ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W4Y4	CCHC-type domain-containing protein	0.692	263-271	LKKLSKKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPH8	CCHC-type domain-containing protein	0.615	199-201	PRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X257	60s ribosomal protein l32	0.928	9-52	KKRTKAFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQLPMPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE50	RRM domain-containing protein	0.996	113-243	RSRSPRTRNGRDGPRSHSHSISRSRSRSPPRYRGKGGENYRDSYRSGRGGGFGRRPGRGAGRGGRDFRRGGSRSRSRSPVRRGVGPRRRSPSYSRGGYGRMRRSRSRSRSYSVRSSRSRSFTRSRSRSRSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE85	Nucleolus protein	0.999	201-299	SSKSKDKKKDKESSSHDETKEEKKRRKEEKKAKKEATDSEKSKKRKAEETGEESKEERKKRKKAEKEAKAAAASSKDGREAPSEEENNKEKKKRKSADK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE85	Nucleolus protein	0.991	157-177	GKKDKEDKKDKKDKKKRSKED
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE85	Nucleolus protein	0.948	307-318	SKKEKEKKHKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF54	Uncharacterized protein	0.933	46-60	KTRTKLKKKSKNRKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN06	White collar photoreceptors-like protein	0.776	251-257	KKKKLKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRN9	Uncharacterized protein (Fragment)	0.689	79-84	RKKKWK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSC9	2OG-FeII_Oxy_2 domain-containing protein	0.71	52-60	IRFRMKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSC9	2OG-FeII_Oxy_2 domain-containing protein	0.65	313-319	KRRVPVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVU9	Uncharacterized protein	0.731	68-84	RSHKGPQGPRNGTKKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWA1	Zn(2)-C6 fungal-type domain-containing protein	0.956	352-369	ERQTRPAKRRKLRHRAPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y8J8	Histone H2B	0.997	18-51	SKAPAKTEGSKAAKKTSKPAPADGEKKKRKKARK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YK51	Uncharacterized protein	0.63	994-997	KHKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YK51	Uncharacterized protein	0.605	1280-1281	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YLC9	Gtp binding protein	0.975	60-77	RRRGPGKAKKGSKAKQGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YMB1	DUF262 domain-containing protein	0.982	284-296	GRKRKRKGKEKAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YTC9	Transcriptional repressor ctcf-like	0.843	93-109	RHRRRKHNYIPKPRKSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZE9	Pheromone-regulated membrane protein prm10	0.994	213-228	KERRERERKEKKRRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMN0	Uncharacterized protein	0.955	156-177	PKKEEKKKEEPKKLSKEERFAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMN0	Uncharacterized protein	0.827	119-132	EHRGKRPQRNFRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQN6	Cell cycle control protein	0.743	16-31	KKTKKYLSRPARKQVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRW4	Atp-dependent rna helicase prp43	0.97	728-755	KKRSGGTDTPSNGKKNSEPAKKKHKSAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1B3	Retrotrans_gag domain-containing protein	0.882	228-242	RKKREPIKPKITRKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X374	60s ribosomal protein l18	0.978	144-186	RNTREAVKHFGMGPHKHKKPYTISKGRKFEQARGRRKSRGFKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7V3	Homeobox domain-containing protein	0.935	181-190	KPTKKRRRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7V3	Homeobox domain-containing protein	0.636	76-79	RRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X994	Uncharacterized protein	0.939	338-359	APPNKRRKSNASSSKSAGRKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X994	Uncharacterized protein	0.698	192-197	SRRKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XB12	USP domain-containing protein	0.967	170-186	KKRQPPPPKRSKGSRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XB12	USP domain-containing protein	0.956	405-447	EKKDKGEKGSSWGEKIGKRISMTVGLGRSGSLKKRKSRSRSRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XB12	USP domain-containing protein	0.938	935-947	KPEKKPKKPKPTI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XB12	USP domain-containing protein	0.904	1017-1034	KDGKGKKMGVRAKDKKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XB12	USP domain-containing protein	0.6	594-594	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XG90	Uncharacterized protein	0.608	90-91	RR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNB7	Uncharacterized protein (Fragment)	0.907	73-85	KKKEKEKEKKGAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSI0	Uncharacterized protein	0.986	174-192	KRKLSKSARARAKKRQKKD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YI91	Chaperone	0.981	277-308	KKVVKKETAPKKQVAEKSKPSKTKDRKAKKDR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YI91	Chaperone	0.927	442-453	GFRKEKNKKKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YI91	Chaperone	0.851	135-155	KKNVKKPSGKTNGAPKAQKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WAQ0	Uncharacterized protein	0.891	54-77	AKRPQKFRHNRNRPAPIIRRSKLR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WDE0	Uncharacterized protein	0.774	336-348	AHSRALRRQRRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK76	OTU domain-containing protein	0.998	343-371	AKARKRERERKEKEKREKKVAKAKEKGAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK76	OTU domain-containing protein	0.95	905-938	KGKRKLVPNPNNTAGRPLTRRERKRLGLPKPRAT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK76	OTU domain-containing protein	0.876	410-432	KPRSKAKGKASTSNPKSKSKEVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK76	OTU domain-containing protein	0.866	217-237	EKRQRRRELQRQKEEDAKRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK76	OTU domain-containing protein	0.726	170-176	KKKVKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMK6	CCHC-type domain-containing protein	0.842	191-206	KKDERKKEEPKKLTKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WP46	Retrotransposon nucleocapsid protein	0.969	474-486	HRPKGKKKRKIQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WU92	Methyltransf_25 domain-containing protein	0.729	158-172	RRKTTGSKVAKPKGP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3Z1	Uncharacterized protein	0.954	191-212	RQGRERVRREKKEEAERKRKDA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3Z1	Uncharacterized protein	0.792	788-812	SRRHSPPGDRQRARKPCSKYERRRD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6L4	RNA-dependent RNA polymerase	0.805	246-265	LRKRPTERPKSPPMIRAPKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6L4	RNA-dependent RNA polymerase	0.705	35-42	EKGRKPPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD84	Poly + mrna-nucleus export-related protein	0.995	214-277	KFEEERRIRETEERRRREEEERRQAEEKRKREEEERKRKEAEEERKKKEEEEQREREEREARER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD84	Poly + mrna-nucleus export-related protein	0.754	15-23	RRSKTKRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN40	Gtpase effector dia diaphanous	0.924	1167-1232	PPPPPPPPPPGKGIPPPPPPPPASAPPPPPPPPGMAPPPLPPGPPPPPMASKGPATPGFTKPGKRL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN40	Gtpase effector dia diaphanous	0.797	1077-1096	SRPKSEKEAKLRAPPPPPPG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN40	Gtpase effector dia diaphanous	0.607	1121-1125	PPPNR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQJ3	Uncharacterized protein	0.994	622-675	SRGRGHGRGGRGARGGGGRGGGSGGNEARDRARKDRRGNQDRRRGHDKKMAKAG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YLD3	Phospholipid-transporting ATPase	0.996	45-65	RAERRKKRRRKGFFRRASEKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WL51	CCHC-type domain-containing protein	0.854	123-138	RKKRELIKPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRN0	Uncharacterized protein (Fragment)	0.916	2302-2317	WRNVYPRASRKKKKEA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRN0	Uncharacterized protein (Fragment)	0.913	1226-1245	SPSPRSRRRSSRSRSPRSLR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRN0	Uncharacterized protein (Fragment)	0.68	1546-1559	RSRSPSRSRSRTPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZ98	Distal-less homeobox 3	0.604	343-343	R
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X272	Translation initiation factor	0.92	124-133	KKKKKSSKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X272	Translation initiation factor	0.895	87-93	KKKKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X272	Translation initiation factor	0.751	13-18	KKRKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3A1	Caspase domain protein	0.861	613-662	PPPATPPPPPSQPPPRKSPTPPPPHGPPPVTPPPPPPPPPEAPKVSKWKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9A5	Bar domain-containing protein	0.817	299-315	SKSRPSRPSSRASRKRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9A5	Bar domain-containing protein	0.77	160-172	EKMKNSKKEKDRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDU8	Actin assembly	0.991	123-151	KKIGAKKDAKSGKTTVEKKKKKSGSKGGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDU8	Actin assembly	0.947	225-241	AKEPKKPKPPPPPSRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDU8	Actin assembly	0.654	279-299	PPPPARPNAAVPPPPPARPNA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDU8	Actin assembly	0.624	301-311	APAAPPPPPAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE97	Uncharacterized protein	0.969	29-43	RKQHKTRRSPRKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKG2	Uncharacterized protein (Fragment)	0.915	80-88	RKKRKQKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XL15	Argonaute-like protein	0.872	71-110	RGAGGGGRGGGTRGSGHEPRGRGRGDSNVRSRGGFSPRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XL15	Argonaute-like protein	0.87	969-987	KKKDKTGSKGKAKEAEKQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMM5	Glycosyltransferase family 1 protein	0.693	224-229	RKRAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YCV9	Uncharacterized protein	0.659	407-412	RKGKKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YFX0	Uncharacterized protein	0.745	363-371	KTAKRHKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YSA5	Chromosome segregation in meiosis protein	0.957	93-113	KAGNKDSKKDGEKKEKKKPMR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W9A4	ArAE_2 domain-containing protein	0.721	132-138	KRKRSKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W9A4	ArAE_2 domain-containing protein	0.667	550-555	VKHRKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W9A4	ArAE_2 domain-containing protein	0.624	814-817	RRNR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WGE9	Uncharacterized protein	0.865	97-112	RRRSGRQKKIRKTEIH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUE4	Uncharacterized protein	0.985	303-335	AKTKKPKGSSKDANPALPPTGLKKEDKKKKKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUE4	Uncharacterized protein	0.62	655-657	KRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X706	Mitochondrial mrna processing protein	0.977	87-112	LGKPKKRKKEQKAEVDERQRGKLPKY
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X706	Mitochondrial mrna processing protein	0.949	711-738	RHIRELRKLARRGRRASERLAAEERGKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7J5	Small nucleolar ribonucleoprotein complex subunit utp14	0.996	460-499	RRKELRRMRELMFRAEMKAKRVKKIKSKVYRRIKRKEKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7J5	Small nucleolar ribonucleoprotein complex subunit utp14	0.98	128-139	KKKSKTKKKKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7J5	Small nucleolar ribonucleoprotein complex subunit utp14	0.836	782-797	SKNKMKKLARKANGGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7J5	Small nucleolar ribonucleoprotein complex subunit utp14	0.754	913-938	KKAPPKPHLIKRVAGIDPKSRADYRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9W8	DUF262 domain-containing protein	0.996	285-302	KGKRNARKRKSQGKRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCY4	Uncharacterized protein	0.996	666-709	TPIGSKRSRPSPTPPKASSIAKTSKRSKAGPRERKAAGKKRATK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFQ9	Ribonuclease e	0.948	209-225	AKRGRPTRRDKIKKAKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN74	Uncharacterized protein (Fragment)	0.837	27-47	KSTRKQKKLAKQMASKFKKTP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XY70	C2h2 transcription factor	0.802	491-505	NEFKELRKQWRKAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W545	Uncharacterized protein	0.995	9-36	PSKKKAPRKKKMQPGARPLRAGPSKVRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTF4	Uncharacterized protein (Fragment)	0.796	10-23	RRSKAGSRKSNKKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WU17	DUF262 domain-containing protein	0.914	480-516	MSKRAKTKRKLNPEPQAGPSRTIAVKQEKKSVREKKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZG7	Trna pseudouridine synthase 3	0.843	503-521	KRWKLGKGFRRDERKRTAG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3B8	Uncharacterized protein	0.894	70-85	RSRKMRRGRMGGIRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6B0	Uncharacterized protein	0.631	218-224	PKASRSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE78	Mitochondrial ribosomal	0.738	142-151	KPPKGRMRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XG49	Pre-mrna-splicing factor cwc25	0.997	165-221	NGIKPKKNKKEKKWEKEERKRVNYEKKYEKQREDDRHSRRRSRSRSEDRYRRRSPSP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XR72	Uncharacterized protein	0.819	262-275	AVRIAKKKRSVGSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y0W4	Gtp binding protein	0.613	8-11	RGNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y1B2	Small nuclear ribonucleoprotein	1	487-532	KKVKLSKEEKKALRKEKKVKAKAEAKADGDDKKKKKKDKKEKKSKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y1B2	Small nuclear ribonucleoprotein	0.997	455-470	PKKEKKKDKEKKKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y8R9	Uncharacterized protein	0.685	98-103	RSRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YCW3	Axial regulator yabby 4-like	0.814	77-87	RGKPTKPKKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W4F8	Uncharacterized protein	0.925	672-683	HRPKGKKKGKIQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK08	Uncharacterized protein	0.837	173-193	APKKAKHSGSTKPKPAPTNPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNI8	Signal recognition particle 14 kDa	0.98	94-138	RKRDKKREKQRAEQVAFKKKRLNEPVIVNGPKRGNGRKKRQRQMK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WR69	Uncharacterized protein	0.636	43-51	RRVIKWRNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTX6	Phosphoprotein phosphatase	0.997	210-227	RPKEKEKKAKKAKKAKKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WY25	Uncharacterized protein	0.969	477-492	PRGEKRHRHRRHRKHG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WY25	Uncharacterized protein	0.79	533-554	KRSDKKWNDKLKRSNSAKAPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WY25	Uncharacterized protein	0.736	61-72	HRSRSHRHRHRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7N1	Plasma membrane channel protein	0.851	276-290	PRSGKKRDKSEWRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XB08	Uncharacterized protein	0.693	192-196	RRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLH8	Pin2-interacting protein x1	0.999	116-143	RQKKEQKKEKKRKREEEKEEKKKRRRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLH8	Pin2-interacting protein x1	0.993	374-396	KEKKQKIRDGNKDKKKDKKRRNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLH8	Pin2-interacting protein x1	0.993	451-465	KKEERKRKKEKKKNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLH8	Pin2-interacting protein x1	0.942	417-432	KKKKRKEEHRLAKTRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMF7	Uncharacterized protein	0.73	349-355	HLRRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XP64	Spc7 kinetochore protein	0.825	503-532	KSIPKPTNRPPSPKKIPVFTPKSPGKSAPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XP64	Spc7 kinetochore protein	0.819	28-41	TRRKRRAHSIAPGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPG4	3-dehydroshikimate	0.875	101-111	KRKKAFKRARG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y4Y7	Uncharacterized protein	0.802	186-200	RRAANPRKKLKTEPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKR3	C6 transcription	0.708	32-36	KRRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZ75	Ring finger domain protein	0.996	507-535	KMRRSKRREKGRKDEKARARAEERERERR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZ75	Ring finger domain protein	0.837	647-667	GGRKKRSNKLVVLGGGGGRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X054	Uncharacterized protein	0.984	35-69	KRKGKLKTLRHKSRHTGRLRLQKTIGRLRQRRRRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X400	Tbc1 domain member 20	0.714	471-477	GRRRRNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9I0	Uncharacterized protein	0.803	100-133	KPSEPAKDLKGKQKAIDPEPEPEPNKHSRRRQRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAQ9	Protein kinase domain-containing protein	0.979	804-821	YKRARERWRLRKGRKRPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XB90	Uncharacterized protein	0.981	843-861	GGPSKLRGRKKKSNHGRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XB90	Uncharacterized protein	0.723	140-148	SPRRPRRFP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XB90	Uncharacterized protein	0.647	123-129	RHHRRHH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBF9	Uncharacterized protein	0.971	276-302	KRSKSHKHKSSRSRSSKRHGHGRSGER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHE5	Uncharacterized protein	0.828	12-37	KQKKRSLSPRAGGGGGGRGGGGSGGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRZ6	Uncharacterized protein	0.882	67-96	NRDPKTRRRDDPRKGGGPEFWGEGGKGGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYI6	60s ribosomal protein l28	0.978	123-140	QKEPKVRPAKKPRGKKAV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYI6	60s ribosomal protein l28	0.648	87-94	SGGRRALR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y6T6	Chromatin modification-related protein	0.872	479-486	KKSGRKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y6T6	Chromatin modification-related protein	0.827	401-416	PQRRKGKGSNRNEPPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBM0	Uncharacterized protein	0.997	295-351	RSKRRSRSRSLSASRSRDHSRGRSQSRERRRARSRSRDSRSRSPRGYHSHSPRHRRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBM0	Uncharacterized protein	0.742	442-454	TRKVKLGRLARRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD05	Ribonuclease h-related protein	0.754	224-231	RRKRKPSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEK6	Nucleolar protein nop58	0.992	467-484	EKRRAKEEKKKKKAEKED
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEK6	Nucleolar protein nop58	0.992	491-505	EENKKEKKEKKRKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEK6	Nucleolar protein nop58	0.986	526-554	RKARKAAKKAAKAAAANGEDQPKKKKKKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU40	BTB domain-containing protein	0.706	410-416	GRRRRSP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ89	Wd-40 repeat-containing protein	0.696	205-209	PKKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WDA9	Aldehyde reductase i	0.642	132-136	KRGRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WI61	Chromo domain-containing protein	0.768	152-159	RPKRKNKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK59	Uncharacterized protein	0.664	75-80	GKKKQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X049	SAE2 domain-containing protein	0.659	637-642	RQKRKQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X049	SAE2 domain-containing protein	0.641	653-657	RYKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X909	Uncharacterized protein	0.831	105-117	KLRRRRTIRRTRH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCD8	Uncharacterized protein	0.986	147-180	RVKKKARQSTKPREKHPSRSHSHRQRERERPRHR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCD8	Uncharacterized protein	0.682	111-118	RGGRRRSS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XP67	Uncharacterized protein	0.625	672-676	RARRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRV5	Exosome complex exonuclease rrp6	0.889	751-764	KQKKRKRTKATGAG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRV5	Exosome complex exonuclease rrp6	0.818	822-833	KKKGKARQNKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRV5	Exosome complex exonuclease rrp6	0.685	776-780	RKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT61	Uncharacterized protein	0.986	284-316	GIKAKTVSQKEQEEKEKEQKARAERRARRSKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT90	RNA-dependent RNA polymerase	0.695	695-702	VKKMRPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXQ2	DNA polymerase epsilon catalytic subunit	0.961	16-41	RFRGGGGGFRGGRGRGRGGGRGGGKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZA0	Mitochondrial import inner membrane translocase subunit TIM44	0.866	188-204	KEARRLRRQKRLEKAGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YC13	Uncharacterized protein	0.615	61-65	KSSRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WHD6	Pro-pol protein	0.724	220-225	KKKKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQM2	Uncharacterized protein	0.98	155-167	KRRRRNRRQRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWW4	Hydroxyproline-rich glycoprotein	0.63	497-500	RKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXE6	Zinc finger with ufm1-specific peptidase domain protein	0.603	55-56	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZ44	Fork-head domain-containing protein	0.674	626-631	RERKRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2G6	Group protein	0.949	812-842	KRSRGTSLSRKKARSLVKVPKKDKDKEARSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2G6	Group protein	0.925	692-704	KERKRGRDRGKKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2G6	Group protein	0.847	188-199	RAKNKGKLRKPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHF9	Uncharacterized protein	0.659	64-74	KRRTLSRARAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLB4	Pseudouridylate synthase 4	0.869	867-876	KAKRRRMKRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRR4	L51_S25_CI-B8 domain-containing protein	0.916	170-191	EREKRLKDWKEQKAKEKAERKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTS8	Uncharacterized protein	0.93	241-262	KEKDVAIGKKLRRKLSKKIFMR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y8F5	Eukaryotic translation initiation factor 5B	0.999	253-362	KSGSKKKKKKKAKKDDEPAPAPAPAAGAKKKGGISALKAMMEEKKRLEEEARRAEEEERRRIEEEERKAAEEEKRKEEEKQRRKEKEKAKRELAKKEGRLLTKKQKEERA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y8F5	Eukaryotic translation initiation factor 5B	0.996	132-147	KEKGKKGKKGKGKKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y8F5	Eukaryotic translation initiation factor 5B	0.996	192-217	SKKEKEKLKKEREKAKKKAQAAAKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y8F5	Eukaryotic translation initiation factor 5B	0.97	79-92	ASSKKKEKKKTKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y8F5	Eukaryotic translation initiation factor 5B	0.801	396-404	ARKKKGPAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y8F5	Eukaryotic translation initiation factor 5B	0.764	4-12	KNKGKKGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YCS0	DNA-directed DNA polymerase	0.932	174-197	SKNKGKSVTESPEAKKPRKRNARA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YCS0	DNA-directed DNA polymerase	0.691	259-272	KRRNKVMKLAKSRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YCS0	DNA-directed DNA polymerase	0.607	346-347	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YCS0	DNA-directed DNA polymerase	0.604	101-102	RK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YQR3	Ribonucleases p mrp protein subunit pop3 kDa subunit	0.996	284-304	KEQRAEGRRAAKERKKRARRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YQR3	Ribonucleases p mrp protein subunit pop3 kDa subunit	0.973	74-90	RKRKKESKGNRPNKKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z214	Uncharacterized protein	0.837	487-509	KGKGMQKQKWIRLLSRRQRRIRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WFZ9	Uncharacterized protein	0.648	420-423	RRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WIL3	Tat-binding protein 7	0.973	937-982	EERKIKEEAERRKREREEHTDKRPIKPVVPKKEEDLTGKRKIELKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWW3	Uncharacterized protein	0.606	218-218	R
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZL7	CCHC-type domain-containing protein	0.639	230-236	KKRELIK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZN8	Uncharacterized protein	0.771	870-877	KARKRKIP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0N9	Histone deacetylase	0.91	365-376	PKKPTKSKKKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7K3	Uncharacterized protein	0.627	215-217	KRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCK5	Srr1-like protein	0.793	23-33	RKKRKNSQRPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQF0	Uncharacterized protein	0.982	356-379	KSRHRKRRNKRRSDANLSLRGRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQF0	Uncharacterized protein	0.971	403-416	RRSSKKKRGKKSQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQF0	Uncharacterized protein	0.799	653-672	NKKKEEEERLEKERKEKEAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQF0	Uncharacterized protein	0.658	97-101	KKARR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRX6	C2H2-type domain-containing protein	0.914	196-205	KRRRKPGRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YD38	Uncharacterized protein	0.686	16-24	ARKSSSRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z372	G patch domain containing 8	0.965	222-241	EIDKRKEKERKREEKELRKM
