR domain-containing protein	0.642	314-323	HRHRSHSRVR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3E9	Uncharacterized protein	0.614	354-356	KKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4B3	Uncharacterized protein	0.83	36-52	RRREQVRRAQRKHRQKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6P3	C2H2 type conidiation transcription factor BrlA	0.606	325-326	KR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCF4	Calponin homology domain protein	0.885	256-283	KEKKRREAAAEEERRRRQTQEKEEERRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRF7	SAP domain-containing protein	0.824	573-597	RRRGGRGRGGGYGGPWRDSWRGRGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HRF7	SAP domain-containing protein	0.744	198-203	KRKRRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HT63	Transcriptional regulatory protein DEP1	0.998	237-252	RGKKGKRGKRKGRKAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I603	ATP-dependent DNA helicase CHL1	0.909	57-97	KTRELTEKRKNLEARLAKARQEEERIKRDFERPDRPRKKQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F773	Uncharacterized protein	0.835	33-64	TKSKASKTKPSTRTSIGSSSKSTKKPTSRKRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F773	Uncharacterized protein	0.632	11-13	RRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F981	HATPase_c domain-containing protein	0.794	245-254	KKEKKTKKVK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FB64	ANK_REP_REGION domain-containing protein	0.722	281-287	AKKKIKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FB64	ANK_REP_REGION domain-containing protein	0.678	11-17	KIRRAKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBV2	Elongation of fatty acids protein	0.922	535-547	VPAKGRGKRSKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FC35	Eukaryotic translation initiation factor 3 subunit C	0.773	1997-2013	GRGGRGRGGGQGRGGLR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCR0	1,3-beta-D-glucan-UDP glucosyltransferase	0.986	282-299	GKADRKTRKARKAAKKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FD58	Uncharacterized protein	0.995	47-71	KKPKRKAKKASPAPAPAAKPKEKPS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FD58	Uncharacterized protein	0.634	332-335	KGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHJ8	Translational initiation factor 2 beta	0.95	44-53	SKKKKSKKPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FHJ8	Translational initiation factor 2 beta	0.886	76-85	KKKKTKKVKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FL33	RNA cytidine acetyltransferase	0.969	1052-1067	KKQKKIKKGTEGKKRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FL33	RNA cytidine acetyltransferase	0.955	69-85	HRKKREAKIKKEVKRGI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLP2	Exocyst complex component Sec3, putative	0.823	692-706	SRSKSPSPSARRRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLP2	Exocyst complex component Sec3, putative	0.747	288-317	RPPSPRRPQSPYSGRAPSRDGNKDPRRQRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLP2	Exocyst complex component Sec3, putative	0.746	556-566	KKKPGKDLAGA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLP2	Exocyst complex component Sec3, putative	0.601	568-568	R
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ31	Protection of telomeres protein 1	0.875	351-369	AKTTATEKEKQPPKKKLRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ31	Protection of telomeres protein 1	0.608	346-347	KK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQP8	Uncharacterized protein	0.662	2480-2483	KKKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT36	Uncharacterized protein	0.724	137-148	SKRSRRLEGLKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZI4	Uncharacterized protein	0.716	135-145	GAPRKNKPVNK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G006	Myb-like DNA-binding domain protein	0.995	275-307	PGRKRNTDVAKKSKKVVDLNKPKRRRISKPKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3V4	Chromatin modification-related protein	0.993	329-347	KKGKPKKEKQPKRPRASRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3V4	Chromatin modification-related protein	0.975	761-779	GRRKAKPAKKKATSREPGH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3V4	Chromatin modification-related protein	0.935	544-562	PNGAAGKEKEKSKTPRKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3V4	Chromatin modification-related protein	0.704	584-588	KKRKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3V4	Chromatin modification-related protein	0.692	738-744	RRSKRPA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3V4	Chromatin modification-related protein	0.618	262-265	KRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3V4	Chromatin modification-related protein	0.603	244-245	KP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G420	Uncharacterized protein	0.609	247-248	KK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5A1	Clr5 domain-containing protein	0.906	62-84	SRLKKWRITKPSRQTRKKPQEKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5W4	Uncharacterized protein	0.754	244-254	KHRRGHKPLRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUV3	Usp domain-containing protein	0.73	336-343	GRRRSRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HUV3	Usp domain-containing protein	0.705	704-711	RKKLRKHA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F931	Disulfide isomerase, putative	0.967	271-289	PAKAKGKKSSKASKKSTKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBY7	Uncharacterized protein	0.94	102-138	RKRSNSAPRKRVISDEHWKIKRSAPKTPPAKTRPPKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBY7	Uncharacterized protein	0.721	264-282	RRARGPINDTRRPPPKIHK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBY7	Uncharacterized protein	0.688	428-445	HKRSQSASRIGKDSPRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FBY7	Uncharacterized protein	0.612	225-228	KTPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDT9	BZIP domain-containing protein	0.803	56-66	QRNYRKKLKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDX7	Outer mitochondrial membrane protein porin	0.944	69-87	KHPQKRRKPPDPRRSSARA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FEX4	Uncharacterized protein	0.875	13-36	IRKRKSSHRPRSSPFASHPRQKPG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FIG6	Uncharacterized protein	0.944	354-389	PRGRRGARGTRGRARARVTTRAGNNAAAKATQGHKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FNU1	Uncharacterized protein	0.686	54-61	ARRRLAKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPQ7	Uncharacterized protein	0.785	1848-1860	KKQDKKPSKSKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPQ7	Uncharacterized protein	0.604	1732-1732	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPV9	Uncharacterized protein	0.979	71-89	AGGKKDKEKPKDKNAAKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPV9	Uncharacterized protein	0.945	10-47	KSTAASSKRTNALGPKKGQRSIAPKKASLVKQRKITKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FR01	Spindle pole body component	0.888	808-815	GKKRRRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSC6	Hist_deacetyl domain-containing protein	0.966	961-987	HKKTTAKSPKKTAAPKPKPIAPKPAAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSC6	Hist_deacetyl domain-containing protein	0.953	757-788	PAKGPGRMQLRERKPKASAPSTPRRPGPKNNR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSC6	Hist_deacetyl domain-containing protein	0.643	874-882	PKRSASPRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWB2	SMP-LTD domain-containing protein	0.709	686-700	KKVEKESAKKLREPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2T9	Uncharacterized protein	0.821	31-53	RRKLQNRLNQRASRRRKLEQQRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3V0	Methionine aminopeptidase 2	1	59-76	AAKKKKKRKPKKKKGAAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G600	Fungal_trans domain-containing protein	0.631	25-28	RKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G617	DnaJ domain protein	0.995	444-462	KKGKDEKKKKEHKKEKSKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G617	DnaJ domain protein	0.882	205-214	LRKKEKKKGG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G899	RNA helicase	0.955	97-136	RKKREADAAAAKPKFLSKKERERLALEKRAKEVEAERRAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G899	RNA helicase	0.917	71-79	VEKKKKKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G899	RNA helicase	0.805	244-249	KKKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9T0	Uncharacterized protein	0.869	1212-1237	RKRGRSGIFNRLTPKKNRDSGKRVRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9T0	