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWQ9	Kinase-like protein	0.654	599-604	RRIKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0N0	F-box domain-containing protein	0.924	60-75	SRLKKKVFALRKKRKQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPG7	Hat family dimerization domain-containing protein	0.619	71-74	RSKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS31	30s ribosomal protein s9	0.947	342-373	RRAKLLRRDPRMVERKKTGLAKSRKRYTWVKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y173	Mediator of RNA polymerase II transcription subunit 6	0.885	279-287	GAGKKKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y8S2	Uncharacterized protein	0.996	202-229	RKLPQPKPKEVKPQKQSKRRKRSGKGPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y8S2	Uncharacterized protein	0.983	45-72	REKKRAKNRERDRKLKEQAANSQKRRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W4Z3	Retrotrans_gag domain-containing protein	0.899	288-303	RKKKELIKPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQ59	CCHC-type domain-containing protein (Fragment)	0.926	228-243	RKKREPIKPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZM7	Uncharacterized protein	0.765	89-97	KRVRRKHPA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZM7	Uncharacterized protein	0.69	70-74	PRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBW9	Uncharacterized protein	0.828	364-389	RRHTRSSSSPSRSPARRALRRPQSGI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBW9	Uncharacterized protein	0.617	392-394	SRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIR3	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.733	285-293	QKSRLKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIR3	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.631	146-149	KKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMN1	Uncharacterized protein	0.993	150-168	DGKKNNKKKLNKKGKGKKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQD9	Uncharacterized protein	0.958	572-591	LSRSRTKSLKAKKGGKRPDK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ68	TBP-associated factor 4	0.915	358-366	PKKKRKKEG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y7M6	WW domain-containing protein	0.997	784-866	SRGRRQSRSLDRGGGMRSSRRLSVSRSRSRSRSRERLRSRERSKERQRSRDRGKPRDRDASRRDRSREVPERRPEGDHGAIPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y7M6	WW domain-containing protein	0.993	1267-1285	LGGKRRRRNQKKPRRMGRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y7M6	WW domain-containing protein	0.98	163-183	KGRRSSTSPPPKGRKKSRKAP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y7M6	WW domain-containing protein	0.979	887-909	HSPSAPRGRSGRAEKPRRARRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y7M6	WW domain-containing protein	0.887	1131-1167	QRRERSRSPPLPLKRDSSPPAPAPAPSKPPVKIRRPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y7M6	WW domain-containing protein	0.624	407-410	GRRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y7M6	WW domain-containing protein	0.619	1019-1022	RPRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YI99	Saga complex protein	0.976	466-474	PKRKKKRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YI99	Saga complex protein	0.863	627-638	PTPVKRRKLKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YI99	Saga complex protein	0.844	1094-1111	KKKKGVTGVGKGNGRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YI99	Saga complex protein	0.725	428-433	LRKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YI99	Saga complex protein	0.6	820-820	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YPU2	5'-3' exoribonuclease	0.716	969-977	RGGRGRGRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z148	tRNA-splicing endonuclease subunit Sen2	0.783	105-132	RRIRDRKAGAKGLTSEEFREKRRVERRQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XC55	Uncharacterized protein	0.664	39-43	KKKSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD27	Ribosome biogenesis protein NSA2 homolog	0.97	14-63	HGRRLDYFERKRKREARAAHKSSAVAQKAFGIKAKLLHAKRHAEKVQLKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD27	Ribosome biogenesis protein NSA2 homolog	0.713	107-116	KQKRKDKAAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDS9	Uncharacterized protein	0.701	67-78	KRLSRHKGPSRH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF32	Branchpoint-bridging protein	0.725	73-79	APRKRRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF32	Branchpoint-bridging protein	0.605	235-236	GK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJB4	G1 s regulator	0.823	341-363	NRKKKLRQFEEALKRKEAQKELR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJB4	G1 s regulator	0.678	65-75	KQKAKAERQAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJB4	G1 s regulator	0.658	48-53	VKRARP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMY8	Mitochondrial distribution and morphology protein 34	0.612	651-653	KRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN24	Vacuolar import and degradation protein 21	0.973	122-137	KKGKHAKQKKKERERK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN24	Vacuolar import and degradation protein 21	0.753	719-724	KKRRRH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN24	Vacuolar import and degradation protein 21	0.747	732-742	RKSVKKRAEAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN53	Transcriptional repressor	0.968	923-1031	AREKAERQAAKKAAAAEKAAERTRIAQEKAAAKAAEKAKIAQEKAAEKEKAAALKAQQEREQAEKERIEKEKAKAERQAKAEREKAAQVERERVAQAEKDKAAKATKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN53	Transcriptional repressor	0.865	1064-1077	SKKPKKNKPIVTKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT82	Histone H3	0.605	57-58	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTD5	CCHC-type domain-containing protein	0.891	259-277	KPRRFQMAANKKKKFEKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTD5	CCHC-type domain-containing protein	0.696	149-156	KKKKDKGA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVJ7	Uncharacterized protein	0.996	253-276	PKRKRPRRERSKSSPPRPPKPAPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YJ01	Protein monoubiquitination-related protein	0.993	412-431	GRKKRKRKNKDPMAVKKKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRV2	Uncharacterized protein	0.806	390-398	QRKRKYKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0Q4	Uncharacterized protein	0.966	76-90	RPRSKRKDKSRRRSA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X114	Aaa family atpase	0.966	147-179	QRSLRPPTKPEKDRKEEQRRSRELRASRRGAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X114	Aaa family atpase	0.838	262-283	PPKPTKSAFNRRTGPGGRRKGP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X114	Aaa family atpase	0.769	1080-1093	ERKRREEYKKTKEL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9X0	Mrna-nucleus export-related protein	0.97	374-416	GGDSKSSRGWEKDRKKDREKDRGNRGQHAEDLRDKDRRKKDRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9X0	Mrna-nucleus export-related protein	0.711	205-212	KTRRSKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9X0	Mrna-nucleus export-related protein	0.618	367-370	KRSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCM5	Spindle pole body	0.932	520-551	GPPKAPPPKAAPPAAPAKKPPVEKSAATKPPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCM5	Spindle pole body	0.87	564-588	PPKKPVGKPPARLLAQKKAPGGDAS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCM5	Spindle pole body	0.811	593-618	PAAPAAPPATSAPKKPPPAATKSGKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEF6	Autophagy-related protein 9	0.96	104-127	RKPTPKKSKGKAKESRSSGSGKSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHG8	Velvet domain-containing protein	0.837	345-351	RKRRKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMH3	Uncharacterized protein	0.948	52-62	GKRPPRKRRKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNX4	Transcription factor tfiiib	0.98	557-575	RGREKEKKKGKKSNSRSRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNX4	Transcription factor tfiiib	0.974	169-196	PPPPPRKRKSNEKDGTEAPKNHKRKRKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNX4	Transcription factor tfiiib	0.941	229-240	NRRRRKGSRKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNX4	Transcription factor tfiiib	0.803	290-308	KKQNREKRARMKMLMERKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSI4	Uncharacterized protein	0.771	526-534	KRKPRHGRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT62	Uncharacterized protein	0.948	165-181	KKSRKEKKAEERSRKWK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y0L4	Uncharacterized protein	0.657	161-166	RKSRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YPS6	Triacylglycerol lipase	0.907	58-71	GPKRKAKLKDKKIS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YQS6	Transcriptional adapter 2	0.664	523-530	RGGKLRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YV24	Uncharacterized protein	0.664	78-88	RPSPPPTKRPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YV24	Uncharacterized protein	0.635	53-58	KKAAKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YW99	Ubiquitin conjugating enzyme family protein	0.713	285-294	PKARNSKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WB48	18S rRNA factor 2	0.944	233-269	KRAERKREKGEEMQLKPLPQPKKRKAEEDSSTKKRPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WLC8	Uncharacterized protein	0.707	512-518	RSKKKGI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQA4	Uncharacterized protein	0.93	76-89	NGKWVRRRRKPARK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRE2	CCHC-type domain-containing protein	0.851	88-99	KKPSRSRPKREK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZK3	Phd finger transcription	0.815	8-23	RRRKPKFKFTHQKQHK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4L4	Uncharacterized protein	0.907	351-380	EKSSRKKDSKREKGSSPSGSPTTKLNKRSQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8A3	Pathway-specific nitrogen regulator	0.801	90-97	RKRKRTRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIY7	Puf family rna-binding protein	0.91	10-37	KKRNAKFQAGPAPKKLHLEKPDKPAKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN97	Rrna processing protein	0.979	272-285	GTGKKKKKKTKSRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRV7	Nf-kappa-b-activating protein	1	200-233	ERRRRERKERKRRKEKEREARKEKKRRRSRSRQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRV7	Nf-kappa-b-activating protein	0.971	22-62	RRERERSPPRRSYRSRSQSRSRTPPRRDEGRGRDRGGRDRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRV7	Nf-kappa-b-activating protein	0.951	168-187	PARDLSPKRKYSNKKSKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRV7	Nf-kappa-b-activating protein	0.779	244-251	RRRRRSRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWL2	4F5 domain-containing protein	0.962	13-63	KAQKKASSQKKPKESGSTLAKRKEADAEALRAKQKKKEEEKAAAAGGGGGG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z2V8	AdoMet-dependent rRNA methyltransferase SPB1	0.999	808-869	KGMSSEHKKKEVKLVVAKGPNKGLKGRPKGVKGRYTMVDSRMKKEVRAKKRKEKANRKRKRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z2V8	AdoMet-dependent rRNA methyltransferase SPB1	0.977	749-783	AKQRALDARPIKKVAEAKARKKYKAAQRLEKAMKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z2V8	AdoMet-dependent rRNA methyltransferase SPB1	0.89	377-386	AKRKRERRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK16	Transcription initiation factor tfiid 55 kDa subunit	0.895	236-248	VRKRRFRKRINKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE74	DUF1708 domain-containing protein	0.961	990-1013	GKRRRQDRLREHQRKKDERREKRM
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE74	DUF1708 domain-containing protein	0.778	48-56	KKERKKAAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE74	DUF1708 domain-containing protein	0.777	671-679	GKKLKKREK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEA1	Uncharacterized protein	0.924	191-209	KRKRETSSDGRKGKLKRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKQ8	40S ribosomal protein S25	0.99	5-29	KAAAPSGGGKAAKKKKWSKGKVKDK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XP91	Uncharacterized protein	0.963	110-121	ATKKSKGKKKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XP91	Uncharacterized protein	0.938	165-176	GKKSKSKKQKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XP91	Uncharacterized protein	0.88	48-63	KKVGGGKKKGKVAGTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWJ8	Uncharacterized protein	0.888	367-381	AFKGKGKAASRKKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWJ8	Uncharacterized protein	0.785	156-177	RARKRLRGEPVSPSPNKEKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZX3	DNA mismatch repair protein	0.979	136-163	KPKRRSKAQKEFASDDDKPKRRRRSRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZX3	DNA mismatch repair protein	0.95	177-191	PKKRRKTAVKPKKEP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X193	Uncharacterized protein	0.683	50-61	KKARLNKDKDKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3Q6	Signal transducer	0.83	135-151	KIRKHAQKKAEKEKAAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCC8	Uncharacterized protein	0.976	293-307	ARKPKSKKGKNKPPA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XM09	Uncharacterized protein	0.629	221-224	ERRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVV9	Yhr097c-like protein	0.66	66-73	PPKSSKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYW2	Adipose-regulatory protein	0.937	273-291	KTRRKRRSKSSRSSSQRRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYW2	Adipose-regulatory protein	0.683	311-317	RRRPSRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YLR9	GATA-type domain-containing protein	0.816	332-341	ISRKSRKKLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YLR9	GATA-type domain-containing protein	0.627	238-241	KKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YYM5	Uncharacterized protein	0.628	285-288	DKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQG0	Homeobox domain-containing protein (Fragment)	0.812	162-169	SKRRKKSS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUI2	Kinase-like protein	0.605	605-606	RP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X233	Mynd domain	0.87	427-439	RKKAPEKKRIKYK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9T4	Pro-pol protein	0.619	143-145	KKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD92	Uncharacterized protein	0.73	585-594	RSATKGRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGB3	TPR_REGION domain-containing protein	0.837	459-471	YKRENKRRGKDEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSF2	Rad21 protein	0.81	337-347	SKLKKKLKEKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT32	Transmembrane gtpase fzo1	0.742	86-93	KEKRRKSL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUF1	Chromosome segregation protein	0.714	814-821	EKRRRWNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUF1	Chromosome segregation protein	0.701	964-973	SSKNKNKDKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUF1	Chromosome segregation protein	0.639	957-960	KKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZ10	Uncharacterized protein	0.983	137-160	ERHERKGEKRRRLRSIRWRRIFAH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZX3	DNA (cytosine-5-)-methyltransferase	0.998	1010-1037	RHAKRKGKNKRKPKKWSRIMRPIDTRRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZX3	DNA (cytosine-5-)-methyltransferase	0.803	292-298	VRKRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W8X1	MFS domain-containing protein	0.601	477-478	RK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WIS4	CCHC-type domain-containing protein	0.975	340-358	PKKEEKRKKEPKKLLREER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XB68	Uncharacterized protein	0.866	26-36	RKRARRKGNKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XK85	Thymocyte nuclear protein 1 isoform 1	0.996	264-285	KSKGKSKANKAKGKKRKLRGAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XK85	Thymocyte nuclear protein 1 isoform 1	0.929	199-230	RTKAAANGKPKTAPAKRSPTTRKAAAATPKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XK85	Thymocyte nuclear protein 1 isoform 1	0.89	297-305	RSPRRRKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLE5	Uncharacterized protein	0.798	578-586	TKRRRGKMR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLE5	Uncharacterized protein	0.639	654-660	SKPKIQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ19	Universal stress protein family domain protein	0.94	280-297	PERKLKKAMEKRRANPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y063	N-carbamoylsarcosine amidase	0.805	75-86	PRPSQKRKRQRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZC9	PC4 domain-containing protein	0.786	52-61	PIKKPKSKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUI0	Uncharacterized protein	0.793	325-345	RRGSRTRKPRDRYTPAPQVKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X652	Chromo domain-containing protein	0.774	125-133	KGSRGKRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6Y1	Uncharacterized protein	0.9	104-129	KMKRRKLKLLLANAGDERPSKKRRSG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7R9	Rnp domain-containing protein	0.999	17-122	RDRDRDRDRERERDRDREKDRDRDYDRDRDRERDRDRDRRDRDKDRGGDHWEPEERRNGERRKRSRSRSRSRRRSASPRRRSRRSRSRSRSRTRSPRSRSRSRGKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDM2	Rsc complex protein	0.996	512-552	PKAVKKKRGRGRPPKNTRAAAAAAKATAPVKSSPPQKKRAV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN68	Trna acetyltransferase	0.701	9-14	PRRKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUR2	Uncharacterized protein	0.976	155-168	RSPRKHRSPKKKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUU3	40S ribosomal protein S26	0.943	87-110	RSREGRRNRAPPPRVRWKDGKKVN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUU3	40S ribosomal protein S26	0.894	3-16	KKRRNGGRNKKGRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVZ4	Non-specific serine/threonine protein kinase	0.991	546-608	RRQQREKEKERAERERERAEREKEKERAQREREQKERERESQRERERERVEPPLSPSKSERRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YDS7	Uncharacterized protein	0.981	81-105	KAREAARTNELKEETKKKKRKKTAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXK6	Uncharacterized protein	0.827	71-82	RFSLKRSKSKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZ97	Peptidylprolyl isomerase	0.992	177-247	KGNKRPRESDATPEKTTPKTEKKKKKQKLDTDGANEKAEKEKSEKKKEKAKEEKATERELPGGLKIKDSKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJW3	Uncharacterized protein (Fragment)	0.654	607-615	KKPQRSFRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKZ3	Uncharacterized protein	0.78	271-277	APKKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNZ8	Exopolyphosphatase	0.932	375-387	KERKKGGKPKSKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0Q9	Uncharacterized protein	0.959	44-62	AKRRPGRPKGSGKKDPSST
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0Q9	Uncharacterized protein	0.892	66-95	NGTPTGKRPVGRPRKDGLPAGSAGPSRPRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFT4	Zf-cchc type zinc finger protein	0.992	33-48	APPKKRKRTSKKRKAG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFT4	Zf-cchc type zinc finger protein	0.969	72-95	KQKKEKGFKRKNRDPSESRRLKRI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YAA3	PWI domain-containing protein	0.999	135-377	RKARERDTRAFDERDRRARLDDIRGNERGGRGGRGGRGRGRGRGGRGGYDDDRGGGRPRDGGWGDRGRRRMSRSPTPRRRSPTPPSSGISRSPPPRRYRSPPRRRSPSPGRGGPRNERSPPPRRRRSPSRSISRSPPPPSRRRPRSPSVTPPRDRRPRERDSRSPPARRRRISPSPSPARSMSRSPPGHGYGKRRRSISPPPKRRRRSPTRSRSPPRRRSPSISKQGGGRRYSRTPSARSRSS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WCC5	Uncharacterized protein	0.679	4-10	PRRKGPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WLR3	Uncharacterized protein	0.916	81-100	KKRRAPREVVKPKVVRKEKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPQ4	Uncharacterized protein	0.999	131-157	APKAKGKTKKGKKGTKRKKGKKAPVGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTX9	Uncharacterized protein	0.986	367-384	ERRHRDHRRKRRHRGERE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYU2	Chtf18 protein	0.905	269-286	RARKKTRSGKKDPNAKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4G7	USP domain-containing protein	0.871	1087-1096	KRRSKKKASK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4G7	USP domain-containing protein	0.832	1340-1351	KKKRLKEVRKME
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4G7	USP domain-containing protein	0.683	1830-1834	RKRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBI3	Uncharacterized protein	0.814	194-202	PTSKRKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQH7	Mitotic cohesin complex	0.998	735-754	SKRGKGKPGSKRRKMKPKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQH7	Mitotic cohesin complex	0.989	77-113	RPKRSRKAKTGPPAKRARKEATTATGENTRKPRKPRT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQH7	Mitotic cohesin complex	0.963	553-576	RGKGRSRGGRGGATGKGRGAKSKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQH7	Mitotic cohesin complex	0.934	1466-1481	HPRPQRPRRNKTRGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQH7	Mitotic cohesin complex	0.926	1419-1432	DKPGGTKGRSKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQH7	Mitotic cohesin complex	0.878	1504-1518	KARPRPRRAYKTRAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQH7	Mitotic cohesin complex	0.791	317-335	EGEKKRAKSGTTPSTKGKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQH7	Mitotic cohesin complex	0.711	11-21	RRSQREKKQPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQH7	Mitotic cohesin complex	0.681	1177-1186	KIMAKTAKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQH7	Mitotic cohesin complex	0.669	33-37	RRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXS0	40S ribosomal protein S1	0.951	5-19	KNKRLSKGKKGIKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YTJ2	Putative zinc metallopeptidase protein	0.703	292-298	PRRPKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXV5	Zn(2)-C6 fungal-type domain-containing protein	0.745	706-711	RRRKRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W9N1	Chromo domain-containing protein	0.643	152-156	RPKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WIF7	Reverse transcriptase ribonuclease h	0.689	82-90	RKRLKQRVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X172	Uncharacterized protein	0.965	51-78	KIAEKYKIRVGNAMKLTKRKKTKKMKDK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3C0	Rrna binding protein	0.994	322-369	KKSKKEIAEQKAAHATKEKLRKERREEQERNVARKKAEKEKKEKKSVR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3C0	Rrna binding protein	0.99	434-446	RRRPRKKLKAKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X619	DUF1713 domain-containing protein	0.999	236-261	KRKRRKKMKKHKLKKRRRLTRQQRHN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN05	Uncharacterized protein	0.886	62-98	KRRNVLKRISKGPEESLRAPSPAPSKLSIGRGKKAKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPF8	Cell cycle control protein	0.959	164-207	TKAARAEAARKKREKEEQEAKKMEWGKGLVQREDGEKKKRELEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPF8	Cell cycle control protein	0.86	242-252	KKKSKGPRKPE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPF8	Cell cycle control protein	0.648	25-28	KKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV06	zf-4CXXC_R1 domain-containing protein	0.938	562-574	KKSKGRKPIRRAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYD5	Uncharacterized protein	0.766	223-230	RRRRNRKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y4R1	Uncharacterized protein	0.981	934-971	PRGRKMQTKKAGGLSKIPVARSGSLKGKKKNPGTKQRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y4R1	Uncharacterized protein	0.706	77-84	KKRVKNKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y4R1	Uncharacterized protein	0.662	820-830	PRPPAGRVRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y4R1	Uncharacterized protein	0.634	162-165	KRKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1Z7	Mitochondrial ribosomal small subunit component	0.778	241-252	KARKAKKGEHLR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WCP7	Uncharacterized protein	0.641	219-226	RKHSKALK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMJ6	Smg4_UPF3 domain-containing protein	0.99	204-249	HAAETRKEEAKKKAAAKATDSPPTSKKAKKAAAAEGAGRKGPKAPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMJ6	Smg4_UPF3 domain-containing protein	0.988	419-446	PPPGFGRGRGRGRGRGGRGGPPPGRGAP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMJ6	Smg4_UPF3 domain-containing protein	0.892	319-336	AKAKKEREKEKQKEANKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMJ6	Smg4_UPF3 domain-containing protein	0.824	8-18	KPRREKEKKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1V0	Pantothenate transporter	0.648	271-276	GRKPPA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2R2	Nwd2	0.747	726-732	LAKKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8A2	CLP1_P domain-containing protein	0.995	33-60	SKSKSTASKRKRDSEERNKQKRKRKKQE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8A2	CLP1_P domain-containing protein	0.762	680-692	ERRRVRRNLMRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA91	Small nuclear ribonucleoprotein Sm D1	0.998	101-139	PKPKSRKKEDARGRGRGRGGDRGRGGGGRGRGRGRGRGF