Uncharacterized protein	0.706	362-367	PKPKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9T0	Uncharacterized protein	0.642	1383-1386	KKKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GAK1	Diadenosine tetraphosphate synthetase	0.911	136-146	KEAKKKKKVKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GFM3	DUF1295 domain protein	0.947	339-364	PKGSSKRAAKSKSKRSEPDNESRKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQY4	WD domain protein	0.822	38-46	RRKPKRPPP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I2I0	General transcription and DNA repair factor IIH subunit TFB4	0.98	375-385	ARKKKKKKVRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I454	Uncharacterized protein	0.625	53-55	RRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F809	tRNA-splicing endonuclease subunit Sen2	0.831	149-167	GKRRVERREFKLERARKER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F809	tRNA-splicing endonuclease subunit Sen2	0.664	30-37	PRPPRARP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAP3	Uncharacterized protein	0.931	211-220	KKKKKNRKSL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGG3	Conserved proline-rich protein	0.92	564-586	KSKKTGENRRSPRFWGRSKSKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMX2	CDT1_C domain-containing protein	0.896	103-118	RRTKSAPPRPLRKRRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMX2	CDT1_C domain-containing protein	0.64	365-371	DRIKNKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMX2	CDT1_C domain-containing protein	0.635	359-363	RRKGL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN61	Transcriptional regulator, putative	0.987	222-247	PKKRQRSAKAESTGKKGRKPAASKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN61	Transcriptional regulator, putative	0.971	113-139	AQAPAKKAKDVKRGKSEDTSKPRKRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ94	Ulp1 protease family protein	0.973	708-737	RSRAKPSGITKPVRRGRDARRGKEDLKKKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQ94	Ulp1 protease family protein	0.934	473-501	EDRNRTKNGRLRRGARGQTARDRERQRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQR5	Tryptophanyl-tRNA synthetase	0.984	408-442	RKLEWRGNPNPVPKPPSEEKPEEKGKGKGKGKDKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSI8	Uncharacterized protein	0.832	252-260	KEKRRARKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT75	Uncharacterized protein	0.834	28-39	KRIKAKREAKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUQ7	Cation-transporting ATPase	0.707	1407-1423	SAGRPPAEGRGGRIPGA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWV6	DUF788 domain protein	0.707	157-166	KRQKKMEKRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZJ4	BUD22 domain-containing protein	0.817	331-367	RRKNRMGQQARRALWEKKYGSGANHVRKEQEKKKNSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FZJ4	BUD22 domain-containing protein	0.687	386-399	NRFGKGRSGPGAGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5C3	CobW/HypB/UreG, nucleotide-binding domain containing protein	0.834	618-646	RRPPSPPNRAAGRKEGTHAPHPSKNHKHK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9Y1	C2H2 finger domain protein, putative	0.989	458-476	AKKPSQKKSRKRAPRKSPP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9Y1	C2H2 finger domain protein, putative	0.974	1169-1191	PRRRGRPPGSKNRKPTKGAVKAA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G9Y1	C2H2 finger domain protein, putative	0.902	886-903	KKSKPASRPPGRPPGPKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GH65	SWIRM domain protein Fun19, putative	0.705	229-241	RLNRTPRVKRTPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GH65	SWIRM domain protein Fun19, putative	0.615	221-222	KR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZ88	DUF1308 domain-containing protein	0.902	163-179	KRKNKGKTGNKDKDKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F985	Ribosome recycling factor domain-containing protein	0.904	75-84	KKKKDKGKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCA5	CTD kinase subunit gamma	0.862	316-333	SSAKTNGESSKRRKKVSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCA5	CTD kinase subunit gamma	0.81	417-432	RARQKAELLKKEKRRQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FCA5	CTD kinase subunit gamma	0.63	309-313	KRKAE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FPE1	Ribosomal RNA processing protein, putative	0.924	411-444	NGSGKDKKRKRDEATASTTGKQEQKNKKKNKRSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQV4	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.865	445-461	AGKPKSRRQLKREERAQ