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAI8	Uncharacterized protein	0.998	18-83	KSALSRSKAGGKKGGEWLTTRFRPKGPPDKIAGGRAKVVPETKKDPKKPKPKPKPQPPQPKPQPQP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YC70	MMtag domain-containing protein	0.998	113-190	KEEKRRRKAERKEEKRAKKEQRRLERAERHEDGDRGYDHRSRGRNRSRSPSRRHRSEERKRDYSNRRPRSESRTPPPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YC70	MMtag domain-containing protein	0.69	203-211	KERERDRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YGL5	General transcriptional repressor	0.924	152-212	RDRDRERDRERERERERAESLSLRDRDRERERERERDRERDRDRVIDQRDPKRLKPERLKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YR25	Gastric cancer antigen zg14	0.961	120-148	HRRKRRKVTKPQPPKVVPLPTRSLRKLRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YR25	Gastric cancer antigen zg14	0.912	275-285	AGRPKKKKEKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YR25	Gastric cancer antigen zg14	0.727	304-321	KKKWEADKAKVEKLKASR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YU23	Uncharacterized protein	0.996	511-539	RKKAEKKAGKGKKATEEKLPAKAKKAKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YU23	Uncharacterized protein	0.854	836-857	KSGKRDLNKSPRKSKEHSSPRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YU23	Uncharacterized protein	0.656	552-555	KKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTZ9	Retrotrans_gag domain-containing protein	0.719	24-30	KREKKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZB4	Methyltransf_25 domain-containing protein	0.997	104-146	KKEKEAEKEKEEKKEKEKEKTKEKEKEKQKEKEKKDKGRLSKD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZB4	Methyltransf_25 domain-containing protein	0.83	163-172	KPSKPLKKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZB4	Methyltransf_25 domain-containing protein	0.781	913-920	KKKKKESK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZB4	Methyltransf_25 domain-containing protein	0.666	248-255	NRWARKGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3M5	Restriction of telomere capping protein 4	0.909	101-121	RRGERKIAKEKKMEQKEKPKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3M5	Restriction of telomere capping protein 4	0.869	790-806	KKASRPEPRPRPKAIRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3M5	Restriction of telomere capping protein 4	0.723	886-894	KRKARAAAE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3M5	Restriction of telomere capping protein 4	0.704	376-382	GKEKRRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3M5	Restriction of telomere capping protein 4	0.695	921-930	GKRLEKRQRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3M5	Restriction of telomere capping protein 4	0.643	437-441	RAKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5B7	Metacaspase pca1	0.981	463-477	KKTRKLWRLRKKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGG6	Membrane protein	0.94	186-211	KRRALFWWFKDIRRSRRLREKRKDPE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJI5	Uncharacterized protein	0.678	333-339	KRQKKTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZI4	Coiled-coil domain-containing protein 16	0.771	258-268	KKKRQAAKAAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WGP7	Uncharacterized protein	0.928	38-53	KRAKAAERQRRKRERD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WGP7	Uncharacterized protein	0.915	117-140	RRERVRAAARERQRKHRALIKERK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WI41	Structural maintenance of chromosomes protein 5	0.758	400-410	ARERKKEAIKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WT44	Tubulin gamma chain	0.61	80-81	KG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WW40	Uncharacterized protein	0.957	40-55	QDRKARARAAKKRPRD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WW40	Uncharacterized protein	0.866	172-181	KRKKSRPKQG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWE7	Histone deacetylase	0.809	518-529	SSRTLRERKKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWE7	Histone deacetylase	0.636	464-467	KKRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFI3	Uncharacterized protein	0.995	30-56	AKKEHSSKKKDKSGDKDKHKDRKKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XK61	Nucleolar protein 16	0.891	7-38	RRKVRSSSYRPVSHSKNAKRNLKKMPPIRAPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y2W1	Uncharacterized protein	0.922	353-369	RLGKRVSRKEKKEKTRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y2W1	Uncharacterized protein	0.908	1206-1216	IKRLPKRGGKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y2W1	Uncharacterized protein	0.758	15-24	RKRKPPSQPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y2W1	Uncharacterized protein	0.662	383-388	KKRLAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y7T4	Uncharacterized protein	0.882	10-22	RKPKHRGGRRRYG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YS82	Transcription factor	0.92	101-127	KAPSPAPLRRRRSPSPASVRRKNLRLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YUG5	Uncharacterized protein	0.778	11-21	KSPRIKRKPPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WGQ8	Amidase family protein	0.935	709-729	EKAIREKEKERIERAKKRQRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WGQ8	Amidase family protein	0.655	467-472	RRAKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WGQ8	Amidase family protein	0.628	584-588	RKPPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4G2	F-box domain-containing protein	0.996	672-687	KANPRTRKGGKRRKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6I0	Abc transporter	0.713	497-504	KKGKGQKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAR3	Argonaute-like protein	0.994	5-75	PSRGDPSRGGRGTPPPRGRGDRGTPPPRGRGDRGTPPPRGRGDRGTPPPRGRGDRGTPPPRERGGTPQGGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ65	Dna repair protein rhp42	0.996	800-834	GRPKRAAARTPRPKSTTNGKPTPKRASPRKRKRPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ65	Dna repair protein rhp42	0.995	232-266	SEKARGKERAKASPVVKLRKAKPKGRVLGSKPKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ65	Dna repair protein rhp42	0.766	184-194	NKSKIKGKGKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ65	Dna repair protein rhp42	0.708	605-610	AKRKRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRZ1	C2H2-type domain-containing protein	0.99	212-235	LSRKKVPAKRNGSRKLKQKKPKTA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT65	J domain-containing protein	0.968	292-307	KGASKSKGRGKKRGRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT65	J domain-containing protein	0.82	350-359	TKATKGRKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT65	J domain-containing protein	0.622	240-243	NKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTT4	Uncharacterized protein	0.993	64-84	RKGRRMMKPGRRHREARKKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YAN8	Methyltranfer_dom domain-containing protein	0.97	317-333	PRRPRHGKPPRNGKKPH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YSL4	Uncharacterized protein	0.885	508-537	SQPKRRKRNEASVEQSNLKPKAKAKASKPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YSL4	Uncharacterized protein	0.823	432-460	TKGRGKEKAVESDAEAKPKQATRRKPNSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YSL4	Uncharacterized protein	0.694	486-494	GKGSRAKRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQJ2	Retrotrans_gag domain-containing protein	0.674	229-237	KKKELIKLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WST4	Kinase-like protein	0.639	487-490	KKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WV29	F-box domain-containing protein	0.988	14-43	KEPMKKKQRKGSPTKKPRASGLVIPRGKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1E8	Abc transporter	0.995	1071-1084	KGKKKEKKEKKRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2W4	Agc agc-unique protein kinase	0.884	1104-1125	PAVPSKGLLPSKPSRNKPRKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2W4	Agc agc-unique protein kinase	0.773	528-535	RSHRKKRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2W4	Agc agc-unique protein kinase	0.663	544-549	GKGKKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5R1	Uncharacterized protein	0.944	69-97	KKENGKENGNKLKKRGRDADGEADKKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBT3	Bromodomain containing 7	0.895	302-319	KLKGKRYKTKKERLRVEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBT3	Bromodomain containing 7	0.797	63-89	AAKKGKSKSSPYPQGLPQKAPRPVKLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XME9	Uncharacterized protein	0.708	400-407	RRQSRKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWC5	Uncharacterized protein	0.943	122-134	PRKPKKTARRRPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWC5	Uncharacterized protein	0.812	352-372	KEKEKEKETEREREKEKKMIP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKJ0	Uncharacterized protein	0.974	173-191	RRAKEERRRLRREKKEMKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKJ0	Uncharacterized protein	0.927	70-80	RRAKKKRPQKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YVZ0	Uncharacterized protein	0.902	294-304	RHNRHRRRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WVB7	Uncharacterized protein	0.801	121-130	ERRRKQREKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5A0	Small nuclear ribonucleoprotein b and b	0.63	55-57	PKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8J5	DUF3421 domain-containing protein	0.998	21-45	KKGKKKDKKDKKDKKDKDKKDHDKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9Y3	Ribosomal protein l35	0.967	84-111	LRPKKTRAIRRRLTKHEKSLKTAKQTKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XI27	Tkl tkl-ccin protein kinase	0.912	101-113	RSPKRRKRIPREH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMU9	Glycerol-3-phosphate o-acyltransferase	0.733	518-527	PRRRPPTRRI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRF9	Reverse transcriptase	0.732	396-403	EKKKKFEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVH7	Duf292 domain-containing protein	0.638	1100-1104	RSKRH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWA6	Valyl-tRNA synthetase	0.938	29-71	SAAKKKAKQLEKEAKLAAKAVKNAAAAAIGSGEKKAKAEKEKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWP3	Cysteine-rich protein 2-binding	0.749	15-28	RKPRPHKNTQRKRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XX70	RNA-dependent RNA polymerase	0.827	598-608	KATKRRSRRNR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YIA7	Rho gtpase activating protein 22	0.633	1762-1767	AMRGRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YIA7	Rho gtpase activating protein 22	0.62	1735-1740	KSLRAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WAX8	Splicing arginine serine-rich 12	0.908	14-35	SRSRSPDRHRDRERRRERDRDR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WAX8	Splicing arginine serine-rich 12	0.903	194-210	RRYKRKRDRKDEKDRIE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WAX8	Splicing arginine serine-rich 12	0.816	214-232	GPKEVGREGMLEKKRARRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WIC9	Eta dna polymerase	0.948	612-630	VKKRRKEPAKGIEKFFGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WX62	Uncharacterized protein	0.958	74-93	RTKHRSPKHRRSSHRGSKRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6Y6	Phosphatidylserine decarboxylase proenzyme 2	0.98	8-46	KHIPRPRRRNTGNNEQDKDKSKSSKTEKAKRRGIRKFRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6Y6	Phosphatidylserine decarboxylase proenzyme 2	0.956	491-505	RAERRKERKERSRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6Y6	Phosphatidylserine decarboxylase proenzyme 2	0.929	443-459	KAREEKKKRFRKSWGSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6Y6	Phosphatidylserine decarboxylase proenzyme 2	0.813	873-886	KKSRFRRGMRKASK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFN7	DNA replication ATP-dependent helicase/nuclease	0.837	42-61	KSKKKMARSVPRTPVKPHKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLG7	Putative g-protein alpha subunit	0.811	51-58	NERKRKKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTC0	Uncharacterized protein	0.7	380-389	SRKRHLNRRH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ93	SprT-like domain-containing protein	0.928	44-60	KTSPSKKKPRVSKKAEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y0D9	Tyrosine--tRNA ligase	0.982	382-404	AKPEKKKKKEKTYHPPPPGKGKN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WR28	Peptidyl-prolyl cis-trans isomerase	0.999	201-250	RKRSKRRSRRSRSRSLSADDSDGGEKRRHRKKSKRKHVSDKKERKERSPS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUC0	Ubiquitin	0.996	73-100	LRGGAKKRKKKTYNTPKKIKHKRKKVKM
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1N3	Uncharacterized protein	0.944	147-158	KGKGKGKGKGKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3F1	Histidine--tRNA ligase	0.903	63-90	KKLGELKKTLGQAKAAAGGGKKKEERER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3F1	Histidine--tRNA ligase	0.886	405-414	PPKKKFKKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAD9	tRNA(His) guanylyltransferase	0.685	243-250	KAEKKSKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEK2	Sister chromatid cohesion protein	0.982	520-542	ASGKKETKSPKKKVTSKKGKEKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEK2	Sister chromatid cohesion protein	0.692	1061-1071	GGKEKGGKEEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXR6	Uncharacterized protein	0.999	499-526	LPRPSRKVKSKKRKNKRGGKKESPKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXR6	Uncharacterized protein	0.981	284-298	KEKRGKDKKKKEKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YR96	Phosphatidylinositol 4-kinase	0.778	1615-1627	KPFIKKTKPEKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W2X1	Uncharacterized protein	0.991	30-50	AREKGRYWKKNKKKEKGGKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMT2	Uncharacterized protein	0.68	62-68	KRRGPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWU2	Uncharacterized protein	0.986	337-357	QTRKHKSKSKSKSRRRDRERT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWU2	Uncharacterized protein	0.974	230-253	RGRERQRQPSRGRPRERERERRKD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZP5	Uncharacterized protein	0.763	215-230	RPHKGLHGPKPGTKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X055	FHA domain-containing protein	0.84	934-997	TAEPAPKKPTTRGRANSDPEPEKLRGRAAAAKMTVPPAIKEEPGSPPPAKKIPAATGRTRSAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X055	FHA domain-containing protein	0.654	848-855	KTRARSKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0T8	Defense-related protein scp domain-containing protein	0.982	165-196	QGKKKPSKEEKDKITKPPKKKESQSQEKEKKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XC94	Integral membrane protein	0.737	172-195	AVKRAMELKEANKPFKFSRRGSRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDA3	Non-specific serine/threonine protein kinase	0.999	860-880	PKKSKVRRGKRGRKKRKGAAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLX0	Uncharacterized protein	0.997	347-500	RERLRREKEKEAEERRVKERERLRKEAEEREKQERERLRLESERKLAEERRLVEEREKQERERREKEERERKEKEERERREREERERLQREREERERQRNFAEEQERARLHKEEEERQRAEQEKHRKAAEEERRAEEERRRQAAEEQEKRRKAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNP0	Pre-mrna-splicing factor clf1	0.697	54-64	RKRKEFEERIR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPD9	Poly polymerase cid13	0.604	455-455	R
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WY32	Uncharacterized protein	0.999	47-71	KKRKKKKPKKSASAKAKEAAEKAAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WY32	Uncharacterized protein	0.989	422-444	GGGKSGKLREGKSGKGKSGKKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WY32	Uncharacterized protein	0.71	889-902	RAEKAKAERAERAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7H1	Uncharacterized protein	0.645	316-319	KRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFH0	Zn(2)-C6 fungal-type domain-containing protein	0.975	141-158	RKERKKGVKRGPYKRKNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFH0	Zn(2)-C6 fungal-type domain-containing protein	0.963	318-336	GRKRKKSSKNGDGKSKKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJC2	Hmg-box dna-binding protein	0.776	86-108	KKEEKQKQKELKRISDKEARQKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKQ7	40s ribosomal protein s6	0.695	91-100	RIALKRRASK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSE2	Formin binding	0.724	49-56	KEGEKRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSE2	Formin binding	0.64	338-341	KRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV66	Rna binding protein	0.987	88-108	PLSKSAKKNAKRKEKRDEKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZJ1	Serine threonine protein kinase	0.633	312-314	KRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WVZ3	Mediator complex subunit 12	0.986	1591-1609	PRNKKPKSKLPVKKTGKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWL6	Uncharacterized protein	0.811	64-72	ERRKSGKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXU0	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.95	532-559	PRERKPSKRKSEADAEPELPKPKKPKIK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXU0	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.79	170-178	KAKPRRSKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXU0	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.715	231-238	PKAKGRKQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6C8	Chaperone regulator	0.863	217-224	SKKKKKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6C8	Chaperone regulator	0.624	189-191	KKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAJ2	Uncharacterized protein	0.611	299-300	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDP0	Uncharacterized protein	0.704	283-289	PKLKKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDP0	Uncharacterized protein	0.611	326-327	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFF7	Uncharacterized protein	0.728	911-930	RRRSPPPDPPRLPQKEQKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFF7	Uncharacterized protein	0.638	47-53	RGGGRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFF7	Uncharacterized protein	0.628	96-100	GRGRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFL8	Uncharacterized protein	0.998	17-149	EPRRSSRIKEQPKPEPIEKKAPVKPRSKKADKEPKADGEEKPKSTAKGKKRKADEEGPAAEEGDKAPPSKKAKPASKATKPASKASAKPASKASAKPASKATKPASKASAKPASRAGSAKPASRAGSKKPTSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGG8	Macrophage erythroblast attacher isoform 1	0.625	58-62	RKSSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKK1	C2H2-type domain-containing protein	0.65	303-307	KGRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRY9	Uncharacterized protein	0.924	28-42	KPSTSGGRRRRGRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWK8	Helicase swr1	0.839	230-254	EPPKHKRRPEPTPEVSQPQHRKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYU9	CCHC-type domain-containing protein	0.755	76-89	KKEEKKEEPKKLTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YD03	Uncharacterized protein	0.747	65-80	RKRPPAKPYVKARAKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YW64	Wsc domain-containing protein	0.949	627-646	TTGKRRRSLRKARHHHDSRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W3R1	Kinase-like protein	0.701	275-283	GKRPAKPTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQ22	F-box domain-containing protein	0.891	64-83	KASRPRSKPLNSSKRRRIKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WVG8	Set domain protein	0.731	477-488	KKTKEWKTKLRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WVG8	Set domain protein	0.689	383-389	QKRKLPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXV1	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.981	1292-1308	RPKKKRKTVKVKAVKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXV1	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.98	1351-1372	PKRKKAKTDDKKKVTKKGTKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXV1	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.955	800-812	ERKKEKRRRERGE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXV1	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.954	1009-1056	RRDSRERRDRGRDSDRYYGRGKRRDSRSTSRDRYRARSPRRFGRSYWR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXV1	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.75	984-996	SEKEREKGRDRRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYT9	Ribonuclease p 21kda subunit	0.96	57-70	NRQKKRKSRRAGPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4Y6	Ribosome assembly protein 3	0.988	10-23	AGPRKRNRKRKRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X550	DUF262 domain-containing protein	0.913	298-308	RKTTGRKKRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGA5	Delta-12 fatty acid desaturase	0.664	400-406	VRRPARK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGY9	Uncharacterized protein	0.986	265-292	WSKSRFLNSPKKGARKEKEKEKEKEKFK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHQ4	Uncharacterized protein	0.99	810-841	RSRQRSKAQAYKSRPASKSKPKPKSKSKVPPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHQ4	Uncharacterized protein	0.987	645-706	KKSVTKPSVKNGKESEKKDRSEKQKERERPMLAKKKSGADEEESKKKKDVAKSHPKGKAVKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHQ4	Uncharacterized protein	0.785	719-734	KKTISKPKASSRKAKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJF6	Uncharacterized protein	0.975	529-556	PRSRKVPAPAKHAKRGKALAMKAKTNKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJF6	Uncharacterized protein	0.881	496-510	SPKTAPKKRYGRKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJF6	Uncharacterized protein	0.651	473-477	RPKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWY9	Long-chain-fatty-acid--ligase	0.626	580-584	RKIAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YHN7	Duf757 domain-containing protein	0.993	151-176	AEAAKEKAEKEKEKAQAEKKKKESKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WL98	Uncharacterized protein	0.774	114-125	WQARKKQHRKDS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WLZ4	Uncharacterized protein	0.831	3-15	KGKNKGGRPLKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WY40	Uncharacterized protein	0.993	565-589	KSKEEVKAGGKKKAGARKKGKSGAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2R1	Retrotrans_gag domain-containing protein	0.93	229-244	RKKREPIKPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCT5	Uncharacterized protein	0.91	199-228	KSVRKDERNKMSKKVRAGLVSKEKEKQKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCT5	Uncharacterized protein	0.847	293-307	RRAGGSSSGRGRGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHN2	Btb domain and ankyrin repeat protein	0.994	1631-1686	RSKKDGGRGGDGGQKKHRKPKGKASGVSSGSKPAQSGGAPQTRGGGGSRNGPRGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHN2	Btb domain and ankyrin repeat protein	0.893	893-906	RRAKGKGKAKALRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XP47	Pre-mrna splicing factor	0.916	165-177	SQKRELKRKRKQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XP47	Pre-mrna splicing factor	0.68	228-234	KKAKPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVG2	Wd repeat protein	0.924	806-820	GKKSGKHSKSKKRHQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W320	CCHC-type domain-containing protein (Fragment)	0.757	137-160	PRSPKIQPKAMAEDRKPSGSRPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W320	CCHC-type domain-containing protein (Fragment)	0.671	371-381	GRKPQRSFRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXF8	HMG-box	0.878	163-177	APGHRNKPKATRKKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYH7	Dna-3-methyladenine glycosidase	0.773	41-59	KRKAKGTSEEPAPKTKKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X949	Snf2 superfamily protein	0.993	1045-1059	RRPSRKRGKGKGKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X949	Snf2 superfamily protein	0.952	1095-1109	ARRALKKRLGKRKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X949	Snf2 superfamily protein	0.77	625-634	RKQKKARKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X949	Snf2 superfamily protein	0.609	1010-1012	KGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XB09	Uncharacterized protein	0.852	453-482	FHPPPPPPPPPPPPPPPPPPPGPPGPPGPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XB09	Uncharacterized protein	0.679	545-551	ERKRERN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDW5	DDB1- and CUL4-associated factor 13	0.986	380-405	ARRVKEERRRKHTRAGESKPKAERKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEV0	Ribosome biogenesis	0.991	869-910	SKKPRLSAKLENEEDRKPAKPGRSIGSLIGRKRKQRKMAKGH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEV0	Ribosome biogenesis	0.971	331-348	KQKRKKQKRIEKRLKAAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHE1	Trna methyltransferase (Fragment)	0.987	22-48	GKRPKIEKDTKSKKLTKKNAKKLKKQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPU7	Histone H2B	0.997	18-55	GKAPAKTEGSKAAKKTASKSKAAAPADGEKKKRKKARK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTG5	Uncharacterized protein	0.984	262-303	GGGSNSGGGGGGAKKERKDRDRERDRDRERDRDRDRNRSRRD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW78	Uncharacterized protein	0.866	280-298	RRMTPRNTRRARAERPRRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XX97	Grfa protein	0.621	734-737	GKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XX97	Grfa protein	0.601	732-732	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZW7	Alpha beta fold family	0.862	260-270	GKARRPKKSSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WFY2	Glycosyltransferase family 90 protein	0.686	76-85	RPRPHTSRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK58	Uncharacterized protein	0.99	869-909	SRSKLPKAPQPRSAPAARKPSKKTPTTSKGRKGKQSARKTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKP2	Uncharacterized protein	0.717	405-412	KPPKAKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKP2	Uncharacterized protein	0.697	224-232	KRKSKSKLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WU86	Uncharacterized protein	0.93	135-151	KAIKKKSAGRQGGKRRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5W4	Ribosome biogenesis protein YTM1	0.899	243-263	ERKKRRKLNGEDDPVSKPKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA61	Rna-binding protein rnp24	0.969	64-88	EKRRQKKKQKLAEKQGQEPASKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA61	Rna-binding protein rnp24	0.791	397-416	KRSDVSAPKQNGPRHRPKPG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDV9	Protein kinase	0.858	820-840	ARRKEERRQRIARLKEQNKAI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIM3	Ribosome biogenesis protein NOP53	0.94	319-346	RKTKAQRRKAAKILEEKRILAERAAKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIM3	Ribosome biogenesis protein NOP53	0.899	20-49	KSKPKVSKSAIGAPSQRSQPSRKGKRAWRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIM3	Ribosome biogenesis protein NOP53	0.743	145-152	RQAKKPRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIM3	Ribosome biogenesis protein NOP53	0.658	380-393	SKLKNGLSGRRIGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIM3	Ribosome biogenesis protein NOP53	0.6	376-376	R
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLK5	Cysteinyl-tRNA synthetase	0.781	677-702	KKAIAEAKAAKKAATAEAERQKRLQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN21	Uncharacterized protein	0.949	72-81	QGDKKKKRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN21	Uncharacterized protein	0.67	280-285	KKRMRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSG4	Atp-dependent rna helicase dbp3	0.998	104-128	DKKDKKDKKKDKKDKNSKKDKKKKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSG4	Atp-dependent rna helicase dbp3	0.994	71-82	EKKKKKKKKRSH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSG4	Atp-dependent rna helicase dbp3	0.959	35-46	VKQKKKSKKRKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSG4	Atp-dependent rna helicase dbp3	0.651	18-24	KKGKSES
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSW9	Uncharacterized protein	0.914	466-474	GKKVRKGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSW9	Uncharacterized protein	0.866	432-444	KKVQPKKKRQLKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVC2	Retrotrans_gag domain-containing protein	0.93	228-243	RKKREPIKPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYE6	Pre-mrna-processing atp-dependent rna helicase prp5	0.987	55-114	DRRDRDRDRYRDDRYKDDRRRDYRDDRRDDRRDDRRDDRRDDRRRSRSRERRPTKASSPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYE6	Pre-mrna-processing atp-dependent rna helicase prp5	0.928	136-168	KARRAKYEAWKKDREAKKALGEAKAKAMALAGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYE6	Pre-mrna-processing atp-dependent rna helicase prp5	0.801	16-39	RVRHSHRSSRSPSPTRRAPRPSNR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y3E5	ER membrane protein complex subunit 1	0.708	1024-1029	RRKKLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y4X4	Zn(2)-C6 fungal-type domain-containing protein	0.854	53-65	KKKRGPKIGPSKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y777	Cyclic-amp phosphodiesterase	0.715	275-283	KPQRKRQKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YLW4	Forkhead box protein c2	0.994	196-235	GTKRPRKRGRPNKNKDTATKEVDKRRGRPRKDSEPPPTKW