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRC0	Transcription elongation factor Spt6	0.981	71-85	TRSRREKRKRRREER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FRC0	Transcription elongation factor Spt6	0.649	119-124	RLKRGH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSN7	Transcription factor iws-1	0.997	90-115	RFKRKRDGEDGERPKRKEGRRKKRRD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSN7	Transcription factor iws-1	0.988	124-142	GEGKGRRKRDGERRKRREA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSN7	Transcription factor iws-1	0.919	155-178	RRRRALDRAMDEALKKPTKRRARK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSN7	Transcription factor iws-1	0.623	420-425	QKGSRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSN7	Transcription factor iws-1	0.614	413-415	KAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTX6	Uncharacterized protein	0.846	4-33	KKQAEPKKSKKTVEDKTFGMKNKKGGSARK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTX6	Uncharacterized protein	0.807	50-64	AKRKEAEKARREAEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWF6	60S ribosomal protein L36	0.964	2139-2158	KRARKLAKKRLGTFGRAKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXM0	40S ribosomal protein S6	0.981	146-220	KRLGPKRATKIRRFFGLDKKDDVRKFVIRRTVTREGKKDYTKAPKIQRLVTPQRLQRKRHRIAIKRRRAEAAREA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXM0	40S ribosomal protein S6	0.973	229-252	ASRVHEEKAKKSELRKRRASSMKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXM0	40S ribosomal protein S6	0.74	102-111	RRTGERKRKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYW0	Uncharacterized protein	0.896	196-210	EKVDGKRVKKDPKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYW0	Uncharacterized protein	0.811	328-349	KKRKSSAEEPKLLEESKKKKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYW0	Uncharacterized protein	0.727	398-402	KKKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYW0	Uncharacterized protein	0.601	365-365	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0S6	Uncharacterized protein	0.903	141-165	LSKKHQFRLERKYRRRAALKYARPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA64	BAR adaptor protein RVS167	0.757	348-360	SKGAPPPPPKPKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GA64	BAR adaptor protein RVS167	0.68	281-295	RKPGSKFAPPGKDKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBJ4	RNA polymerase II transcriptional coactivator, putative	0.749	30-38	GRSKKVKRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYW5	Ubiquitin ligase subunit CulD, putative	0.795	12-22	GGKRKSIGKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I658	Protein kinase	0.822	1271-1279	SKGRRRRPS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F934	DNA topoisomerase I	0.979	149-239	KKLAKEKVKIEKEAAKEAKAIRKDEAAAAKKSTAKNAKATKPATNGKKQTNGIKKEASDDEPLARKAPAKKVKAEPKSASSTPVKKGKGKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F934	DNA topoisomerase I	0.706	380-392	KKALPAAEKKRLK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F953	UDENN domain-containing protein	0.759	75-81	RPKRRRH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F990	AAA family ATPase, putative	0.999	29-52	PSRSARSKSKSKKKSRPSKKRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F990	AAA family ATPase, putative	0.782	378-387	RRPGLRKRKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F990	AAA family ATPase, putative	0.624	195-198	PRRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9G2	Cytoplasmic tRNA 2-thiolation protein 1	0.782	350-365	KKKKVTGTKAKGVKPL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDQ1	Siderophore transporter, putative	0.897	254-269	RHKAKKKGLLHKKERS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FGU6	Transcription initiation factor TFIID subunit beta	0.969	85-100	AKAKKRGRKSKVEKER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLF4	Structural maintenance of chromosomes protein	0.961	58-86	KMPAKRRRRTTADIPARRAARPSRGRRAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLF4	