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WES8	Uncharacterized protein	0.997	305-321	KDKPKKKPAKPRKKRAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WES8	Uncharacterized protein	0.989	354-374	KRKPRAKPRSKAAPTSRKKPA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WES8	Uncharacterized protein	0.966	258-273	KRSRPRKRVTKKRARP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WES8	Uncharacterized protein	0.76	433-449	KSVRPRSSVGGGRKPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJP7	Homeodomain mating-type protein	0.982	440-465	KSKKKKAGLPNRKPKNSPRQSRASPA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJP7	Homeodomain mating-type protein	0.86	205-219	RVSRKNGQEPKKKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJU0	Uncharacterized protein	0.948	26-61	PSPPKKGHRKSRSDPGNTGKSSKEGNKLGKGMLSKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WM72	Uncharacterized protein (Fragment)	0.856	181-195	KKKKTRKQEAMKIEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WS35	Uncharacterized protein	0.729	3-10	KKSKKGKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0U3	Uncharacterized protein	0.76	38-44	RSKRKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3N8	Clr6 histone deacetylase associated phd protein-2 cph2	0.996	713-769	PAKPAKRARAAKKKDPEENAKDENPEKKSRKRKEREDDNQRAEKAKEKKEKAKAAPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3N8	Clr6 histone deacetylase associated phd protein-2 cph2	0.943	165-180	PGSSRPRRKDKGKAKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X801	Retrotrans_gag domain-containing protein	0.629	165-171	PSRSRPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8Q5	Other 1 protein kinase	0.71	700-704	KKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAD6	C2H2-type domain-containing protein	0.792	679-689	KNKKPRTGERR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNV0	Chromo domain-containing protein	0.688	44-58	RVKERSRRDLDKFKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV40	Uncharacterized protein	0.676	279-285	RGHRRRT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWF8	U4 tri-snrnp-associated protein 3	0.985	21-117	RDRDRDRDRDRDRDRDRYSRGGYGHRDSGRRRSSRSASPRRGDRDRDRREYRHDKDERDRDRDRRDRDRYRESDRDRERDRERDRDKSDRRERDSRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YAN4	Putative g-protein alpha subunit	0.796	63-72	SQRRKEAKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YC82	Ras protein	0.655	175-180	IKKPSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z011	Conserved fungal protein	0.958	426-465	RGGRGRGRGFRSGERGGFRGGFRGGERGRGGDRGFRGRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z011	Conserved fungal protein	0.853	494-512	EGGEYRGRGGRGRGRGGDR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z011	Conserved fungal protein	0.677	25-31	KKLRKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WFC1	Rho guanyl nucleotide exchange	0.68	907-914	RKPSFKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJD2	CCHC-type domain-containing protein	0.854	125-140	REEKKKEEPKKLSKEE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WVG3	Pre-mRNA-splicing factor CWC24	0.697	12-23	KKKSRPTTGRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WVG3	Pre-mRNA-splicing factor CWC24	0.609	294-295	KR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBH1	Acetamidase regulatory protein	0.792	177-183	KRKRKGT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBH1	Acetamidase regulatory protein	0.789	34-44	PPKKARQRKQA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDX1	Uncharacterized protein	0.839	72-101	ARKETVKKEKIKIKAEEEQPAKVELGKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDX1	Uncharacterized protein	0.822	194-203	APKKPKEKKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XG79	Wlm domain containing protein	0.94	177-211	PFQKGTRRGGPRRPKQIIPSNHTGRQTEKKRKPGS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XG79	Wlm domain containing protein	0.798	240-252	KGKRAASKRAREE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQP5	Uncharacterized protein	0.997	260-285	RRDRTGNKPTRRSSRRRRKRASGKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRC7	Uncharacterized protein	0.755	186-193	RREKRRLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XX18	BZIP domain-containing protein	0.863	27-36	KPKPGRKPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YU18	Ribosome biogenesis regulatory protein	0.965	295-310	GRAVSGGKGKKVGKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YU18	Ribosome biogenesis regulatory protein	0.962	93-123	RAKPLPKPKPPTKWELFAKAKGIQRKRRDKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YVT3	ATP-dependent DNA helicase CHL1	0.813	114-132	RRREQAQKAKMRARVVKKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W8S9	CCHC-type domain-containing protein	0.987	169-190	PKKEEKRKKEPKKLSKEERFAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKG0	Uncharacterized protein	0.967	99-112	KKEKKKEKKAKVAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2U5	Mucoidy inhibitor a	0.637	275-279	ARKQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2U5	Mucoidy inhibitor a	0.625	919-922	PRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X685	Uncharacterized protein	0.722	161-171	RRKKGPLGIRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X989	Uncharacterized protein	0.996	813-855	PTGSKRSRPSPTPPKASSAVKTSKRSKAGPRERKAAGKKRATK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAG2	Exocyst complex component EXO84	0.913	12-50	PRKSTRQQTKLAKPGAGPTPRPRAADARKSRVDDKIKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAG2	Exocyst complex component EXO84	0.754	360-372	KRRKEREGEHERR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XG17	26s proteasome non-atpase regulatory subunit 12	0.994	81-101	EKPKAAASKRKRDKKAAKGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNS1	Mitochondrial ribosomal protein subunit l2	0.991	335-388	GRGRSKSNKHPVSIWGWGTKGTRTRKPGPKGPKNSNKLVIRERPRGVEKRKGKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNS1	Mitochondrial ribosomal protein subunit l2	0.916	88-112	PKRKKGGRNNTGRITVRHRGGGHKQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNS1	Mitochondrial ribosomal protein subunit l2	0.644	195-198	KKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW94	Reverse transcriptase-rnase h-integrase	0.771	10-17	KKKKGKLR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZE0	60S ribosomal protein L13	0.962	29-44	PGRKLRRRNARKAKAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZE0	60S ribosomal protein L13	0.936	189-208	EGARKARAAKKEEEEAAKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZE0	60S ribosomal protein L13	0.832	117-135	KAYKERLVVFPRKAGKPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YEH0	Uncharacterized protein	0.743	289-299	VRSKGHPHRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YQB3	Uncharacterized protein	0.906	242-254	KRKPKPKTRTRRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z320	Uncharacterized protein	0.964	224-278	WRRGGDTRRIDRTENGRGEREDKERPRSRVRDSSRGRRDSSPSRRDRDDRRERDR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z320	Uncharacterized protein	0.958	285-355	PRRWRDDGKRDERMAARRERERGRDKPPHENPWESGGDRRWAIPEDRDVRAKKGAPREKRSTGAEEARERE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z320	Uncharacterized protein	0.67	213-218	SKKKVG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W708	Ribosomal protein	0.709	96-106	NKNKKLVKKLA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WH10	Ribonuclease H-like protein	0.924	489-514	PAGRGRRGVRSTRKVSKEQRRTRDKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X149	Zinc finger protein (Homeobox domain)	0.671	127-131	PKKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5U6	U3 snornp-associated protein cic1 utp30 family protein	0.991	637-669	KQKKAGGAGEKKKEKVIKAKGGKSAKDGVLGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5U6	U3 snornp-associated protein cic1 utp30 family protein	0.978	314-374	EKEKPKKKAKAQESEPKTPATAKAQLVSDKSKAKKRKEAEPPAPAPESKVDDASSKKKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5U6	U3 snornp-associated protein cic1 utp30 family protein	0.975	603-612	EKKKRKKAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5U6	U3 snornp-associated protein cic1 utp30 family protein	0.906	486-493	KEKKKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5U6	U3 snornp-associated protein cic1 utp30 family protein	0.854	297-305	KKGKKKRAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5U6	U3 snornp-associated protein cic1 utp30 family protein	0.822	560-567	AKKKEKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X614	Ring-finger domain-containing protein	0.747	425-438	PPPPLKIHAKPKKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8T2	40S ribosomal protein S24	0.999	165-201	SKVDKASRKLRKERKNRAKKFRGTKKVKAAEPPKKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XI98	Tandem pore domain k+ channel	0.754	80-85	RRRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XI98	Tandem pore domain k+ channel	0.622	380-382	RKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRK4	CCHC-type domain-containing protein	0.67	442-451	GKKPQRSFRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV07	RNA methyltransferase	0.718	104-108	RKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYV3	Cbs domain-containing protein	0.962	415-430	KSKPTKRTRRGRRKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YIX9	GTP binding protein 2	0.97	241-295	VRRHVQAHLHLPKRERERDKTKKLKHQNNSAESGGDKKSNNRRTARDRRREEKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKY4	Uncharacterized protein	0.624	452-454	RRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWV7	Uncharacterized protein	0.865	169-179	RKAHRKKNRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWV7	Uncharacterized protein	0.678	292-297	KKSKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZR7	Translocon-associated alpha	0.913	248-255	GKKIRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X281	Uncharacterized protein	0.732	194-200	KKKQRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCS2	Conserved fungal protein	0.971	128-141	KPRKRRKLVKGKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCS2	Conserved fungal protein	0.817	167-187	RGKKTEFQKNLERLRRKKQGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFH8	rRNA-processing protein	0.986	66-112	KDRRREITLERRKAAEEKKRLEEDKARMGARKTARLRRKQGLTKKIS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFT0	Multidrug resistance protein cdr1	0.725	1464-1471	KGAKARKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGQ9	Elongator complex protein 4-like	0.848	431-439	KSKKPKKRV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMP6	CCHC-type domain-containing protein (Fragment)	0.883	228-242	RKKREPIKPKITRKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTN6	Uncharacterized protein	0.774	46-55	NGKKDKGRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUD0	Glutathione transferase omega-1	0.675	250-255	RVRRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XX62	Transcription initiation factor TFIID subunit 8	0.815	150-159	KAKTMKRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKP6	Nadph oxidase isoform 2	0.904	84-108	SERWRIQPLQKRLRRAEKAPARPKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WGQ0	CCHC-type domain-containing protein	0.898	74-89	RKKREPIKPKITRKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKL8	Zinc finger cchc domain-containing protein 16-like	0.937	58-73	RKKREPIKPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMM3	Uncharacterized protein	0.9	60-77	KKEERKKEEPKKLSKEER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5J3	Uncharacterized protein	0.922	519-531	TPKKRRRRDDKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5U1	GCR1_C domain-containing protein	0.927	339-354	TRSARRKRRVKVHGRL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5W0	Drap deaminase	0.956	381-405	KGTLRAPRELALKKPPPRNKRQKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBN7	Nucleolar complex protein 2	0.967	6-45	KKSMKKFASSGQLKKTIEARKKHQQIKKKFQNRRGNKGPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBN7	Nucleolar complex protein 2	0.825	631-640	QRKAREKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XL98	Uncharacterized protein	0.973	828-840	GRPKKKPAKKRMG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XM86	Eukaryotic translation initiation factor 3 subunit J	0.917	204-220	QREKTSGKKKKGSTKPG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XM86	Eukaryotic translation initiation factor 3 subunit J	0.829	59-80	PPKKKGTLKQKLAEKEAAKAAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNB2	FACT complex subunit POB3	0.996	534-558	KKKKKTKTREKGKGKEGEGSKKVKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNB2	FACT complex subunit POB3	0.989	591-605	DKPKPKPKPKPKAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNB2	FACT complex subunit POB3	0.979	617-643	KAKERPKPKPVKPKADGDGPEPPKKKQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNB2	FACT complex subunit POB3	0.953	573-583	KPKKKKAAKKD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YCX5	Uncharacterized protein	0.984	77-119	KRLKKLRSKLRRAKRNLTDSKNALAHAKSAGKADLKRAKRKLR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1C4	Uncharacterized protein	0.981	264-293	PKIKGKKGKNKPKNAVNGSGPPGPKGRLAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYH9	DNA helicase	0.745	844-861	RHKLFAKRDKDRIAARKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X376	Beta-lactamase	0.829	431-445	HEKRISREKPRPKNP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXA4	Cation-transporting ATPase	0.605	132-133	RR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXX7	Condensin complex subunit 2	0.911	485-500	ADSGAPKEPKRREKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXX7	Condensin complex subunit 2	0.856	540-549	GKKLRRKGKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXX7	Condensin complex subunit 2	0.699	68-73	KRRRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXX7	Condensin complex subunit 2	0.617	481-482	RK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YM36	Ribosome associated chaperone	0.991	341-386	TPKKSKTEEEEEKRKKEEAEKAAKTEAKKAKAAAANAAKKARRQQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YM36	Ribosome associated chaperone	0.905	278-291	EKKNKSERARRKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YM36	Ribosome associated chaperone	0.812	310-330	IKRIKEEEKAAREAKRLARSQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WB42	U4 u6 small nuclear ribonucleoprotein	0.936	361-382	TKKEQKKMRKLKRAAELQDKRD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WIU1	Uncharacterized protein	0.937	324-350	KRRREQREREAREKAEKEAKEKEEREK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJB0	Retrotrans_gag domain-containing protein	0.93	121-136	RKKREPIKPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTL8	Uncharacterized protein	0.99	20-82	TPRRSKRIASKKARSVLLARKGKGKAAIFPTPKSARTTKAKKSKYSFQVPPRPKSAGGGRRVR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WY90	Calcium channel subunit cch1	0.688	1545-1552	PSKRPQKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1I9	Uncharacterized protein	0.909	61-75	NDSKPPAKPKKKASK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDY0	Uncharacterized protein	0.664	71-76	RKAKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDY0	Uncharacterized protein	0.603	483-483	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEV9	Gtpase activating protein	0.634	422-425	KPRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKI2	Uncharacterized protein	0.945	307-336	VRNVGKSRPPAAKKTTGGKAPRRLLAKPAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKI2	Uncharacterized protein	0.894	272-302	RPKGKGKEKAVEKVVSAKPGRTNGKKASPAD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKI2	Uncharacterized protein	0.635	101-108	KSGKSSKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKI2	Uncharacterized protein	0.602	150-150	R
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN23	Spindle pole body component	0.756	412-420	HRSRRQRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT70	CCHC-type domain-containing protein (Fragment)	0.778	309-322	KKKRMGREPVKLKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTD9	Complexed with cdc5 protein cwf19	0.967	7-43	KRSKHKRKDRDSEHSSKKRSKYDDSSSRHKKKSKSKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTD9	Complexed with cdc5 protein cwf19	0.679	453-457	RKKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y106	Uncharacterized protein	0.709	111-119	RERSRRRQS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z194	Uncharacterized protein	0.909	29-46	RTQHRRKIGRAKGGPKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z194	Uncharacterized protein	0.868	148-159	PPPSHRRKKPAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z194	Uncharacterized protein	0.816	69-75	RRRKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z194	Uncharacterized protein	0.788	299-325	PRALWPSKKKASAPAEEPPTPTKSKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X217	Phd transcription	0.977	784-824	GKKRKTAHKPKGRAAAAAAPVTEAPAVAKPRAKPGPKPKPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X217	Phd transcription	0.962	1229-1248	RKVNGDTAASKKGKKRKAPT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X217	Phd transcription	0.691	516-521	KKKKSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2U8	Dnaj domain protein cwf23	0.685	210-218	KKAPHKPPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2U8	Dnaj domain protein cwf23	0.625	104-107	KKQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3S1	Putative forkhead-like transcriptional regulator	0.999	646-669	ESLARKKKKEKKEKKKDKKGKGKD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3S1	Putative forkhead-like transcriptional regulator	0.917	354-375	GKGKKKEKAGAPLSEPPLKKSV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3S1	Putative forkhead-like transcriptional regulator	0.9	229-252	TTSKKRKKSDLAAVPPPPPPRPKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5T6	Uncharacterized protein	0.692	597-604	SKGKGKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X925	Sec2p domain-containing protein	0.762	571-584	KFKKEKEKEKELPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ05	Spore wall assembly-related protein	0.608	60-61	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XX06	Uncharacterized protein	0.782	83-89	KPKKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZP4	Uncharacterized protein	0.674	85-90	RRKIKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YBZ7	Uncharacterized protein	0.861	391-406	ARRARKAKEEKERLER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YHU7	Dna ligase	0.995	139-176	SSSRKPSSKKPPSKKPASKTSKPAAIQKPASKGKGKTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YHU7	Dna ligase	0.905	99-120	NSKPESKPQSKGKARSSTKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YP43	30s ribosomal protein s15	0.692	185-194	AKIRQRKAEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YQI4	C2 domain protein	0.713	1254-1259	KKRKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWJ3	60S ribosomal protein L6	0.784	75-84	QPKKSRKSPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YYY2	tRNA-splicing endonuclease subunit Sen34	0.891	125-137	KKRKERELKRQKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W2G7	Reverse transcriptase ribonuclease h	0.925	93-134	KKKEEEIKREKEKARTPLHPIPATGIKRLRDRLHPYAKKKLS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W2G7	Reverse transcriptase ribonuclease h	0.623	1248-1250	KKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W337	Retrotrans_gag domain-containing protein (Fragment)	0.86	420-437	KKDEKKREEPKKLSKEER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WL58	Mary1-like reverse transcriptase	0.895	430-437	KKKRGRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X330	Duf221 family protein	0.977	685-701	KKNIKKLRRRIKRIPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X330	Duf221 family protein	0.874	191-200	RRLHKKHKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X330	Duf221 family protein	0.659	798-803	SKKSKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBL8	DUF262 domain-containing protein	0.912	463-471	RPGRKRKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBL8	DUF262 domain-containing protein	0.789	153-162	KHGAGKKKKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBY1	Uncharacterized protein	0.937	170-181	RPPGKGKKRRRL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGT1	Zinc knuckle family protein	0.98	287-310	PTKGRGSGRGRGSRGGGRGKGRGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLI8	Williams-beuren syndrome critical region protein 22	0.997	228-282	YERRREKAPRKKDGKRKSVKVQDRDWILKKKELYRKRGKEDVPRDSKYTGRKRKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUS3	Uncharacterized protein	0.935	27-45	TKRPKRAEPLKPRTGPRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YHM8	Establishment of cell polarity protein	0.999	175-209	ERRRQRAAMRERRRRETKEKKRKEREREEKKAKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YHM8	Establishment of cell polarity protein	0.999	291-399	EKRKSIEEKERFEKASARLDGVKVKDDEARLKKAAKRKEKEKAKSKKAWDERKEQLAASMKAKQKKRADNIAMRHERKKEKGGGKKGKARPGFEGKAFGKGKAKSTKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YHM8	Establishment of cell polarity protein	0.917	44-61	NTKKPKEAGAAKKARKDK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YHM8	Establishment of cell polarity protein	0.862	81-91	KAREKAKGKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRA7	Uncharacterized protein	0.746	106-118	KKPLKQKSKLAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA37	Sox-1 protein	0.715	142-151	RPNNSRRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIV2	Uncharacterized protein	0.989	35-57	NRKRKRKREQSQLKNKKSRHKDR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIV2	Uncharacterized protein	0.884	345-359	SKKERKAKAQKEKQQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIV2	Uncharacterized protein	0.614	373-374	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XK00	Dolichyl-diphosphooligosaccharide--protein glycotransferase	0.964	763-778	GKKRKRTKPVTRRRPI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMV2	Uncharacterized protein	0.878	212-241	RRDRSRSPRRGDFDDRRRSPPPKRDDDRRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMV2	Uncharacterized protein	0.642	268-271	RKRD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRJ3	Phosphatidate phosphatase	0.991	465-496	RTRRRSLSPGRKRCAAPAKDGKQKGKGKGRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRJ3	Phosphatidate phosphatase	0.609	1154-1155	RR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z2I8	Microfibrillar-associated protein 1	0.996	435-515	DRGKGRDRREYSPRRDRDRDSSRYRPRSRERRRRSPSRSMSRSPPRGQRDDYYRHDERRRSRDWPPERDDHKGKRRRLEAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQC3	Uncharacterized protein	0.889	12-38	RIHLRPTVPRRTTGRAWFRQLRRRRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWS8	Eukaryotic translation initiation factor 2A	0.991	538-566	GGKEGGKEGGKGEGGKEGGRKRNKGAKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWS8	Eukaryotic translation initiation factor 2A	0.793	619-641	KVRNLNKKLKAIEELKEKAKRGE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4X1	Uncharacterized protein	0.985	1047-1085	KVEEREREPVRPTRKAKGTARKADHGKDSDQKPKTKKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAM5	Uncharacterized protein	0.886	16-28	PKRKGKGIKPVKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCF3	F-box domain-containing protein	0.845	35-45	APKSRKRQKRD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCF3	F-box domain-containing protein	0.805	55-63	QGRRKKAKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCF3	F-box domain-containing protein	0.794	223-230	RRAKGKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGE1	Uncharacterized protein	0.916	535-555	ASKNKMIKKKAESAKGKEKET
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGE1	Uncharacterized protein	0.867	996-1013	RRGQTPAPEAPKGRGRKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGE1	Uncharacterized protein	0.866	341-359	KPKRTARGSPKTIKSKKHP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGE1	Uncharacterized protein	0.861	636-644	LKKRKRGRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGE1	Uncharacterized protein	0.69	689-695	KGRKPKQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGE1	Uncharacterized protein	0.687	30-44	RGRSASAAPTKRPRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XP60	Kinesin-like protein	0.787	41-59	KAPAPAAKKAVSRKPLAQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRR8	DNA-(apurinic or apyrimidinic site) lyase	0.76	251-260	RWGKGKGKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRR8	DNA-(apurinic or apyrimidinic site) lyase	0.722	319-326	GKRGRRSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y0J5	Nucleosome binding protein	0.998	7-32	KAKRKAAEKAEKAPRKPKKDPKAPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YFT4	RNA exonuclease 4	0.972	17-37	KKLSKKSENASRPPRKKRKLS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YFT4	RNA exonuclease 4	0.857	332-350	KKGSKSEKRVKISPGGGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRH7	Pa domain-containing protein	0.96	1215-1242	RAPPPGRRGRPPKKWSAPLPPGLTLRER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRH7	Pa domain-containing protein	0.805	1275-1289	KQVRIRAKKSVKGKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WHV0	Uncharacterized protein	0.601	119-119	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJ27	Uncharacterized protein	0.97	91-115	RRRKRVASKQGGDKRKKDKEPALFK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJS0	CCHC-type domain-containing protein	0.723	125-135	KKPQRSFRKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WN44	Uncharacterized protein	0.951	699-730	KKAKKKQGGPKASTTANVGGGPARRKKSTTKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WN44	Uncharacterized protein	0.9	3-19	RKKTGKPRGKPQWPKGP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WN44	Uncharacterized protein	0.846	658-665	KKGRKRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNL6	Chromo domain-containing protein	0.883	46-63	RVIEQGKKKRGTFKKGQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WW89	WAPL domain-containing protein	0.784	216-227	KGKGKGRTTKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WW89	WAPL domain-containing protein	0.629	624-628	KRRNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X223	Uncharacterized protein	0.85	845-869	RGGGRGGGRGRGGGDGGGFRHNKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X223	Uncharacterized protein	0.673	449-454	KKRKEP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2D3	Chromatin assembly complex protein	0.619	874-876	KKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA53	Uncharacterized protein	0.947	471-526	IKKQKEQKARFLREEKERRQFEEERRRVEEERRRRDQERIEWEKERKAWEREKKAM
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XB07	Duf300 domain protein	0.627	355-359	SKGGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBI0	Histone acetyltransferase	0.94	115-148	RPKAPQAKKGGTSTPKAPAKAPAKVPRSKSLLKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBI0	Histone acetyltransferase	0.92	520-532	EKIRKKNRRRIHP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCF6	Uncharacterized protein	0.832	220-228	APRRRRRHR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF90	Ubiquitin-protein ligase	0.953	42-69	SGTRKRTRDPKGKAKQVADEPPKRRTRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF90	Ubiquitin-protein ligase	0.625	90-92	GKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJU8	Uncharacterized protein	0.843	706-720	HHRERRRAKAESRGG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJU8	Uncharacterized protein	0.627	528-531	KRKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTD7	Guanine nucleotide exchange factor	0.969	101-124	TRSKRRSRSRSRSRGSRDFKGKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTD7	Guanine nucleotide exchange factor	0.961	295-305	PNKRRRRRRRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUN5	Ribosome biogenesis protein ERB1	0.923	249-275	PKRRWIPSKWEKKKVMKIVRAIRQGRI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUV0	Uncharacterized protein	0.901	267-280	PPPKHRNRRRDGRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW34	Histone deacetylase complex subunit cti6	0.855	74-84	RSKRKPKEKSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW34	Histone deacetylase complex subunit cti6	0.811	276-281	RKKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXF7	Atp-dependent rna helicase has1	0.926	523-555	RRQGKQRRIETLGKKRVEKEVYKKGKERNQRGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJ45	Uncharacterized protein	0.997	113-132	GRAGKKNKKKGKGGKGKEKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WLT6	CCHC-type domain-containing protein	0.926	229-244	RKKREPIKPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0K6	Uncharacterized protein	0.907	325-336	KISKRRKKTKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4Y7	Uncharacterized protein	0.964	61-86	RDRRNNPKEVAKSRKKDAKQNSKRKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5G1	Leucine rich repeat domain protein	0.607	190-192	RPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X783	Uncharacterized protein	0.62	664-667	RTRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7L3	DNA helicase	0.61	69-70	RR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XH34	Uncharacterized protein	0.844	121-132	KKKSDPRKRARR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIA0	Nucleolar GTP-binding protein 2	0.983	645-675	KNKNRAKAALMKSLPTGKKGGEGRKGKPARP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWF1	Protein phosphatase 2c	0.755	203-212	NGKKEKKSGS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y5G1	Origin recognition complex subunit 1	0.991	285-305	ESKKKGTARRGPPRKKVKKDK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y5G1	Origin recognition complex subunit 1	0.974	365-419	PSKRKRSAGSAFTTPKKPRGRQLKVHPTPHSKAALSRRRQSSSPNKSKRAPVPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1E1	Uncharacterized protein	0.908	90-113	GRPPKAKADEPSDGKKVRGRGRAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1E1	Uncharacterized protein	0.828	681-688	KKRKRPGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1E1	Uncharacterized protein	0.749	477-484	NKRPRSKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1E1	Uncharacterized protein	0.711	636-642	PKRRRTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1E1	Uncharacterized protein	0.668	415-419	KKKAS
UP000017559	Moniliophthora roreri (strain MCA 2997)	F2WVH5	Hyp1	0.826	83-92	SKKKKQQKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W2R3	Retrotrans_gag domain-containing protein	0.926	214-229	RKKREPIKPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W4H1	CCHC-type domain-containing protein	0.72	170-182	KEEKKEEPRKLSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W7R9	Reverse transcriptase domain-containing protein	0.821	58-76	KKKRMEKETVKPKIQRKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMD5	Uncharacterized protein	0.695	394-404	KRSSKKLRSSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUA7	CCHC-type domain-containing protein	0.862	275-292	KKDKKRQEEPKKLSKEER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9D7	Sumo deconjugating cysteine peptidase ulp2	0.963	1076-1102	PKGGKGATKAKKSSSGGNRKPAARLRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9D7	Sumo deconjugating cysteine peptidase ulp2	0.671	476-482	NRGRPKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBW3	MYND-type domain-containing protein	0.8	704-712	AKKKGKERE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCF4	Translocation protein SEC62	0.995	217-236	PKKKSKKKRGDKAAKGDKKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCJ8	Rna recognition motif protein	0.891	347-357	LRKKSRIKKKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJG2	Uncharacterized protein	0.961	393-415	AKFRERWEKLKESAKKKKEAKEA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XR51	Chromo domain-containing protein	0.636	82-85	PKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWG7	Origin recognition complex subunit 5	0.842	395-401	KKRKRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YAZ0	Uncharacterized protein	0.956	167-179	DKSKRRRRTSRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YI30	Uncharacterized protein	0.927	78-94	RGRGNGRGKGRERGRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WL90	Uncharacterized protein (Fragment)	0.929	26-56	SGKRSHKAKAAAASSAAAEPLKPKKWGKKSD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUG8	Minor histocompatibility antigen h13	0.607	44-46	KSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0J2	Uncharacterized protein	0.907	244-255	KISKRRKKTKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2Q9	Uncharacterized protein	0.62	644-649	GSRLRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8J9	Uncharacterized protein	0.827	748-756	PAKAKPKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8J9	Uncharacterized protein	0.655	103-112	AKSKAQVKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8J9	Uncharacterized protein	0.642	63-68	RQRRGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAZ2	Atp-binding cassette transporter	0.745	146-155	KWSKRPKHPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCS4	Retrotrans_gag domain-containing protein	0.952	156-169	KKRRRPKEPVKPKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDE7	Uncharacterized protein	0.747	73-82	AKPGRGRPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSA7	Uncharacterized protein	0.69	75-82	YNRKMRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW61	Ribosome biogenesis gtpase	0.98	660-675	GKKHKKPKRVKQRSGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYI8	Ribosomal RNA-processing protein 36	0.999	257-341	AKKEEREKRKEGKGNWWMKKSAKKELLVKARYEALAAGGDQRAVKKAIEKKRKKIGQKEKRSRPFPKGGNGFEAPERAHKRRKIE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYI8	Ribosomal RNA-processing protein 36	0.686	4-12	RPRPSARKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMQ2	Uncharacterized protein	0.817	61-129	TPTIKEPRKKDQTRNLGRKSPTPSNRSERITHDESRKPQGPAPGLLKPPVRVKKAEVLSQPKEGHRRAP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMQ2	Uncharacterized protein	0.734	28-35	PPKKGHRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMQ2	Uncharacterized protein	0.637	151-155	TKKAP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMQ2	Uncharacterized protein	0.602	158-158	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWI0	Wd-repeat-containing protein	0.838	14-25	PRKKLRKSTKKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0A8	Uncharacterized protein	0.725	214-222	KTKKGGKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0A8	Uncharacterized protein	0.701	1293-1300	ESKRKERQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0A8	Uncharacterized protein	0.616	1285-1289	KSKDK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X287	Ectomycorrhiza-regulated protein	0.731	170-176	RRSRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5K2	Uncharacterized protein	0.719	290-301	KVMGRGNKNKKN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7K7	CCHC-type domain-containing protein	0.732	226-233	EKKKKFEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X850	Lysine--tRNA ligase	0.95	32-57	KRREKQRAKEASKAAKAPAPQERKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8R4	Chromatin remodeling complex subunit	0.992	406-441	KEKKKQKLLKAGFEARARARKEKEREREEKEREEKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8R4	Chromatin remodeling complex subunit	0.878	500-509	ERVPKKKRKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8R4	Chromatin remodeling complex subunit	0.827	468-489	IKDRAKRRAALSDRKSAAAQAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9S2	F-box domain-containing protein	0.692	15-20	RRRGRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEX8	DUF2013 domain-containing protein	0.974	622-643	PPKQRRSAPAPPGPPKRRKPPA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIY9	Centromeric dna binding protein	0.918	389-403	GKRRKRSTRSRSRAP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPY9	Small nuclear ribonucleoprotein	0.626	153-155	KRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y6G2	Uncharacterized protein	0.805	434-468	KQAKKARMPGFHSSKAKVAAPDSTPKETPKKSKKD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y6G2	Uncharacterized protein	0.68	560-569	KTLRRVKRLG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YSQ2	Uncharacterized protein	0.871	172-181	RKKRKELKRL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YSQ2	Uncharacterized protein	0.825	92-107	KGEKKKKNTYKHLIKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WDX7	DNA mismatch repair protein	0.863	432-446	KKKGKPAGGEKEKIV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WDX7	DNA mismatch repair protein	0.803	196-206	KKSPVKRGRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WDX7	DNA mismatch repair protein	0.691	258-265	KKSKARRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQ19	Uncharacterized protein	0.674	116-121	KKEKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7M8	Methylcrotonoyl-carboxylase	0.94	57-80	RARLGGGPKAAERMKSRGKKLPRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBS1	Uncharacterized protein	0.891	73-91	SRPASNKKLSKRNSRRIRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE15	DRBM domain-containing protein	0.889	290-299	KERRRKRRVA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE15	DRBM domain-containing protein	0.723	259-271	KQGKLDRRGRQKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE31	Uncharacterized protein	0.75	624-640	LRRPVRRTREVLRRASR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEI1	Uncharacterized protein	0.954	561-575	LSPKKPKVKKGKEKM
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEI1	Uncharacterized protein	0.634	682-686	PGRKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFQ6	CCHC-type domain-containing protein	0.855	228-243	RKKRELIKPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMT0	SET domain-containing protein	0.758	7-18	KKSKANARRGKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUC2	Ribosomal protein L15	0.951	40-79	SRPSRPDKARRLGYKAKQGYVIYRIRVRRGNRKKPVPKGA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUV7	Uncharacterized protein	0.831	324-330	RKRRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVY6	Gelsolin repeat	0.912	595-608	IHPTKERAKKPKKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YAY0	Uncharacterized protein	0.759	75-87	RRGRRGRWYATRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WL27	Uncharacterized protein (Fragment)	0.988	258-293	AKKSTGKKAKGTKKTSATKKTPAAASKSARKKAPPA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WL27	Uncharacterized protein (Fragment)	0.939	320-337	PQAKPKSKPKQVLKRKKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMG1	Translation factor GUF1, mitochondrial	0.706	624-631	KEGKKRMK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNH2	Cytokinesis protein sepa (Fh1 2 protein)	0.839	1010-1037	PPPPPPPPPPPPPPPRVGPPPPPPPPPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNH2	Cytokinesis protein sepa (Fh1 2 protein)	0.642	811-819	RGSKVSGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WS30	F-box domain-containing protein (Fragment)	0.816	68-83	KKREKIRSLKSPIRRI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6F6	Tkl protein kinase	0.989	573-593	PRKAKPARTPLKRRLRPRKRV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6F6	Tkl protein kinase	0.899	434-456	KASPSPRRLRSKDKDKDKQRSKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6F6	Tkl protein kinase	0.766	503-510	RKAKRKIK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6F6	Tkl protein kinase	0.676	25-33	RSPSSRKRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X784	Structural maintenance of chromosomes protein	0.753	180-190	KARKAMAKKQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD02	Uncharacterized protein	0.907	82-88	RKRKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDS6	Eukaryotic initiation factor 4f subunit p130	0.999	485-655	SKKPIKIENPKDKEKERKEKEEAEKKAKEVERLKKEKEEAEKKKKEEEKKKKEEERKKEEERKKEEERKKEEERKRKEEEEQKKRKEEEEQKKRQEEEKRKKEEERERLRKEEEEKKRVAEEQERARKEEEERRKAEEDAKEKERLREEEEARAKKEAEEKERLQKEEAAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNN5	Uncharacterized protein	0.845	130-144	RMKKQRLAKGKGVKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU07	Patatin-like phospholipase domain-containing protein	0.973	73-87	RVKRKKKKERAHERR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU07	Patatin-like phospholipase domain-containing protein	0.796	131-143	RGKKGLLRKRLRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YPR9	Uncharacterized protein	0.859	179-189	LHSRKRKPKNP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YPR9	Uncharacterized protein	0.651	623-626	RKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKF6	Shuttle craft like transcriptional regulator	0.974	48-67	EDAKKPRDKLPRKKPLRNKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKF6	Shuttle craft like transcriptional regulator	0.809	19-36	RKPNRRHNPNRNRGPRPS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKF6	Shuttle craft like transcriptional regulator	0.717	623-629	KGKGKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKF6	Shuttle craft like transcriptional regulator	0.662	100-104	PRPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKF6	Shuttle craft like transcriptional regulator	0.627	142-145	GRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X415	Uncharacterized protein	0.8	611-625	ERPTKRKRCRSPSPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDC5	Zn(2)-C6 fungal-type domain-containing protein	0.894	227-238	PPRVKKRKRAEP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQR8	U2 snRNP auxiliary factor large subunit	0.991	25-130	HHHRDRERGDRAERYGRRGDDRRDRDRDRDRDRRDRDRDRYRDYDDRPPRRAHHDDDRRREHRGGRDDEGRGERRGREERGGGGGGGGGGGRGRKDGLGTPERRSP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVW9	Histone H2B (Fragment)	0.997	47-85	AGKAPAKTEGSKAAKKTASKSKAAAPADGEKKKRKKARK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YJN9	Atp dependent rna helicase	0.989	370-388	RSGKGKKGKTKKGGEKKGP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WIH6	Uncharacterized protein	0.985	153-186	KKKTAAMIKKRPAEEERQQSDPSKRKPASKKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WIH6	Uncharacterized protein	0.729	241-249	KRKPASKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJV9	CCHC-type domain-containing protein (Fragment)	0.683	276-287	RDEKKQGEPKKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRV5	Uncharacterized protein	0.81	282-288	KPKKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRV5	Uncharacterized protein	0.692	92-99	KEKSKSKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WV70	Mating type protein	0.988	83-105	EEKEAQKKKAAKERPQNRRRRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4Q9	Uncharacterized protein	0.808	149-161	KKKKSSRFGARAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XK44	Uncharacterized protein	0.798	580-587	SSRKRKRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XK44	Uncharacterized protein	0.796	37-50	KRPGRTVVKRGRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSR9	Uncharacterized protein	0.978	378-410	EKAGNKGDGKKQAPKKAPAQTKNGGKGRKTSRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSR9	Uncharacterized protein	0.975	446-469	MNRRKSIKQPEKPRPLPKKIPRKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSR9	Uncharacterized protein	0.814	591-599	KAGKRRRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSR9	Uncharacterized protein	0.66	151-155	RSKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y430	Uncharacterized protein	0.629	197-204	PSGKLAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YPV0	HBS1_N domain-containing protein	0.848	538-557	KPSKLAMKIKKAHEKHEKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWG1	Protein kinase	0.965	993-1003	KRERAKKRKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWG1	Protein kinase	0.95	320-338	SSRKKHARARSRSRSRSPA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWG1	Protein kinase	0.857	353-388	SRDRSRSRSSSPAPKRLRRESSPFIPHDESPRRGRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWG1	Protein kinase	0.801	457-470	RPKKGNRGNGARRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWG1	Protein kinase	0.793	404-413	SHRNRKARRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWG1	Protein kinase	0.737	270-287	KHNGHGKQHKGNQKKHYN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWG1	Protein kinase	0.71	7-13	HRRKPRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W3U7	Uncharacterized protein	0.984	48-64	KLKVKKKKKFKQHKLKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WT98	Retrotransposon unclassified	0.999	177-199	SGGRAGKKNKKKKGKGSKGKEKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WW60	Rna annealing protein	0.993	204-223	PRRRVKKGPKRLKKHIHKHK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WX22	Nad-dependent epimerase dehydratase	0.752	504-516	KKNRKKADMQGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNK3	CCHC-type domain-containing protein	0.916	228-243	RKKKEPIRPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQK8	Uncharacterized protein	0.998	391-421	GRKRPEKRGKEREKEKEKEKKEKEKEREGKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQK8	Uncharacterized protein	0.75	437-448	KKVRSAKPKIKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQK8	Uncharacterized protein	0.645	1025-1029	KGKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQK8	Uncharacterized protein	0.604	877-877	R
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XR93	Ubiquitin carboxyl-terminal hydrolase	0.645	621-625	KKRGP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRX0	ARID domain-containing protein	0.911	933-952	KSPKTKPPAKPRQQPKQRRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT30	CCHC-type domain-containing protein (Fragment)	0.702	275-292	KKDEKRQEEPKKLTKEER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYJ8	Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyldiphosphate specific)	0.796	31-46	KRRPSPLTARRRKSPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z369	ATP-dependent DNA helicase	0.99	1122-1149	RRRIRRRFDDEPEFGSPKPKKKKPRKSL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z369	ATP-dependent DNA helicase	0.987	831-859	SKGKTRLRKSRTVPAEGSKKSKPKKAKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z369	ATP-dependent DNA helicase	0.955	131-144	KSGWRKPKRKGKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z369	ATP-dependent DNA helicase	0.696	778-783	KSKKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z369	ATP-dependent DNA helicase	0.669	935-940	KSPRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z369	ATP-dependent DNA helicase	0.621	1231-1233	RRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WC63	BZIP domain-containing protein	0.754	23-46	RKRPRSEISSEERKEARAHRNRIA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WLD4	CCHC-type domain-containing protein (Fragment)	0.787	229-239	RKKREPIKPKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WT73	Integral membrane	0.784	37-48	PQRPRRGGGGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUS5	Pre-mrna-splicing factor cwc22	0.998	659-715	RRRTSRRRRTRSPSRSPPRRRRGASRDSADSRTPPRRGRSISRSPPPQRRRDETPPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUS5	Pre-mrna-splicing factor cwc22	0.936	770-819	SPPPRNGYRRDRSSSRSRSPPRRGERSGYNKEDPRDKDRGYGERERPTRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3I7	Transcription factor iiia	0.75	313-319	PRKKRRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X695	Putative rpt2-26s proteasome regulatory subunit	0.981	22-49	KKDQPQKKKWEPPLPTRVGKKKRRGPSA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA67	Histidine biosynthesis trifunctional protein	0.695	366-374	KAKKVTRRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF44	Uncharacterized protein	0.641	172-175	KRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUR5	MYND-type domain-containing protein	0.949	5-16	KKSKKKPAPKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVS5	Ribosomal rna-processing protein 12	0.98	984-997	KKRKDRAKRKKANK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVS5	Ribosomal rna-processing protein 12	0.887	1210-1225	KKGGGRKNRIGIAGKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVS5	Ribosomal rna-processing protein 12	0.842	1170-1193	KKQKVKNAKPGHEFKAKRAGGDVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVS5	Ribosomal rna-processing protein 12	0.656	1148-1151	KKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWC6	Uncharacterized protein	0.964	111-135	RHSRSGRKKYVKKHPERVRKVPSRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWE4	DNA replication licensing factor MCM2	0.834	110-132	AEAKMNRRDRVERSGRRGSRAAN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWP7	Uncharacterized protein	0.979	181-204	IKLKKPKKRKNGEEEPEPASKKTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y7B6	Uncharacterized protein	0.824	272-283	PAPRGRGRPRKD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0S7	Ribosomal RNA-processing protein 8	0.99	58-115	KTRDNGPIKSKKKQKKHSKAQDVSIKKKEISRPMPLRAADKRESTSSLPPAKKAKTKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0S7	Ribosomal RNA-processing protein 8	0.708	25-30	RKRKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0S7	Ribosomal RNA-processing protein 8	0.613	39-40	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJ65	Uncharacterized protein	0.652	751-754	RRKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZP7	Proteophosphoglycan ppg4	0.605	7-8	RK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X064	Cytoplasm protein	0.738	421-428	RRRARRRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4M0	Nucleolar GTP-binding protein 1	0.961	640-676	RPRNMLAKAGESDRAIRVKMPKHLFSGKRKGGKTQRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4M0	Nucleolar GTP-binding protein 1	0.733	499-506	ALKKAKKN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGW3	Nad+ kinase	0.804	606-612	MKKRRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGW3	Nad+ kinase	0.63	694-698	DKRSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPN3	Origin recognition complex subunit 3-like	0.962	607-631	EKRRRELLAERRKSASPRKEKQKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSE4	Mads box transcription factor mcm1	0.938	51-83	PKSDKKAGRRKIKIEFIQDKSRRHITFSKRKAG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YIS3	Uncharacterized protein	0.997	97-127	RVRKRRHGFLARKRSKGGRKILARRLAKGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRW3	Uncharacterized protein	0.969	388-415	KAIAEHDRSRDKNKIIKARRLQRKKAKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRW3	Uncharacterized protein	0.912	234-246	RSPPPVKPKKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WME1	Uncharacterized protein	0.982	15-44	KKKEKPPLKRKKRDDVITNGKGPLSKKSKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYB6	CCHC-type domain-containing protein	0.936	76-91	KRKEKKKEEPRKLLKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHR3	Zn(2)-C6 fungal-type domain-containing protein	0.65	617-620	RKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKL1	zf-C2HE domain-containing protein	0.928	215-231	KAKARAERKRKAEENKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVH9	Brca1-associated protein	0.982	590-599	SKKKGGKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVU6	Transcription elongation factor 1 homolog	0.894	3-15	KRKKSSRKPGPAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXI6	Homeobox domain-containing protein	0.662	84-91	RKAERPPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXP1	Uncharacterized protein	0.83	13-28	ERESKGNRKERARLRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YJE1	MAGE-domain-containing protein	0.77	291-300	KKKGGPGKRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRU7	NADAR domain-containing protein	0.97	63-73	RRKKKRRRPSA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3M0	Uncharacterized protein	0.832	25-33	VKKRKRLKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA43	Uncharacterized protein	0.773	237-244	RKGKRKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFL0	Mrna transport regulator	0.773	920-930	SRKVRERRRAG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XH04	Cross-pathway control protein	0.749	484-491	ARKSRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNC8	CCHC-type domain-containing protein	0.932	229-244	RKKREPIKPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU21	Cmgc cdk cdk9 protein kinase	0.973	116-171	RRNGSRPGRGDHWEPGAGSRRDRRSRSRSRSYSPPEKHRLPSRRTPEPAFSPPRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU21	Cmgc cdk cdk9 protein kinase	0.905	373-405	RYKKPDGGGRDAYSKSAPKEPPRIRIVKRRPAY