Structural maintenance of chromosomes protein	0.704	158-168	RKRKSMAHPRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLF9	CUE domain protein	0.997	631-662	RGRGGSGRGGRGRGRGGRGRGGRGRGRGGGDV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLF9	CUE domain protein	0.911	674-704	ARQKKDVNKASRANHNRRDQRAKKIARGGGL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLF9	CUE domain protein	0.889	307-317	QKHKKKSKGKD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMG4	Cytokinesis protein SepA/Bni1	0.892	1675-1694	ARRKGSAEDERRQRRMRRRN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMG4	Cytokinesis protein SepA/Bni1	0.89	1580-1593	QRDRRRRARLKERH
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMG4	Cytokinesis protein SepA/Bni1	0.776	1037-1079	PPPPPPPPPPPPPGFAGGIPPPPPPPPPPGAGIPGPPPPPPPP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQR8	SNF2 family helicase/ATPase, putative	0.814	948-956	HKKRKREVK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT71	Sister chromatid cohesion and DNA repair protein (BimD), putative	0.99	1332-1362	AKKAKKTKGRSLPIRRSSAAGNPKLPKKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT71	Sister chromatid cohesion and DNA repair protein (BimD), putative	0.695	1471-1482	KKSTRAKLKSTP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT71	Sister chromatid cohesion and DNA repair protein (BimD), putative	0.666	1560-1568	LPARRSTRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FT71	Sister chromatid cohesion and DNA repair protein (BimD), putative	0.615	1522-1524	KRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0J2	GPI-anchored wall transfer protein 1	0.769	97-113	KKAQKTQKAKPPRSASR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2M8	Uncharacterized protein	0.956	26-42	RRKRKKDAVRSRRQKAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4L3	Ribosome biogenesis regulatory protein	0.984	187-219	SIRGESRRERVERIKRNERKERANDRKQRKAGN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G4L3	Ribosome biogenesis regulatory protein	0.837	100-139	KPLPTPKAPTKWELFARKKGIGKYNTKPGAALADKERRKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5M0	Uncharacterized protein	0.756	22-32	RPQKARQRKRL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5S1	Ribosome biogenesis protein Nhp2	0.992	7-35	DKEKKREKKDKKRAETDGVHKSKKDKKSK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5S1	Ribosome biogenesis protein Nhp2	0.79	97-122	KKVLKSVKKAAVNKSLKRGVKEVVKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDM9	Uncharacterized protein	0.737	171-178	KKRAKARK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDM9	Uncharacterized protein	0.686	75-83	KSVRSKAKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZR9	CUE domain-containing protein	0.973	140-168	RGGRGRGGFEGRGRGRGDRGRGGRGGRAG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HZR9	CUE domain-containing protein	0.752	11-31	PRGRGSARGGRGGYSSRGGRG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I239	Uncharacterized protein	0.999	137-229	KKRKLSPASKEAKRIEKEAKEKQKLEEKAKKEEEKAKREEEKRQKEEERKKRDAEREEERKKKEEKKKLKEEERLAKEEERKKKEDEKIKKER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3R2	Delta(24(24(1)))-sterol reductase	0.984	567-601	EKRRKRNREKESREEKERIRAEKEEEKNWAMARRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I3R2	Delta(24(24(1)))-sterol reductase	0.86	724-732	KKKKNKKIT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5X4	BZIP transcription factor FlbB	0.935	51-76	KKSTREGQAPKRRGPKPDSKPAQTRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5Y6	Transcription regulator BDF1, putative	0.998	628-676	KKKKTPPAGKKSGKSKNGKKDSKKSAGGGGSGLAKKDKKGAAKPSKPEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5Y6	Transcription regulator BDF1, putative	0.78	378-403	KKPKKTAVPAPKTQAARRESRVAAPG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5Y6	Transcription regulator BDF1, putative	0.777	439-461	RPKRSIHPPKRDLPYTTKPKKKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I681	Nucleolar complex-associated protein 3	0.993	351-375	VRGKKKEKKEFRTKKLRKLLKERKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I681	Nucleolar complex-associated protein 3	0.828	48-57	RRPRKAKKDK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8F0	Exosome complex protein	0.999	208-251	GKSGNAKAAKSKRQQDKQERKDAQKERRRKKNEKRKARRAAQKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDE3	Ion channel	0.963	391-416	ESIRSGRMKSGTGYRKKLRRKPIRSA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMB7	Ribonuclease H2 subunit B	0.992	392-427	RAEKKRRKEEEEKKKKAGLSRGVKDLKKVDTSGMKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMB7	Ribonuclease H2 subunit B	0.753	433-441	GKAAAKKKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU90	Exosome component 3'-5' exonuclease	0.821	698-707	KKKRSKGSKN