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWK9	Splicing factor 3b	0.941	557-578	AKKKQKMERDKERGKNKEKEFK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWK9	Splicing factor 3b	0.684	22-33	KNQLRRLKTKQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WIB2	Retrotrans_gag domain-containing protein (Fragment)	0.648	304-312	KPQRNFRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTW8	Uncharacterized protein	0.851	89-104	KKGKPEPELKPKPKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WU11	Ubiquitinyl hydrolase 1	0.975	432-457	KPKKPAAKGKANGKVNGKTTRKKAKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WU11	Ubiquitinyl hydrolase 1	0.93	169-198	KKEKEKNKQSQSQSKRQPKPKTKATTKKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WVG2	Reverse transcriptase	0.787	58-68	RKKREPIKPKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBE2	HEME_HALOPEROXIDASE domain-containing protein	0.706	349-360	KRSKLIRKAAKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XC83	Uncharacterized protein	0.968	1232-1246	RGPLFPRRRRRRPRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF03	Ribosomal biogenesis protein gar2	0.781	53-66	EPVSRSKKSKSSKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF03	Ribosomal biogenesis protein gar2	0.737	37-47	PQKPSKRKLAE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF03	Ribosomal biogenesis protein gar2	0.698	262-275	NKRLIRRQNQKKQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJS9	Uncharacterized protein	0.995	184-282	KRAAKKKARREFIKNKHAERKAATRAKKEAAVAISKAESEQSSASKAPPSKKLKVQGGGASPKMNTKAQRPKGKGESKKPPMSKKDRQSKVAKSVKMRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJS9	Uncharacterized protein	0.762	7-12	RKRKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMR1	Protein-lysine N-methyltransferase EFM6	0.72	233-240	KRRKADKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXL7	J domain-containing protein	0.987	219-250	KEKERERIEREREATRKRKEKLREQERERRKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXL7	J domain-containing protein	0.921	462-492	PKHKHSAHKAAKAKREEMLRHAKDAEKEKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y684	Mitochondrial DNA polymerase catalytic subunit	0.976	1334-1351	KEPGKSRRTGKGRRKAKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y684	Mitochondrial DNA polymerase catalytic subunit	0.899	696-709	KSKSKKAAKPPKPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YPC7	Dna repair protein rad16	0.958	319-349	QARREEKRRLREENKSTKAEEKALKKKLGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YPC7	Dna repair protein rad16	0.853	100-118	NKGRKQVNKPKTSAKGKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YPC7	Dna repair protein rad16	0.761	289-298	GKGKAKAKDK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWK4	Ribosomal protein	0.951	51-67	KKRALKSDRKKKERASH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YYA1	Chitin synthase	0.993	843-862	LKAPPPKPKGGKKGKPRPPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YYA1	Chitin synthase	0.892	211-221	RVARRHKKKRV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W351	Uncharacterized protein	0.713	45-51	WKKKTRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1G2	Kelch domain-containing protein 4	0.997	3-36	KKKSTSTAAKAAKKAKAEKKAEKRTTKKGKKDKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1G2	Kelch domain-containing protein 4	0.984	393-406	LKKPKKKGVAKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1G2	Kelch domain-containing protein 4	0.608	549-550	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5D3	Metacaspase type ii	0.685	479-491	KKMVRWRQKINRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X659	Uncharacterized protein	0.763	58-65	SKPKRIKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X659	Uncharacterized protein	0.731	208-214	QGKKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6J6	Uncharacterized protein	0.999	417-481	KPPAKAPAKAPAKAPARAPAKAPAKAPAKAPAPAKKPVTAKTAAAKKPVAKKPAKKAAAKKPRSL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X738	Uncharacterized protein	0.732	135-146	VRKRLERGGSKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS10	Uncharacterized protein (Fragment)	0.724	199-207	HRKGKEKAP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSM7	Mrna export receptor mex67	0.682	40-51	GRKGSSRIRSHR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXD6	Uncharacterized protein	0.695	119-126	KPPRRPPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRX7	DH domain-containing protein	0.706	984-998	KKLKKHESVRIPRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YST5	Pa2g4 protein	0.976	375-390	KPLRENKKSKKKKAKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YW34	Ph domain-containing protein	0.956	33-48	KKGKQRRRRRAIPPGL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z2X6	Chromatin-remodeling ATPase INO80	0.99	1247-1266	RGKKRKPATRGGRRGGGKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z2X6	Chromatin-remodeling ATPase INO80	0.883	96-107	TSRKRAGPKKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z2X6	Chromatin-remodeling ATPase INO80	0.636	258-260	RKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W9Q8	Uncharacterized protein	0.972	304-314	SPKKKVKKRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WA30	Uncharacterized protein	0.99	24-47	RKDRNKGKQRNRGKKNKKLEENRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WB95	Armadillo repeat protein	0.627	7-10	KKAI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WLE5	40s ribosomal protein s2	0.996	6-31	RGRGGFGRGRGERGRGRRGPRRGARK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WP35	Polyadenylation factor subunit 2	0.662	609-618	GGGGGGGRRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQG1	Uncharacterized protein	0.818	16-23	KKRRRRHN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X252	Uncharacterized protein	0.628	459-462	KRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5Q8	C6 transcription factor	0.877	105-112	PPKKKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFN8	Uncharacterized protein	0.844	280-295	PKKKWRFRKLMRGDRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHR7	Uncharacterized protein	0.954	55-67	SRRDRGKKRRKEI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHR7	Uncharacterized protein	0.938	372-398	ATGKKTKKTATKPAATSKPATRKKKVP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHR7	Uncharacterized protein	0.938	430-447	KPRVRPNSKPKSKREPKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHR7	Uncharacterized protein	0.904	527-574	RRKRIKRVQIAPEVDKSKKRHVELDGKGGAADKATAAKSRGRAKSVGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLC1	Dna damage repair protein	0.982	653-681	PEPKRLRRKAAAKTPKAPTPGPSNKKRHH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLC1	Dna damage repair protein	0.881	732-745	TRTPRRRPPKNPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLC1	Dna damage repair protein	0.625	595-599	KGRGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMP9	Dhx37 protein	0.965	68-89	SKWNSKKKKRLEKYIEKKLKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMP9	Dhx37 protein	0.851	10-28	NARARQSQAGSHKRKKHDK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMP9	Dhx37 protein	0.766	45-59	KSKKEKELDRKERLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMP9	Dhx37 protein	0.663	144-149	RGGKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNN1	Uncharacterized protein	0.792	119-127	EKKKKAALK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNN1	Uncharacterized protein	0.717	179-190	KKPSKQKSKLMK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPJ3	Protein kinase domain-containing protein	0.975	529-546	PAKRGRGRPKGSRNRRPD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPJ3	Protein kinase domain-containing protein	0.887	488-498	SPKRKRGRPPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPJ3	Protein kinase domain-containing protein	0.707	471-477	TSKRKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSL7	Uncharacterized protein (Fragment)	0.966	597-611	KEKDKKSKKKDKKSS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSL7	Uncharacterized protein (Fragment)	0.731	569-575	KEKKKRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKL4	Uncharacterized protein	0.895	148-157	RRRRKRRTER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WW52	Uncharacterized protein	0.618	582-583	RK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAH8	Ubiquitin carboxyl-terminal hydrolase	0.999	614-652	PPRETKEKEKEKEGKEKEKKEKKEKEPHRKPSGWFKRRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAH8	Ubiquitin carboxyl-terminal hydrolase	0.818	958-968	KKDKEKKEKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF38	DNA polymerase delta subunit 3	0.996	414-439	PKKKRKPKKVWPVGKNGLKKKRVMKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF38	DNA polymerase delta subunit 3	0.994	206-268	KKETGTEKPKQTGKLDFSKAKTKAAKEKEAAEKKKTEQPKVKKEEKLKMYKSPPEKKGKEKAS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF38	DNA polymerase delta subunit 3	0.894	167-198	KEAKNKGKGKMPPPLAPVAGPSKQKPAPEPAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF38	DNA polymerase delta subunit 3	0.676	536-540	GKPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF38	DNA polymerase delta subunit 3	0.631	522-528	AGKGGQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF38	DNA polymerase delta subunit 3	0.62	471-473	KGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF38	DNA polymerase delta subunit 3	0.608	341-344	KAAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIZ4	Phospholipid:diacylglycerol acyltransferase	0.621	49-51	KRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKK0	Histone H1	0.998	89-267	GPSGKVKLAPKARTDAAKENTKPAVKKPAATATKSKATTTKSSAAKPAAKSATAKKPTAARTTTTKPKAKSTTAAKPAAKKPAASAVKKTTAASKATKKITATTRKTASAKKSSTSTKKPTTAKKAAAAKKSTTKKPTAKAKATPKKAEAKPAASKAKPASKSKPTSKAAKKPAAAAAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS66	Uncharacterized protein	0.81	89-96	KKKKQRKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSA3	Uncharacterized protein	0.689	445-454	KRRAKFKSHK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YJM6	Uncharacterized protein	0.926	11-25	KISQIKDRKNRKKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXF6	Histone deacetylase sin3 component	0.996	42-99	GLPQKKKRRAGEREREKEREKERALEKEREREREREKEREREREAALKQSSSRSRKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXF6	Histone deacetylase sin3 component	0.902	582-606	KGARGKKGGAGDLRKKLLAKSTNRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXF6	Histone deacetylase sin3 component	0.6	32-32	R
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z2S4	Inositol polyphosphate phosphatase	0.862	150-192	KDKDKDKDKDKDKDKDKDKDKDDKDRDARSSKHSHREEIIKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z2S4	Inositol polyphosphate phosphatase	0.727	435-442	GSKRRRWR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WV32	Phosphoprotein phosphatase	0.932	376-391	RQKKKRWRHHKPSHAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WV32	Phosphoprotein phosphatase	0.7	48-53	KKRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WX59	Histidine kinase	0.797	1015-1022	KPKKAKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WY29	Uncharacterized protein	0.617	821-824	GKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1L9	Retrotrans_gag domain-containing protein	0.646	286-293	KKPQRNFR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YHX2	Replication termination factor 2	0.986	197-215	ERRRALEPIKPKKSKKRKN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YNJ5	Uncharacterized protein	0.914	94-109	KERSKSRGKLNHKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YNJ5	Uncharacterized protein	0.894	426-479	REKAKERKQRIKKQYENDPNGKTKQIAARERHRMAQRRHWEKCRAEINRKQKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWJ9	Ash2-trithorax family protein	0.981	462-482	EKRKQKEKKKQQAEARKRAKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWJ9	Ash2-trithorax family protein	0.845	345-355	RRAKGKRAREG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZT4	Uncharacterized protein	0.97	81-95	RRRRKRRPVAKMAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WBG0	Ribosome biogenesis protein noc4	0.614	13-15	KKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WN37	Uncharacterized protein	0.831	126-137	RRKAKKHLKPIK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQL4	Uncharacterized protein (Fragment)	0.646	18-21	NRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6Y8	Uncharacterized protein	0.747	175-180	KRRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X767	60s ribosomal protein	0.872	186-214	RSHRKPEPYKGKGIFVGDEKIRIKSVKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFB3	Gata factor srep	0.857	321-329	KRKKQRKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFB3	Gata factor srep	0.833	263-273	KKSVIKRRKRV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLM4	Nucleosome assembly protein	0.766	393-402	RRRGPPKGRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKP3	Rna polymerase ii transcription elongation factor	0.995	114-157	KAAKRQHTARGATKEKSRKLDELKAKRKAKDEKSKNRTGSPKRD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKP3	Rna polymerase ii transcription elongation factor	0.99	18-36	KDKKRKRNKSKSSSSKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKP3	Rna polymerase ii transcription elongation factor	0.761	439-445	RRRRERK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WLK2	CCHC-type domain-containing protein (Fragment)	0.747	4-14	RKKREPIKPKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMN7	CCHC-type domain-containing protein	0.865	191-202	KKDKKRKEELKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMN7	CCHC-type domain-containing protein	0.633	417-420	KKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUU2	Nbs1	0.964	757-787	RGDRERQREKEKSEWEGKPNFKKFRKKNKPS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUU2	Nbs1	0.812	853-865	PKRGGRGKSKASA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWP0	Uncharacterized protein	0.904	467-501	KPKPKHKTLDDLRRKTIGGGGITKVGRKTKTPRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWP0	Uncharacterized protein	0.657	126-130	SRRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WX96	Uncharacterized protein	0.997	143-172	RVRSKLKRKKAIKKKGSRPGLSRFNPFKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WX96	Uncharacterized protein	0.976	185-223	PRKVKHKSSRRSVPSSSGSGSRSRSRHRSPRHKSSRRLR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBH9	Uncharacterized protein (Fragment)	0.934	83-105	RKKSVGRSGGTNKGTKKGKKAEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPU2	Uncharacterized protein	0.986	38-118	KPKAPAPKTKVKPIQPNKKVKKEKEVEAPRRQSARLRNVIDPNESPEKKRKREAEIEERRAKEAEERIEAEEKARLAKRPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTI1	Wd repeat-containing protein 24	0.96	854-875	AGPSSRKKRPHSVRRPSTRRRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV81	Snare protein syntaxin 18 ufe1	0.814	17-28	RKGKEREKRPRT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW50	Duf1665 domain protein	0.857	199-213	PAPSLVKEKKGKKDK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW50	Duf1665 domain protein	0.794	67-77	KSKQTKKRKLR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW50	Duf1665 domain protein	0.6	195-195	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XY00	Glyco_hydro_cc domain-containing protein	0.835	43-59	RGHGSLAKKKRSNPSRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XY49	Uncharacterized protein	0.975	255-290	KAREARRKKIAHKTDERERERRGEVLKSTRKRMRKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YDM0	Uncharacterized protein	0.95	37-52	IGRPGRAIAKREKKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YR89	RNA-dependent RNA polymerase	0.96	1266-1285	ARRAANEGAKPKRKSGKPRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YR89	RNA-dependent RNA polymerase	0.663	1306-1311	KSKSKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W4N7	Uncharacterized protein (Fragment)	0.796	175-185	KPRKQRGEKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W5R7	Uncharacterized protein	0.996	517-558	GTKKHKHGKSRKDAGPVKKHMRKVSRVKEKAGTKGGFKRKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W5R7	Uncharacterized protein	0.905	237-251	KIEEVKKKLKKKIAP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W5R7	Uncharacterized protein	0.629	38-42	AKAKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK64	Uncharacterized protein	0.999	244-306	SKKRPAPGSPPAPPPPAKKPKTNAPAPPPPAKKPKVAPPKPPAPKKKPATKTTTKKAVPKKKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK64	Uncharacterized protein	0.704	135-142	RPKKFKKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMZ4	Uncharacterized protein	0.816	289-301	VESKRSKRKNSVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMZ4	Uncharacterized protein	0.611	285-287	RRL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WN57	Rox1p	0.984	82-119	WYRKQEEAKREHERRYPGYKYRPVSKKTRRKRQTKRNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPA0	Uncharacterized protein	0.756	233-240	KRKRGTRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WT22	CCHC-type domain-containing protein	0.779	253-263	MAANKKKKFEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WV15	Reverse transcriptase-rnase h-integrase	0.648	492-500	KKPQRNFRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WV15	Reverse transcriptase-rnase h-integrase	0.603	551-551	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WV15	Reverse transcriptase-rnase h-integrase	0.601	546-546	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDY4	rRNA adenine N(6)-methyltransferase	0.911	36-81	PKKRGRPRKVQVTSPQEAELRPRGRPRKTPAPEATVESKAPKEVKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XM22	Pre-mrna splicing factor	0.995	114-136	GKKDKKDKKDKKDKRDRALRKRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XM22	Pre-mrna splicing factor	0.799	68-82	PRKHKHKSGDSSRRQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y611	Uncharacterized protein	0.615	231-232	RR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRY9	Putative lipase esterase from carbohydrate esterase family ce10	0.729	685-700	KRAIKVIKQREKIAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRY9	Putative lipase esterase from carbohydrate esterase family ce10	0.695	564-572	RRGKLLKKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMQ8	Uncharacterized protein	0.987	261-290	SWRGGRSRGVRGRGRGRQGGEPNSRKRRRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQA5	Uncharacterized protein	0.955	61-85	RMWAGGKKKPVSRGRAVKKQHYRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0M2	Snf2 family dna-dependent atpase	0.899	632-643	AKRKAKAHRPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0M2	Snf2 family dna-dependent atpase	0.859	712-720	KPPKKGKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0M2	Snf2 family dna-dependent atpase	0.647	493-500	RAVKAKGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XI22	Uncharacterized protein	0.745	287-298	RGHRVRRKPVPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIC3	Peptidase S53 domain-containing protein	0.738	36-49	RSKLPRGWSRLRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPN5	Dna repair snf2 family	0.973	67-74	KKKKKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW53	Nwd2	0.972	880-890	QIERKRKKARR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y7T2	AMPKBI domain-containing protein	0.962	186-200	KVSKKRKKSKVKVRD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YD34	F-box domain-containing protein	0.742	54-60	RKRRARR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZT9	Uncharacterized protein	0.653	82-87	RRIRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSV9	Retrotrans_gag domain-containing protein	0.918	229-244	RKKKEPIKPKITRKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2S1	Uncharacterized protein	0.981	630-668	MGPPKKKPKTGRSTVKKPQVVQKAKPAIEKKDRAQRRAS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2S1	Uncharacterized protein	0.819	247-256	HRSKRKRAGS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2S1	Uncharacterized protein	0.736	528-541	LKARIILRKRLHRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5N5	Uncharacterized protein	0.988	560-586	NRRRRMKKIGLKIKRFLDSLARRKKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLM6	Uncharacterized protein	0.858	133-144	RSKKKRSKSIAG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSH4	B-block_TFIIIC domain-containing protein	0.973	555-600	KKRKRADNGDEDAPPKKRGRPPKVGTQESASAPVPKKRGRPPKSAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSH4	B-block_TFIIIC domain-containing protein	0.897	1290-1319	KTRKRLKKEAAEKREQEALEAKAALAKKAE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSH4	B-block_TFIIIC domain-containing protein	0.841	1427-1436	RPPPPKKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT04	50s ribosomal protein l22	0.87	103-113	IKSKKREKKAH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV35	Uncharacterized protein	0.998	211-243	GPKDKRPAKGRKPAAKKETARSKGRGKAKVATK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV35	Uncharacterized protein	0.963	539-594	KKKAKQNPDSGGASDKRLKTVSRKQKENSKTSSGRGKKSTTSKALRPVSKPKGPPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV35	Uncharacterized protein	0.921	471-496	TKARKRTGTKGKPEPSLASSTKKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV35	Uncharacterized protein	0.916	130-147	SKRKPAATTRKRTGGKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV35	Uncharacterized protein	0.899	254-295	DKPPNTSTRKGKKASKEEDAGAPLTVKRKNKSANTTRRKGQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV35	Uncharacterized protein	0.788	67-84	GRETRSRSRSRSRSRSPV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW36	Uncharacterized protein	0.71	591-602	KVLKRSKDSKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZU5	Uncharacterized protein	0.975	14-32	AKKKTLKRSPKKRVTKRPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y5C3	Uncharacterized protein	0.999	363-396	RKKREGKKNGANKASGKKGKKSSASKGPAKRGKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y5C3	Uncharacterized protein	0.963	436-459	KRSNTKKAGDRKKDKMLKRKALEG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y5C3	Uncharacterized protein	0.825	469-488	KKLNAPGQKEWPKPKKILKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZM2	Uncharacterized protein	0.986	59-81	GPKPRSEEKASSKGKKSRRPRRV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK89	Uncharacterized protein (Fragment)	0.792	221-246	KLKHIWKKMGQKMQLNWRHRRKETKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWT3	Adp atp carrier receptor	0.99	56-73	KGEKKSRKKDSKSKKKKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXW1	Uncharacterized protein	0.882	63-77	ARRGRRKGNERGRDS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCI4	Dna-directed dna polymerase	0.835	667-675	KPKKKKFRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRG2	Zinc finger protein helios	0.881	92-107	HKRRVHGYVPKPRKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSG2	Uncharacterized protein	0.989	265-273	KKKRKKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSG2	Uncharacterized protein	0.898	1020-1030	PKSRRAGKRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSG2	Uncharacterized protein	0.825	232-240	KKSKRKKAI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU63	Uncharacterized protein	0.886	32-64	PRRRISQKPPPHLTTAQRKSRREKAEERREDIR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU63	Uncharacterized protein	0.783	662-679	RLRLPGKGSRHAAGSKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVB0	Dead deah box helicase	0.763	964-972	KKESRRKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVB0	Dead deah box helicase	0.674	23-31	KSKISGRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y6N3	Uncharacterized protein	0.69	370-376	KQRRRHK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YQ07	Forkhead box protein c2	0.926	140-152	RVRKKKNKGSKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRM2	40S ribosomal protein S6	0.967	158-207	VRREVKSAKKENAKPYTKAPKIQRLVTPVRLQRRRHLRSIKRRKFEAQKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRM2	40S ribosomal protein S6	0.718	132-143	RLGPKRATKIRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRM2	40S ribosomal protein S6	0.668	218-226	KRIAEKKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRM2	40S ribosomal protein S6	0.643	91-94	ERKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W992	Uncharacterized protein	0.817	39-49	GRTIEKRKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQS5	Box c d snorna protein 1-like	0.908	335-346	RPRPAKKRKLAP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQS5	Box c d snorna protein 1-like	0.869	107-125	KKGMRGRGKGAGGSRGGKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTF5	Non-specific serine/threonine protein kinase	0.783	18-32	KKAAERKRRVYEPRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTF5	Non-specific serine/threonine protein kinase	0.65	337-340	KRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WY39	Cop9 complex subunit 7a	0.838	264-285	RGKNRKAPQAEVSKPQRKRNRL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYF4	Cmgc clk protein kinase	0.701	135-139	KKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYF4	Cmgc clk protein kinase	0.629	466-470	PKPKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYL0	Uncharacterized protein	0.97	242-267	KPKESMNKETAKGKGKDKKGKGIGKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYL0	Uncharacterized protein	0.95	429-441	RPPRHRKRQKKKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYS9	Autophagy-related protein 3	0.815	305-316	PKEKKKWFGRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZA9	Proteophosphoglycan ppg4	0.848	349-371	KKAGWYKPWLRSRKMNHDKRRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3T4	Uncharacterized protein	0.989	15-44	KDPKKRKDRNAHPRGAIHPRKRVTRKPPPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3T4	Uncharacterized protein	0.632	607-610	VRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEA0	Ny-ren-24 antigen	0.995	10-94	SPRRRHDDRDRDRSERDRRPKYDEESRHKRGRRSYSRSRSRDRDDYSRDGRERSTSRERRKRYYLRKRDKSEERRARKAEKKRMK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKZ0	RING-type domain-containing protein	0.959	92-122	IKKIGRLEKEIKELKEAREKDKRKIAWLKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKZ0	RING-type domain-containing protein	0.883	322-340	KRSRMKQLAEERRSKRTRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYB3	Uncharacterized protein	0.997	754-780	TRSKEAKKGKEKEKPKDTKKKGKQKQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYB3	Uncharacterized protein	0.941	988-1008	TGGRLRKKDKDDRDRKGKGKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYB3	Uncharacterized protein	0.834	538-549	RRRKEKEREKDR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYB3	Uncharacterized protein	0.661	1082-1087	KKKGSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W3N4	Gag-pol polyprotein	0.717	1363-1372	LKSSKSRAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WCZ4	Atp-dependent protease la 2	0.919	512-533	LRKPDPPAPPKPNQRKRKTHVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WHN3	Tubulin binding	0.645	491-500	