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU90	Exosome component 3'-5' exonuclease	0.719	661-667	GGPRKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVU3	Uncharacterized protein	0.87	300-308	RRRPRRRRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FWF7	Glutaredoxin domain-containing protein	0.653	55-61	RRSKGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FYB9	Uncharacterized protein	0.649	15-22	GRRHGQKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G0U9	Mannose-1-phosphate guanylyltransferase	0.723	111-117	NKRKRSE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G303	Signal recognition particle 14kD protein, putative	0.996	111-130	KKRDRSGKKKKGKAGKVTKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G723	Viral A-type inclusion protein repeat protein	0.996	657-672	GGGKKKKNKKKKGGKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G7I9	Mitochondrial 54S ribosomal protein YmL32	0.883	70-87	PKKKTSHMKKRHRQMAGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYE8	DnaJ domain protein	0.99	12-77	DKHKTKTKEKEKDKEKDKDREKDRERSERVKAKPKDPHPLSQRIVIPPPPPKDSPKPPDARPHPHP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I109	Acetylornithine deacetylase	0.764	1293-1300	KRTRKRRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1V9	Uncharacterized protein	0.903	104-134	PGKDAAERAEKAKKNNRWSWMRKPAKEDKGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I327	Uncharacterized protein	0.636	187-193	KEEKKEK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5L2	C6 transcription factor, putative	0.904	87-96	EPRPRKRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5L2	C6 transcription factor, putative	0.65	958-964	KKGMRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FDL7	Pre-mRNA-splicing factor SYF2	0.759	244-251	LKKRRERR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FJ57	SAGA-associated factor 11	0.983	306-329	TKKKKPNPTPKKMAGKKPPPASKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN84	Cactin, putative	0.985	950-988	KQGSHKKSMKSDHPAPQRQRSGAKGGRAAKISARRKRAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN84	Cactin, putative	0.807	11-30	SKRSRSRSPPPWRHPQKLPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FN84	Cactin, putative	0.634	82-88	KKKAEIR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FND3	OB-fold nucleic acid binding domain-containing protein	0.996	230-265	RARKRLEQRRRKAARKEQRDKIRIQKRWERDEKLRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FQK9	AMP dependent CoA ligase	0.923	557-582	SPSGKILRRFLRDREKELRRKAGGKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FR44	Peptidyl-prolyl cis-trans isomerase, putative	0.996	193-223	KLRKRDKIAVAEKKEEGKPVVKKKKKAKGGK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FR44	Peptidyl-prolyl cis-trans isomerase, putative	0.971	284-307	PRPRKRQRSKSPSRGPEDRRHRIK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FR44	Peptidyl-prolyl cis-trans isomerase, putative	0.927	536-569	VGERRKGRASERDREREFKRGRTGDLEWDRERKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXS2	Uncharacterized protein	0.995	54-106	QGKFRFKSSKSKPQSKRDAPSEEDGEDRRHHRHHRRRHHHGRHRHSSKREKTD