RGGAIRGRMP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSD9	Uncharacterized protein	0.74	266-271	KRRRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3Q0	40s ribosomal protein s9	0.939	167-183	GRPGRVKRKRAAAAAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XC35	Uncharacterized protein	0.688	137-145	SPHRHRHRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPC7	Uncharacterized protein	0.996	649-675	SSSPHGKGKGKTQKKRGKPEKERGRSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQI6	Retrotrans_gag domain-containing protein	0.696	388-396	RRREEPKKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXQ3	Atp-dependent rna helicase dbp8	0.941	573-586	KREKIRRQKFKRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YM05	Glycoside hydrolase family 5 protein	0.786	472-485	KGHRDRYKRRTLRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YP53	Putative magnesium-like protein	0.719	324-332	MRKRTRRQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YP53	Putative magnesium-like protein	0.668	358-362	KRRRQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WL54	CCHC-type domain-containing protein	0.846	274-289	KKDERKKEEPKKMTRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WLT4	Uncharacterized protein	0.611	77-79	KRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNC8	C2h2 conidiation transcription factor	0.757	294-299	KKKKKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WS20	Uncharacterized protein	0.987	71-96	SRSKERRRRGKDPIKELLKGGKKAKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WS20	Uncharacterized protein	0.952	723-743	KSKSRSKGSKKPGSQRGKERP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WS20	Uncharacterized protein	0.725	339-346	KRGRKRNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXK9	Swi-snf complex subunit	0.997	1495-1527	KVNGKEKEKEKEKEKEKERERKREREKEREKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXK9	Swi-snf complex subunit	0.938	863-891	RRRDHERARERGRHAQKGPLRREGLKLPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXK9	Swi-snf complex subunit	0.875	1183-1193	KRRKRNTRGRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXK9	Swi-snf complex subunit	0.861	1011-1019	NGAKKKKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXK9	Swi-snf complex subunit	0.646	1282-1288	KKPIPKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X524	Non-specific serine/threonine protein kinase	0.961	433-460	KDRARQQKKYHSKRSTRRAGRPGGSKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X524	Non-specific serine/threonine protein kinase	0.622	418-420	RKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X533	Endosome protein	0.754	585-591	GRRSRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA71	60s ribosomal protein l36	0.958	63-85	SKDKKARKLTKKRLGTLLRSKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBG5	Uncharacterized protein (Fragment)	0.996	81-109	RKKAFKLVGRSGGRNKGTKKGKKAKKQIK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBZ7	p21-activated protein kinase-interacting protein 1-like	0.939	18-65	KKTRIEEPSRPLASRVKGSPRPQKQKSGKSKNAENGAPASAPSTKSKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCL3	Meiosis-specific apc c activator protein ama1	0.805	24-31	SPRRKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XK46	Pre-mRNA-processing protein 45	0.902	211-235	RFKHKKLPRGPPSPPPPVLRSPPRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQB7	Uncharacterized protein	0.728	180-187	RPAKSKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQB7	Uncharacterized protein	0.661	286-291	KLSRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQB7	Uncharacterized protein	0.656	121-126	GRRRVQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUH0	Transcription factor BYE1	0.948	1089-1132	GRGGGAGGDRGRRGSGSRGNRGGGRNRPEDWSRRPVDSGWPRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUH0	Transcription factor BYE1	0.915	290-325	RKRRLTKGKPSSSSPGPSSKRKAQASAPYHPPPQKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUH0	Transcription factor BYE1	0.849	50-72	KPTKQKALPKAKEKPQVAARKAQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUH0	Transcription factor BYE1	0.771	213-219	KPAKKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV80	Non-specific serine/threonine protein kinase	0.73	456-462	RRREKKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW24	ATP-dependent RNA helicase DBP10	0.997	879-935	RPAPNKKGKTKVSSRYGGKSIGRVKSELKNAEQIRKSRKVQERRKLKNARPTRKGRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW24	ATP-dependent RNA helicase DBP10	0.904	373-383	KKGKGKGKGKD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW24	ATP-dependent RNA helicase DBP10	0.768	771-775	KKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXX0	Uncharacterized protein	0.763	600-613	KLRRTKRIGSRIRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJ80	Uncharacterized protein	0.989	648-689	GTKKHKHGKSRKDAGPVKKCTRKVSKVKGKASTKGGSKRKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJ80	Uncharacterized protein	0.897	165-186	KAPAKAKAIPKAAPKKTGDSRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJ80	Uncharacterized protein	0.871	338-355	SAKMGEAEKKLKKKIAPG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WL79	Transposase	0.883	71-82	KRAKPGRGRPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXP7	Uv-damaged dna-binding	0.931	275-287	KGKRKRLDKRKSG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXP7	Uv-damaged dna-binding	0.786	294-308	EKAKQKEKEREQKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1N9	Uncharacterized protein	0.738	750-760	VRRSKRVANKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9S4	Atp-dependent rna helicase prh1	0.848	38-46	KRKRKHLKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE23	Phospholipid-transporting ATPase	0.839	1287-1307	RMTRRGKKPWFSALKKGYKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFV5	Transcription initiation factor tfiid 111 kDa subunit	0.977	389-407	KVRTAKKKKDKAGRKLGKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFV5	Transcription initiation factor tfiid 111 kDa subunit	0.927	872-902	KDRRARKRIEEELARMKKNQERRLHRKNAKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFV5	Transcription initiation factor tfiid 111 kDa subunit	0.897	94-115	PGAIKQKQKRVRVVKRRVERPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIN2	DUF2235 domain-containing protein	0.996	267-302	KLGLPPGSMPKSRPRPRKKESEKKEKQEKDKEKDDK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIP4	Nucleolar protein 9	0.956	762-774	PKNDAKEKGRKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIP4	Nucleolar protein 9	0.92	697-708	PKPKKRKRDGAP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIP4	Nucleolar protein 9	0.848	5-13	NRKRGKRKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIP4	Nucleolar protein 9	0.706	722-735	KKMKGPGLAPKAKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XR28	Bud22 family protein	0.991	305-344	EKKKNRRGQRARRAIWEKKYGRNANHKKKEVAESGERGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XR28	Bud22 family protein	0.953	12-63	VKRKRQENPKEKDLNAKMVGKLHHDLKEVRKAAKKAKAFETQKLIKKLKGLR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XR28	Bud22 family protein	0.767	401-421	KKKLKEKQSAAITPPPPGRKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTJ2	Uncharacterized protein	0.797	301-310	RRERRRERRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y268	Cytochrome p450 (Fragment)	0.865	221-242	KKSDKGKRPTNSKKRQTQHRPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X210	tRNA (guanine(9)-N1)-methyltransferase	0.995	36-79	LSKKAMKKAAKQQRYQEFKLERRAREKETRKEKKKILRQKRAAG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X210	tRNA (guanine(9)-N1)-methyltransferase	0.92	89-97	ERRKKRRKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9N0	Stress response protein NST1	0.999	518-694	EREAKKQTANQKKKDKKRQQKLAKEEEKAKKEAEKAAEEAASKAKQVALEEEQRRKREEDRAKREVARKAQEEEKARKDEERRKRLAEEKEREAERERKRKEKEEKLRAERREKEERDRKAKEEREEKLRIERAERVAAEKARKEEKEREEKAERERKEKERKEKEEREKEAKEKAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGD6	Uncharacterized protein	0.834	701-728	KGGVKKFLKAITGGRNGGKKHVPIVKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQP4	DIS3-like exonuclease 2	0.946	645-674	KKEKEEKKRKKEENAAYDPKSAAGRKDDKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQP4	DIS3-like exonuclease 2	0.661	15-31	KDEKRPGSTGNNRGPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQP4	DIS3-like exonuclease 2	0.655	81-95	GKKPDQRSGGRNPSG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUP2	Chromatin modification-related protein	0.99	451-474	NKGPKRSGRGGRRKAGGNRGGRGT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUP2	Chromatin modification-related protein	0.804	191-214	RTPRREKVTEGISRPRNGARAKKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUP2	Chromatin modification-related protein	0.723	177-184	AKRKRVPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWF2	Na+ h+ exchanger 1	0.91	692-706	VSKKGRSKRRASMRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWN8	BTB domain-containing protein	0.802	308-325	RKKSIRKSILRSLRLTKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ39	U3 snornp protein utp20	0.983	2555-2588	NRKAHRNAVKKDSRKRKNQSFVEGKGKPKRRREE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ39	U3 snornp protein utp20	0.941	1879-1891	PKKKGKKGKEDKN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W939	Uncharacterized protein	0.969	873-889	KKLRDRGKGEKGKGKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W939	Uncharacterized protein	0.946	464-476	SGLKSKRKKKPGF
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W939	Uncharacterized protein	0.848	188-219	GAEGRKKPVGRGRAWEHDFAERQKDRAKSQRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WFA1	Uncharacterized protein	0.996	76-107	NAKGKGKKKDRQSEEKEKGKGRKKNKTNEKSP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJE6	Rna-binding protein cwf29	1	173-218	KALKNAKKSKSKGKHKDKTPEERRARKERKREKKAKKEKKKSEGVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJE6	Rna-binding protein cwf29	0.993	237-289	SSRRDDRSRSRSPNRSPPRRKHYSRSRSPPTRRDYRSRSRSPPRRPNERSRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKA4	Uncharacterized protein	0.888	58-73	RKKREPIKPKIVRKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRF0	Uncharacterized protein	0.913	333-344	KLSKKRKKTKLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WV90	C2H2-type domain-containing protein	0.922	109-123	PKTHPRPSKRNKKKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYG8	Myo-inositol transporter itr1	0.936	517-532	KESKRLRKAKKEIKGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7V1	ABC transporter domain-containing protein	0.849	265-276	EEKDGKRKKLRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBG6	DUF2235 domain-containing protein	0.779	516-527	PKQKKRGVRVHR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBG6	DUF2235 domain-containing protein	0.692	318-326	KPKKSKTLR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLI7	Zinc-finger domain of monoamine-oxidase a repressor r1 protein	0.99	327-338	GKKSPKRKKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y8A4	Uncharacterized protein	0.987	476-489	QKKRKPRKLRKPKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W4C5	Retrotrans_gag domain-containing protein	0.862	229-244	RKKRELIKPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W7T2	Uncharacterized protein	0.796	292-300	KRAKKAREK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJ15	Uncharacterized protein	0.725	31-38	RRAARRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNA9	Rsc complex protein	0.622	131-137	KKPVPPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WY78	Uncharacterized protein	0.867	533-545	RERERDRKKGKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0S7	Uncharacterized protein	0.771	59-67	EKPRKEKRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8Q2	Uncharacterized protein	0.953	241-253	KKRKRAWLKKRRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBC0	Uncharacterized protein	0.948	103-127	AKKLARKLKKGAEKNDNMKKRMRDT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBC0	Uncharacterized protein	0.823	131-142	KDENARKRMKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XC72	Uncharacterized protein	0.948	393-404	KEDKKKKKNRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGT2	Uncharacterized protein	0.696	32-37	GRKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XH11	Uncharacterized protein	0.963	395-406	GRRRKQRARRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIF4	1,3-beta-glucan synthase	0.788	222-231	KSKRGGGKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKX2	Nacht and ankyrin domain protein	0.729	1276-1287	RKKPAPRTPSKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKX2	Nacht and ankyrin domain protein	0.635	250-265	RREAAGERLKAQAERR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPX4	Uncharacterized protein	0.82	119-131	KSKSASKEKPKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y2H2	Uncharacterized protein	0.986	674-837	RERDRDRERQRERERERERERERERPVKKERESPLPLPTKSKQDLSSLPSSKTKDKRKERVSPPAPAPTLKSKEKPVKRERELSPLLAKKRDLSPPKVKREASPLPRITKTQPVKQDPSPMPAPLPRMTKKEPVKKERDVSPPLPPARIKKEKEDRDKDRDRDR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y2H2	Uncharacterized protein	0.975	537-589	REPRRELSRKERERDRDRDRDRDRDRGRGRERDSSSLSRRERDRERERDRDRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y2H2	Uncharacterized protein	0.804	328-338	VKKAKEKEKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y2H2	Uncharacterized protein	0.72	648-653	RKKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y2H2	Uncharacterized protein	0.683	482-494	KRRDTSPAPKRER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YJF1	Uncharacterized protein	0.952	1009-1038	RGKTKVRASQPAKTKPKEKRRTTYKYEKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YJF1	Uncharacterized protein	0.816	785-792	RRKRKRDR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YJF1	Uncharacterized protein	0.772	1058-1076	APRKSARLASKTEAKGKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YJF1	Uncharacterized protein	0.613	1044-1046	RRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YVX3	Non-specific dna binding protein spt2	0.985	34-108	RMEKNKKEEEKKRKQLEREEADRKREIELRKKRFEEEERERQRQRKKEEEEKAVEAVRQKRAEEEKNKLLYGKPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YVX3	Non-specific dna binding protein spt2	0.867	457-469	KRREEEKKQRKRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YVX3	Non-specific dna binding protein spt2	0.781	354-372	GRAPDSKKRQRSSSRSESP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YVX3	Non-specific dna binding protein spt2	0.632	374-378	PSRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WA88	E3 ubiquitin-protein ligase listerin	0.997	13-53	GTRKKHAKKAASRLGEEPEPVQQKQKKEKGKKGPKKEPKQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WST6	Transcription factor 25 (Basic helix-loop-helix)	0.994	111-129	KNDKKAAKKAKAKAKKKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WST6	Transcription factor 25 (Basic helix-loop-helix)	0.992	64-76	SSKKKPKKKKKAG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WU26	Histone-like transcription factor (Cbf nf-y)	0.992	106-151	KEKKKKSKGKRAAAAAAAAAAAVNADRTPAAPKRRKKKKDEEPASK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3A2	Iq calmodulin-binding motif protein	0.665	28-36	KIQKAWRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3B1	Uncharacterized protein	0.672	50-56	RKHAKHK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6W7	Uncharacterized protein	0.81	44-53	KSRRTRRRRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XB24	Ectomycorrhiza-regulated protein	0.753	465-472	ARKSRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBB3	Mtf2 domain-containing protein	0.854	357-374	RGSESKRRGRSDSKKPAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIR0	Uncharacterized protein	0.862	79-102	KRARTSTTKKRNVGSPTRRRAAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XM92	G domain-containing protein	0.643	326-329	RRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU22	Uncharacterized protein	0.696	340-348	RKSDRKERR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMQ6	Small nuclear ribonucleoprotein-associated protein b (Fragment)	0.69	40-45	VRPKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WR00	Uncharacterized protein	0.84	16-27	KPKPKRASKPRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRA2	Dna repair protein rad16	0.991	78-105	KKKDREKAEKKASRRRVRGGAPAGGAAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRA2	Dna repair protein rad16	0.682	26-30	QKRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRA2	Dna repair protein rad16	0.646	12-21	RKMMLRKLKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXN6	Uncharacterized protein	0.948	4-15	KRRKGKAKAGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4Y1	Dna polymerase alpha catalytic subunit	0.804	94-105	TAKSKGKPKAPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5E2	Zn(2)-C6 fungal-type domain-containing protein	0.871	245-255	GRKKRRTPPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9K8	P4Hc domain-containing protein	0.86	49-56	EKPKRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XB02	Uncharacterized protein	0.607	232-233	RK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDX9	High mobility group box domain containing protein	0.999	57-115	KKPAAKKTAVKKPVKKTVAKKKPAKKTPAKRTLAKKRVAKKKDVRPKFDKQLLKPPKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDX9	High mobility group box domain containing protein	0.762	193-205	KKKCKAKGKPAPS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XK31	Flap endonuclease 1	0.996	325-362	PKTSKGKEKATSKSSSKKDKGKDKEKTKKGTAKGKGKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XK31	Flap endonuclease 1	0.996	443-496	KPKEKTEPAKKGAAVTKGGKDDKGKKGATSGAKRKGKDQDGGSKSKKAKSSGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XM70	Centrosomal protein atpase	0.862	15-26	KKEKKRKDISGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XM70	Centrosomal protein atpase	0.698	280-285	GNKKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XM70	Centrosomal protein atpase	0.646	127-130	RRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YNX1	Autophagy-related protein 4	0.877	1007-1015	TRKKKSKKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YNX1	Autophagy-related protein 4	0.734	623-636	RSRDRSTREKGKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWH0	KDa trp-asp repeats containing protein	0.601	368-368	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZ56	Atp-dependent rna helicase	0.881	374-389	KRKLRRGRDKLPPGPG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZ56	Atp-dependent rna helicase	0.805	689-706	GEGRGSGRAKEVRRRVAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZ56	Atp-dependent rna helicase	0.68	50-55	RKKNPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W5W0	CCHC-type domain-containing protein	0.835	275-290	KKDKRKQEEPKKLTRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WEY8	Phosphatidylserine synthase 2	0.954	435-453	KARKYIRRNERRRAKSKAQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK04	Reverse transcriptase-rnase h-integrase (Fragment)	0.655	87-90	KKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNS1	Uncharacterized protein	0.942	328-341	GFKISKRRKRSKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQC0	CCHC-type domain-containing protein (Fragment)	0.634	875-877	KKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTD7	DNA replication licensing factor MCM7	0.927	698-715	AGAGRMKRTKKTRRFGKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYE4	Regulator of filamentous growth and virulence rfg1p	0.945	122-137	SKKKKQMLKAKRKAGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYE4	Regulator of filamentous growth and virulence rfg1p	0.815	15-29	KSSRKTSKSSRKAKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1S4	Uncharacterized protein	0.998	405-435	PKKRKRGTAKKPRKPRAPQPSGTGARSSSKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1U0	Uncharacterized protein	0.912	279-302	SKRRRSPSPIPSTRSLRARTKRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD90	Protein required for cell viability rrp17	0.997	164-223	PAPPAIKRDSTKKAKLKPKKIRYETKEARKAERSKQRARRTEKAELAGGKAARNKGKKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD90	Protein required for cell viability rrp17	0.989	46-77	HKRKVAKAEAARKKAAEREKRERLQTKKEQRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDL0	Nuclear export factor	0.918	52-80	RWERGGHRGGRGGRGGRGSGPGYSSPRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDL0	Nuclear export factor	0.883	994-1006	SKKRARKRLSERS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDY5	Uncharacterized protein	0.923	491-525	KKSRKRKTRSSNGEQELQGLRRSLRRKTKVARNPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDY5	Uncharacterized protein	0.763	295-301	KRVKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDY5	Uncharacterized protein	0.632	191-196	RKGGRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE86	Putative proline serine-rich protein	0.978	26-84	RGRRGGTRGGGPGRGRGGAARGANRGTKPPEVATDSPKPATEKPPPTPQRPKAPSRKPS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE86	Putative proline serine-rich protein	0.883	351-379	PSSGRGGSRNQRPEREKFKEKTGKDKSAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTR4	Peptidyl-trna hydrolase domain protein	0.952	168-191	RSANERRMKEKMRRKSVKQSRGKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YSF0	Uncharacterized protein	0.665	158-164	RKTKKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YX71	CID domain-containing protein	0.672	186-192	ERHKRLR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W3S8	Uncharacterized protein	0.788	306-325	KKPGNQKQYQEKKKSNKGKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQG6	UBX domain-containing protein	0.91	380-428	RDKERILAKMREEEERKRREEEEEVERLRLIREAERLKREEERKRRVRV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WX05	Nickel/cobalt efflux system	0.703	150-156	KRRRDRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WX84	C2H2-type domain-containing protein	0.684	315-326	GRRKNTSGKTQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0Z0	Uncharacterized protein	0.997	861-906	SRSKLPKAPQPRSAAAPTKQSKKAPTTSKVRKGKRASRKTKSKAPS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1H9	Uncharacterized protein	0.936	370-395	TKRKKGDHQELRRGTRERRRPLRYRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1H9	Uncharacterized protein	0.899	206-222	PRRRSTRAKAQKRSKAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1H9	Uncharacterized protein	0.737	277-283	KPKRKKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1H9	Uncharacterized protein	0.658	162-169	SKTKAARR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4P7	Uncharacterized protein	0.656	75-78	KRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHI4	Uncharacterized protein	0.927	87-102	EPRKGALPRRRTRKRV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHL1	Peptidyl-prolyl cis-trans isomerase cwc27-like protein	0.998	450-488	RQRGARAREEEKERKRKERARGGGGRPRHGGGGHGERRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHL1	Peptidyl-prolyl cis-trans isomerase cwc27-like protein	0.768	352-364	AKGRGLSRKMRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHL1	Peptidyl-prolyl cis-trans isomerase cwc27-like protein	0.747	191-203	EREEEMRRRGAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHL1	Peptidyl-prolyl cis-trans isomerase cwc27-like protein	0.651	336-341	KKKQKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKC9	Dead deah box dna helicase	0.799	1188-1199	TRNTRPIKRPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMW4	Uncharacterized protein	0.605	872-873	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPH2	Abc transporter	0.746	497-507	RDGDRKSKKTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVN5	Deah (Asp-glu-ala-his) box polypeptide 35	0.682	186-191	KIRRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y5I2	Uncharacterized protein	0.772	7-19	PSRSPSPARRRRH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YJN1	Camk camkl mark protein kinase	0.997	583-626	KNKDKGKGKEKEGEKDKEKNKEKGKEKEEESKHRHHHHKHRHRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YJN1	Camk camkl mark protein kinase	0.99	753-801	AVKEEKDKEREREKSREAEREKVSVEKEKEKEREREREKEREREKERKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z207	Ste ste11 protein kinase	0.95	993-1014	KEKKVRRGKKSIRIVAEEHKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W9I7	Flagellar associated protein	0.606	308-309	RR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJM2	Uncharacterized protein	0.948	238-261	KRNEGEKKRKRGSGSEKVQRVQPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X158	Succinate:fumarate antiporter	0.931	374-393	KRVVKAEAKRRAKEAAKKAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X158	Succinate:fumarate antiporter	0.657	23-26	KRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2P9	Uncharacterized protein	0.787	250-266	LKDKRAANPHKKVKMEP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKM3	Dna-damage-repair toleration protein	0.96	179-193	RQKRKVGKGKGKKNR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKM3	Dna-damage-repair toleration protein	0.652	229-241	RRERLAEERRSGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ52	Uncharacterized protein	0.957	90-105	KRRPGRPRGSKNRKSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YJ13	Toxin biosynthesis protein	0.748	123-137	MRREKDQDKGKKGQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z316	Sec7 domain protein	0.851	361-369	HRKRRPPRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z330	Rrna-processing protein utp23	0.975	252-262	GRRRKRKRKTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z330	Rrna-processing protein utp23	0.969	181-198	PRKKRKGPKGPNPLSVKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W3V6	Uncharacterized protein	0.984	79-116	EWKLQRPGARRSHKGPQPEKDHNGEKKSKKKTGYKARR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSQ2	Uncharacterized protein	0.999	883-916	SGKSGKTARHGEEKERRKKKKEKVGRGRGKAKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSQ2	Uncharacterized protein	0.939	681-712	SSAKRPKSRGPSPSPSRDIAPPAPKPKPKSNP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSQ2	Uncharacterized protein	0.843	1117-1141	KKKEKDVGVGRRSRGGRETKASAPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSQ2	Uncharacterized protein	0.837	756-768	RKKARSRSRSRSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSQ2	Uncharacterized protein	0.705	1159-1177	SKSKSPPAAGPKPTPALKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSQ2	Uncharacterized protein	0.653	641-646	PKKEKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X696	Pre-mrna-splicing factor syf1	0.771	136-144	KKRAGGRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6J1	Alpha beta hydrolase