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXS2	Uncharacterized protein	0.868	199-216	LREERARAKERDQRRRRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FXS2	Uncharacterized protein	0.741	232-241	RRGQARKKMK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1E1	SNF2 family helicase	0.928	840-854	KQSRSTKSKTKKRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1E1	SNF2 family helicase	0.728	287-295	KPQNKKRRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1E1	SNF2 family helicase	0.639	270-277	RRSNRARK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G1T8	PB1 domain protein, putative	0.818	664-681	PSQRRRANSRRPEVRKFR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3V3	Nucleolar protein 9	0.989	3-31	REKQKRGRRAEEKKRKREEIPEEAATKRP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3V3	Nucleolar protein 9	0.662	652-660	RRRGEWKAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G652	BZIP domain-containing protein	0.985	26-74	NEGKGKRQENGKPKSKPISEKRRLQNRQSQKTFREKHRRQKQLLKRVGG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G714	F-box domain protein	0.892	692-701	GARRRRRRAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GC95	Dynamin-like GTPase Dnm1, putative	0.91	542-553	EEKRRREKRRMK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GCZ2	MI domain-containing protein	0.996	28-54	KKRRRNGPATRKERRKEERAQKRGRHA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQK2	Protein transport protein sec16	0.821	1802-1814	RKGGTAKSKRKGR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQK2	Protein transport protein sec16	0.78	1603-1635	KKAEKERKDREADEAFRKAAEADAKKSAQPGKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTL5	Serine protein kinase Sky1, putative	0.754	290-301	KEDNRNGRRRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HTL5	Serine protein kinase Sky1, putative	0.677	32-36	KKRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYN6	Ribosomal protein	0.724	94-103	NKNKKLIKKL
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I1C2	Uncharacterized protein	0.936	51-98	RKVRHNRRLARPPEPDRLHAGWLPRGVRDEVRVNRKQRADRRKRVREF
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F6V3	Uncharacterized protein	0.987	15-64	KPSGVSKGKPSTLSSGSRVSKSSAKVKRPPPKEMKSKARTAPENLKKKKT
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F6V3	Uncharacterized protein	0.974	133-173	REAKRKEAEARQQEKKSKLEETKDSLRRKKRKSNDDMPSKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F6V3	Uncharacterized protein	0.777	87-94	KPKGKKKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F6V3	Uncharacterized protein	0.73	182-189	TKSKGKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8V3	pH-response regulator protein palI/RIM9	0.981	334-399	RRGPPPGPVLRGRGGFPPRGGYGRGGPYGGPRGPPPNGRGRPMGPVRGAPPGPGMRGRGQRGPPPG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F8V3	pH-response regulator protein palI/RIM9	0.673	183-187	KARKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9B4	MFS transporter, putative	0.646	42-47	KKKLER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F9N6	Nascent polypeptide-associated complex subunit beta	0.859	18-31	GKGTPRRKTKRVHK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLR6	Transcriptional regulator Ngg1, putative	0.971	292-311	RASKGGKLKKRKERVSKEER
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLR6	Transcriptional regulator Ngg1, putative	0.783	730-744	LGKSKKGSQAKHRPG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLR6	Transcriptional regulator Ngg1, putative	0.698	159-167	GKGKGRETK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSX6	Cell wall proline rich protein, putative	0.994	351-396	KSKHKLRSKAHKRQKKVRSWAGAILTRGKGKKHHSKKTPQKSPPPR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FSX6	Cell wall proline rich protein, putative	0.75	844-853	LKKKGHRISR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FTD8	APSES transcription factor Xbp1, putative	0.917	454-474	RPRSNEQMRHDVRRKRRRASA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FUY8	Rhomboid family protein	0.723	549-555	RERKKRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FX52	Uncharacterized protein	0.792	548-558	RARRKSRSRSR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2C8	Protein phosphatase regulatory subunit Gac1, putative	0.758	437-460	KKPKARAEKHSVPGVGPRHALPRS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G2C8	Protein phosphatase regulatory subunit Gac1, putative	0.611	243-245	AKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G3B0	Uncharacterized protein	0.734	198-209	ARRRTVLKRGRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G490	Uncharacterized protein	0.963	421-432	QKRKRKRRVSRA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G5L1	Iron sulfur assembly protein 1	0.812	126-137	KPRRSRLRPRKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G6Y2	NEFA-interacting nuclear protein NIP30	0.989	145-164	GRKRRRDKKKESLIPGKRRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GBA4	Uncharacterized protein	0.991	94-125	SKKNGRVQKRRNKKPRSSIVFSRHSSKEKKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD01	S-adenosylmethionine-dependent methyltransferase superfamily domain-containing protein	0.974	22-88	TILKKRKASEVESKPASDKKRRTAKADNETQKSKIKPKAKQNANGKANNGAVKPERTAQQKKNPPKK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD01	S-adenosylmethionine-dependent methyltransferase superfamily domain-containing protein	0.686	714-723	KSSGAKSKKS
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD01	S-adenosylmethionine-dependent methyltransferase superfamily domain-containing protein	0.682	653-658	RLRRKG
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GD50	RNase H domain-containing protein	0.83	102-153	RHRISKPLKKWVSRLSKTNHPGGKARLDSTSRRDPESKQRCKDAKKQRKIQK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GEY8	C6 transcription factor, putative	0.78	52-61	RIRRNRPRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HQY0	SCD domain-containing protein	0.998	99-151	RERKKAARKAAAKRKSTTRGKGKSQTRAAKKPKIATNGTGRRLAIRSATNGKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HV69	Aminoacylproline aminopeptidase	0.974	1086-1108	KQRAAAKKASAQKKQKEKKRDPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HV69	Aminoacylproline aminopeptidase	0.803	878-893	IERARLQKEKEKEKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I420	Uncharacterized protein	0.605	97-98	KK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5I5L1	Uncharacterized protein	0.614	26-29	HRPK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5F939	60S ribosomal protein L12	0.815	86-99	KEPPRDRKKEKNIK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FAP1	Uncharacterized protein	0.847	254-262	HRRKKAKAR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FKG7	Phosphoinositide phospholipase C	0.929	773-784	KRDKRRRHKSKI
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLG7	RNA binding protein	0.998	508-555	RGAEGAPRLKVKTKSRGASKGKPKTRSSRRAAAYKAAGGRKGAQERKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLG7	RNA binding protein	0.923	427-451	PPLLPRKLRVTRARKVQKRREGTGA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLG7	RNA binding protein	0.843	351-357	KKKKKKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLG7	RNA binding protein	0.811	150-161	EAKRRSEKAKRV
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLG7	RNA binding protein	0.691	125-129	KRKRK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FLG7	RNA binding protein	0.641	474-483	GRAGAAKLKE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FMT2	C6 transcription factor, putative	0.932	57-68	GRAPRRKKRPLK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FU55	Cell division control protein 15, cdc15	0.778	1208-1217	PKRRPPTRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVS1	SAGA complex subunit (Ada2), putative	0.922	297-317	RKKRRIEERKEAAKSAPPATP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5FVS1	SAGA complex subunit (Ada2), putative	0.707	62-90	PPKRSSSTPVAPRKHPPSQSRVSTRLRRR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5G8F8	C2H2 finger domain-containing protein	0.602	382-382	K
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB44	Uncharacterized protein	0.97	184-222	RSPSRPRSLSRRRSRSRHRPSDREEIIIRRDEREGGRKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB44	Uncharacterized protein	0.778	107-131	ERDRERRRHLDRDEREEIRIRRRDR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GB44	Uncharacterized protein	0.681	88-95	RERPRPRE
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDP9	SIR2 family histone deacetylase (Hst4), putative	0.979	467-497	TNPKKPGPKKGAANKTTKTTKPRAKKEQTAK
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5GDP9	SIR2 family histone deacetylase (Hst4), putative	0.892	56-68	RPAKKRRRVEPKP
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HR67	60S ribosomal export protein NMD3	0.946	414-429	ARKKKNKSRNWRLKRM
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYG8	Chitin synthase	0.93	783-802	RPSRARPKRLQKKRLWPFKR
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYG8	Chitin synthase	0.798	1457-1475	KKRAEEEAKRKAEEEAKKA
UP000018001	Byssochlamys spectabilis (strain No. 5 / NBRC 109023)	V5HYG8	Chitin synthase	0.77	1313-1323	KKTRKVKKQVR