fold protein	0.708	37-44	KRLRKSKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBZ0	Uncharacterized protein	0.928	19-34	HPRPIRRRPRPKGLWK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBZ0	Uncharacterized protein	0.852	537-545	KQRRGKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLG2	Ankyrin repeat domain protein	0.65	311-316	RSPRRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLG2	Ankyrin repeat domain protein	0.622	987-989	RKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y0Q1	Guanine nucleotide exchange factor	0.646	151-168	RATRDGGGGGGGRSDKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YDU9	Scf complex subunit skp1	0.679	390-395	TKKRSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YIQ8	Diadenosine tetraphosphate synthetase	0.915	138-146	DKKKKKKAV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W4M1	Pro-pol protein	0.746	625-633	KRGPRKKLP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WGV3	Uncharacterized protein	0.992	60-85	ASRQKRREKKGKKCKAKNSDSKKSKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WS53	Uncharacterized protein	0.89	332-352	PRRKKAVASSRAPHRKSGKEN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSS4	RRM domain-containing protein	0.937	7-29	RSPRKTSRSRSRGRSPRSRSTRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3D3	Rna helicase	0.834	48-68	PRNPRKSFQKHPEKKAEKSGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3D3	Rna helicase	0.691	644-652	GRGRVKKHR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X792	Topoisomerase 1-associated factor 1	0.992	584-594	RKKKSKRRKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X792	Topoisomerase 1-associated factor 1	0.992	1014-1036	SQGTKKRRRKAGENAEKKKRQKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X792	Topoisomerase 1-associated factor 1	0.966	924-933	KKRRRRRRVR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X792	Topoisomerase 1-associated factor 1	0.942	949-964	KARRERKREKRQEEKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X792	Topoisomerase 1-associated factor 1	0.897	1075-1088	KERPRPKPRPIPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA92	F-box domain-containing protein	0.927	10-19	FARKKRKAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHL7	Uncharacterized protein	0.67	41-49	RSIVKRERK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSJ5	Uncharacterized protein	0.786	280-287	SKKKKPEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSJ5	Uncharacterized protein	0.762	248-258	NHEKSKGKGKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVW5	tRNA (guanine(26)-N(2))-dimethyltransferase	0.901	66-93	RWRQGQERKAVKVRSKEESARKRQKEHP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVW5	tRNA (guanine(26)-N(2))-dimethyltransferase	0.801	551-559	GKNGKRKRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXI9	Uncharacterized protein	0.95	85-102	RRLAREKKAPKTRKSSRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXS6	Protein SDA1	0.987	666-739	SIQKGREGREKFGSRKGKKTKEAPSSSTNREKAKNKPIMMILSSGAVRGKKKASLREKQQKLRAHIERGKKAHR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXS6	Protein SDA1	0.975	265-295	HRREINKKTRSGDKKLQKKLNTAKKKKHSSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXS6	Protein SDA1	0.614	654-656	KKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0U2	BZIP domain-containing protein	0.77	30-40	GKPGRKKNPNS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WLB7	Uncharacterized protein	0.664	279-284	RGHRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WR13	Arsenite-resistant protein asr2	0.809	56-75	RGRSRSPPFDENSRKRRRSP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WT79	F-box domain-containing protein	0.996	33-73	RPRKRARQDGPAEEVEPPAKKPKSRKPPLARPHARTRRRTR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X624	Pre-mrna-processing-splicing factor 8	0.722	159-169	REKRDRRHFKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7U2	Required for respiratory growth protein 9, mitochondrial	0.623	147-150	KEKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAQ7	Uncharacterized protein	0.873	23-49	RARSRRTPRRFLGRPSFTKSKAALKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLH2	Uncharacterized protein	0.972	419-431	GGKKKKKYRKGKM
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLH2	Uncharacterized protein	0.905	474-482	PKRKKPKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLH2	Uncharacterized protein	0.728	390-396	RRKGKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVD5	Non-structural maintenance of chromosomes element 1 homolog	0.959	240-253	QKGRKSKGKGKGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVI3	Atp-dependent rrna helicase rrp3	0.829	413-420	GKKRRRKN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVI3	Atp-dependent rrna helicase rrp3	0.813	441-448	RKKKSRSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXA8	Uncharacterized protein	0.725	265-273	RRSARRKSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y118	Ring finger domain-containing protein	0.997	52-64	KDKKKRRKKRRKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W515	Retrotrans_gag domain-containing protein	0.733	15-22	KKKKNKGA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W515	Retrotrans_gag domain-containing protein	0.702	181-185	KKKKF
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKI5	CCHC-type domain-containing protein (Fragment)	0.93	155-170	RKKREPIKPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYW5	Uncharacterized protein	0.651	30-35	KKGGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBA0	Zn(2)-C6 fungal-type domain-containing protein	0.786	7-19	KSKRRRERNIFKQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDT9	Uncharacterized protein	0.84	152-167	APSKPPPKLPKPLKKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDT9	Uncharacterized protein	0.699	86-94	PRNRAKHKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDT9	Uncharacterized protein	0.61	71-72	KR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XG47	Mitochondrial chaperone bcs1	0.999	680-735	KEKLKREKAKREEERERRRKEKAEKEKEEKRKKEEEEREEKRRKEREEEERLKREK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XI50	Uncharacterized protein	0.641	263-267	KSRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ37	60s ribosomal protein l3	0.95	18-39	PRKRAARHRGKVKSFPKDDPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ37	60s ribosomal protein l3	0.825	124-147	RSKKKAFTRYAKKHAEDGGKSRAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ37	60s ribosomal protein l3	0.701	237-246	KKLPRKTHKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ47	40S ribosomal protein S7	0.935	101-120	RRMLRKPSKHSRVKQKRPRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPL3	Protein MAK16	0.997	276-306	KTSLGKRKAPSTSQPKPPKKRPDKKQKKGPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPL3	Protein MAK16	0.745	136-150	VKKKLDRREATRERK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUL1	Zinc finger matrin-type protein 2-like	0.969	43-61	ENEERLKQGKRPRKGPKRD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUL1	Zinc finger matrin-type protein 2-like	0.664	29-35	KARKRDL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUL1	Zinc finger matrin-type protein 2-like	0.618	37-41	EKERM
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y0R9	Pescadillo homolog	0.83	604-620	EKKRNIQKQKGRQQKKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y0R9	Pescadillo homolog	0.742	553-560	KSRRKAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y0R9	Pescadillo homolog	0.712	47-53	PRSRKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YK24	Uncharacterized protein	0.977	128-145	HRKTKRRRKRVTSRSRSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKH6	Non-specific serine/threonine protein kinase (Fragment)	0.932	365-385	SKRKRTDVHGSESKKARKGGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKH6	Non-specific serine/threonine protein kinase (Fragment)	0.646	323-330	RAKPVHRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKH6	Non-specific serine/threonine protein kinase (Fragment)	0.612	336-337	RK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTI0	Uncharacterized protein	0.64	60-64	KKKPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZ33	Uncharacterized protein	0.978	200-223	KRKSKPRKAKHNGGCKSRRKGVRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X917	60s ribosomal protein l25	0.991	144-199	KKRMFKGHKWERTKERREAHRSMLLRDMDKRVRRWKDYHRRRRPDPLKPPKRLSGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9W5	60s ribosomal protein l24	0.99	110-150	TKAKTEKKEKESKKAKPAVKSAPVGAPKVSKQQMKGGKGGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9W5	60s ribosomal protein l24	0.821	59-77	HKKGITEEVAKKRSRRTVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD22	General transcription and DNA repair factor IIH	0.991	30-51	GRGKGKGKATEKRKKGESKKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSB0	Uncharacterized protein	0.625	32-34	RKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWD7	Ribonucloprotein	0.989	53-90	LAQKKLVKKLHKTIKKASKARQVKRGVKEVVKGIRKGE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWD7	Ribonucloprotein	0.75	149-156	KKKVKRKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKU1	Uncharacterized protein (Fragment)	0.93	75-86	KKEKKKDKRAKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNT8	Uncharacterized protein (Fragment)	0.657	256-260	RRRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQ29	Uncharacterized protein	0.649	294-304	RKEKENILRKW
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X033	Protein phosphatase methylesterase 1	0.835	53-59	RKRKPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0K3	Uncharacterized protein	0.896	334-345	KISKRRRKEKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE30	Pre-mrna-splicing factor cwc21	0.998	152-340	KLKRMAEREERERRREEDRARMQEQKAKWEAERRERDRLRRRQEDRMRQERAENVNRRDRDMPPPPVPAARGGPRDDRASYRSRRPSSRSKSPPPRRHRDSPPPRERSPPPSRSRRDDSRSPSASRSPPPDRRRRRSVSPPRRDRSPPYRQHDSTPPRRGRSASRSVSPRRRSPSPDRRRGSPQPKRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XI55	Glycoside hydrolase family 61 protein	0.858	342-367	RRVSRKRSAPTSPKALRAHNRSKFRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ33	MRC1 domain-containing protein	0.989	304-339	ATKGKGKGAKPIKTKKPTASERKEADKERARMKAEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ33	MRC1 domain-containing protein	0.843	1078-1087	KKKEKRERKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ33	MRC1 domain-containing protein	0.792	518-528	AEEARTRKKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ33	MRC1 domain-containing protein	0.789	1037-1046	PRRRRLMKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ33	MRC1 domain-containing protein	0.706	481-502	KKVLPPPKRAVVIPLAKKSTKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ33	MRC1 domain-containing protein	0.64	1197-1201	RIRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNX0	Ectomycorrhiza-regulated protein	0.72	254-261	ARRSRKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XY23	Atp-dependent rna helicase dbp9	0.996	595-630	KDSGRSRGRGRGGKNSRGGGRDRGRKKADPLRKFGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XY23	Atp-dependent rna helicase dbp9	0.986	366-390	RKRKRAEASSASDSKSRKRKHKKGG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YVV4	Uncharacterized protein	0.605	186-186	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNU5	Condensin complex subunit 1	1	503-523	REKRKKKRPKKKKQAKLKPRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNU5	Condensin complex subunit 1	0.99	1280-1302	RVQEKKAARQKRAKRNAKRKVAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNU5	Condensin complex subunit 1	0.953	143-164	APKRRGRGGKAGGSGRGTGRST
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5Q9	Uncharacterized protein	0.914	172-185	PSPRRKAKAKARLS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5Q9	Uncharacterized protein	0.794	321-332	AARPTERKKPKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5Q9	Uncharacterized protein	0.708	300-313	KKSKSSKSRESRER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKG4	Uncharacterized protein	0.929	110-147	PPTPPAIPKGLKKFKSMGMLKQKRPRVESSFKPPKKSH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKG4	Uncharacterized protein	0.649	344-351	AKKVIKGG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKG4	Uncharacterized protein	0.605	289-290	RR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPZ7	Ribosome biogenesis protein nop6	0.958	494-513	RGWKKRWREAVKVKRRRGGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPZ7	Ribosome biogenesis protein nop6	0.945	164-185	KTARPVKEKKRVKAPDTRARRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRM0	Exp1-like protein	0.882	446-468	RAAQRKAGKSRKSNIKDPNAPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ88	ATP-dependent DNA helicase II subunit 2	0.666	652-659	VKEIKRAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ88	ATP-dependent DNA helicase II subunit 2	0.604	479-479	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ88	ATP-dependent DNA helicase II subunit 2	0.602	649-649	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZD3	Ace1 transcription factor	0.786	208-216	RKRARSRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YNU7	alpha-1,2-Mannosidase	0.874	7-21	RKRKKDQKGQKEKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WD73	Uncharacterized protein	0.998	302-325	RKPRATKGKSKARRKVRGRGKPKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WD73	Uncharacterized protein	0.951	74-87	RGSKHPRRGGRRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WD73	Uncharacterized protein	0.942	955-990	MRRERERERERERDKRERDRDFHREIERERERERER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WD73	Uncharacterized protein	0.772	549-559	RKKRRLERDRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WD73	Uncharacterized protein	0.607	861-863	RER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WD73	Uncharacterized protein	0.603	865-865	R
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYV3	C2H2-type domain-containing protein	0.705	391-399	RVGKRPPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X120	Uncharacterized protein	0.996	179-202	PERRAKEAQRRKAKKQRQKERRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X127	Dead box rna helicase	0.997	697-713	EAKEKRKEKKRKRKERE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X127	Dead box rna helicase	0.968	6-24	PPKKSKRPQKPLKSAKAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X127	Dead box rna helicase	0.685	505-512	KQKQKKNA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X213	Elongator complex protein 1	0.967	1174-1193	SKKSSRSKRKAERKVGSGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGB4	Uncharacterized protein	0.777	182-192	KGSKKELKKKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMI4	Rnase p protein subunit	0.993	47-106	LRRRAASHDPRRVPLRLRAKARAEMDPVKKKALGRKLPKLGKAKQIARSEILLKRQRNKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMI4	Rnase p protein subunit	0.71	403-411	KLKRPRFKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMI4	Rnase p protein subunit	0.625	232-237	KWNRGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUC8	Ribonuclease h	0.851	46-54	KRKQKKMKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW64	Uncharacterized protein	0.877	107-137	KRQSKANKKRKCAENKWSSREYKPPPGTKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZG1	Cation transporter	0.838	115-121	KRRRKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZG1	Cation transporter	0.702	508-519	VKSRWRSSRKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZG1	Cation transporter	0.608	239-240	KG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZG1	Cation transporter	0.602	694-694	R
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y954	Uncharacterized protein	0.943	1406-1419	RAKNLRGKKGRKKY
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YJ51	Uncharacterized protein	0.974	420-457	KDRKGRPTKMTIEDGERREREDRKKQDKKRPWPLRRDR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YN33	Uncharacterized protein	0.95	338-366	REKRGRRNGNGRASRGSERKGVDRSRPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YVS0	Uncharacterized protein	0.704	41-52	KKKANLKEKAKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W5W4	Uncharacterized protein	0.943	130-155	KGRSKRAGSRITDYPRKRPRRSGKTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPX6	Reverse transcriptase	0.787	251-257	KKKKGKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUR0	Uncharacterized protein	0.717	774-778	RKRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWI2	Zz-type zinc finger-containing protein 3-like	0.712	247-255	KSKPKPRTR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWI2	Zz-type zinc finger-containing protein 3-like	0.663	157-164	KIRELKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X673	3-carboxymuconate cyclase	0.699	27-42	GRGQKQGRPRLSGNRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7M3	Cnn_1N domain-containing protein	0.693	133-139	RPKHRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7M3	Cnn_1N domain-containing protein	0.6	233-233	R
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGE3	Protein rmd11	0.976	525-545	RSTRAKARAEKRAKPRQGRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHP9	Serine c-palmitoyltransferase	0.827	260-267	ERKKKRGP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN88	Cdf-like metal transporter	0.858	67-79	KEGRSRRRARGLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQY8	Cyclin binding protein	0.84	124-131	GREKKKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQY8	Cyclin binding protein	0.646	400-403	KKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYQ5	Dil and ankyrin domain containing protein	0.996	222-255	KPRRHTSKRIRMEERQERRKRGEEKMKRKRGREG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYQ5	Dil and ankyrin domain containing protein	0.854	871-884	SGGLKWRKRNRKVR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYQ5	Dil and ankyrin domain containing protein	0.601	859-860	KR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YTB7	Camk camkl gin4 protein kinase	0.846	555-588	RKSSIRKAQRDVKAGRRHVQILIPPQRKRSKLKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YTB7	Camk camkl gin4 protein kinase	0.652	376-379	HRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPG9	Uncharacterized protein	0.682	46-50	KKKNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRV4	CCHC-type domain-containing protein	0.61	227-228	KP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7L1	Ubiquitin ligase scf complex subunit cullin	0.77	6-16	RKKTKIKPPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA33	PACT_coil_coil domain-containing protein	0.656	1909-1912	KRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAS5	Rad26-like snf2 family dna-dependent atpase	0.99	39-68	KPKKQRELRTRKSKSTGARSSEGRKRRRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAS5	Rad26-like snf2 family dna-dependent atpase	0.987	971-1016	KVRRKKAARRSERSSSKPVKARVKTEEIPPAPQWPPIRKHHKLKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDA5	Snurportin-1	0.989	109-119	KKKKKGKRKKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF53	Phosphatidylinositol 3-kinase VPS34	0.82	515-533	KRAKELRTSKDPRPKKIEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGK0	Uncharacterized protein	0.657	397-402	RPNKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ89	Carbohydrate-binding module family 48 protein	0.705	370-377	PKKGKHQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRY4	Protein fra10ac1	0.939	208-247	EKSRHERWDRDRDNLVKERRRERHRSLSPRDSRRHVHSRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YX30	Uncharacterized protein	0.901	170-184	KKKQRRTLARKGKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YX30	Uncharacterized protein	0.855	393-404	SAPARAPPRKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZJ9	Snf2 family dna-dependent atpase	0.748	829-840	KSAKKRSNPKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W5G1	Uncharacterized protein	0.981	321-337	LRRKSKHKRSKSRSRPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W5G1	Uncharacterized protein	0.708	194-208	HSRTREGERGRSRQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WLU5	Uncharacterized protein	0.936	162-186	SKENHKEKIKASRRGYQAWKKKAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WLU5	Uncharacterized protein	0.749	214-222	RSKKSRKHK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRM2	Uncharacterized protein	0.61	218-219	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X044	Uncharacterized protein	0.901	440-453	ERRERRERRRSRSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6U9	And fes cip4 domain-containing protein	0.868	792-806	RKKRESERKIPIRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBM2	Meiosis specific protein hop1	0.918	675-691	TRGKAKGRGKSKAVQRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD89	Uncharacterized protein	0.742	85-91	RRRRKSA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKF9	Uncharacterized protein	0.723	233-240	RVRPKRSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMD6	Asteroid-like protein 1	0.731	792-799	KKRKVKTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMF5	Dbf4-dependent protein kinase hsk1	0.733	690-703	KKREDRMKSGRRSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSQ5	Uncharacterized protein	0.993	139-193	RTGRTKTGRPTDASKAGIRLAPEKDSKGRVKTKKRVQLPRRRPRISLQKTRKWNR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSQ5	Uncharacterized protein	0.606	76-77	RK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y0N4	Traf interacting	0.83	221-238	EKQIKLLKKKLKALSKSH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y982	Uncharacterized protein (Fragment)	0.958	212-231	QDRSHKGYRLKRKAKREGRQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WA44	Uncharacterized protein	0.916	684-701	KKGIGAGTAKRKKSVKKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WA44	Uncharacterized protein	0.721	505-513	RGRKQRKPL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WA44	Uncharacterized protein	0.66	592-596	LRKKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WA44	Uncharacterized protein	0.65	1200-1204	KKEKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJA6	Sh3 domain-containing protein	0.841	333-345	RRTAPPRKRAKSP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJA6	Sh3 domain-containing protein	0.828	106-125	PAPAAPPKPTGEKPKWKPPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJA6	Sh3 domain-containing protein	0.629	36-39	RPKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1Y8	CCHC-type domain-containing protein	0.613	283-284	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBJ5	Transcription factor	0.935	48-60	RKPRDGPKKKKAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBR2	Uncharacterized protein	0.791	177-190	KSRKRLKNEKHHHR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGS3	Uncharacterized protein	0.997	499-537	KKKAVKEIKKERKRKSEGNSDGKKNLKKAKSGKAKAKAD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGS3	Uncharacterized protein	0.817	365-382	KHANRASGKLKVRVRKRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPF1	Flap structure-specific endonuclease	0.983	443-465	GTRGRGAKRGRNGRGGSRGRGRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT75	Uncharacterized protein	0.997	108-124	VPKAPAKKKRKPKAKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT75	Uncharacterized protein	0.992	163-190	RKPSKSKAPPKGKGGKSGPSKGKGINAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT75	Uncharacterized protein	0.912	82-95	KPGKRKIVKPKRFR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT75	Uncharacterized protein	0.851	246-258	LKKRKLPPIKKNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT75	Uncharacterized protein	0.648	198-201	KKPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0F6	Duf788 domain-containing protein	0.83	163-185	RQEKLRKRNERGDPRVQAQVRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMK9	Uncharacterized protein (Fragment)	0.622	177-181	KKTPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSN7	Reverse transcriptase-rnase h-integrase	0.781	123-136	RKKRELIKPKITRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZF7	Zinc carboxypeptidase	0.982	171-194	KKHDGEKPGPKPPKRDKPGKEREL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X092	Uncharacterized protein	0.863	208-219	KPLPTSKRKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5S8	Ribosome biogenesis protein RLP24	0.883	100-126	KEKREHAFWKNRMAASREKQRAHRKRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5S8	Ribosome biogenesis protein RLP24	0.868	41-59	KMKRNPRKVRWTKAFRKAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8A6	Uncharacterized protein	0.651	128-131	KKKQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8S1	Non-specific serine/threonine protein kinase	0.78	690-702	KGERPKRPSRMKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD75	Vacuolar sorting-associated protein	0.998	442-524	ESRRERDKDRNRDRERSERHKDGDREREPRERDREHRERGDREHRDRDRSDRDRDRDRDRDRDRERSDRHKKHKKRKSPSSRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDJ8	Mmr1 hsr1 gtp binding protein	0.967	4-42	RKPMSTRQKKEEIKLKRAIKRGDVDPPPPKPQQHRRKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNI0	RNA-dependent RNA polymerase	0.809	630-637	SRRRGRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNI0	RNA-dependent RNA polymerase	0.798	1242-1252	RRREARRRNRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNW2	Reverse transcriptase domain-containing protein	0.615	131-133	KKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XR00	Uncharacterized protein	0.698	257-263	RRRRHER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKJ5	Glutamate carboxypeptidase	0.997	696-721	ELRKIIKKWKKKHDRRRKLWRKLWKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YST1	Mif4g ma4 domain-containing protein	0.965	31-57	KRHSSRKQQLSRKEARKQERAGRKQKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTB7	Uncharacterized protein	0.997	233-270	KQNKEDKKKAAQKAKKKQGGPAPHKASATAKRKSTTKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTB7	Uncharacterized protein	0.698	195-202	GRKQKRPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WU54	Uncharacterized protein	0.95	341-357	PRRKKAVRAPHRKSGKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WVM5	Wd repeat-containing protein 75	0.941	23-46	GKQKRGKGKVKENTGSQKRRAGKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X201	Cysteine desulfurase	0.736	446-452	RRPRKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDH3	26S proteasome regulatory subunit RPN1	0.895	17-46	KKKKQKESDKEEGSSKGLKDGKKDGKDEKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDH3	26S proteasome regulatory subunit RPN1	0.691	683-692	KKDEKKDEKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDQ7	Uncharacterized protein	0.706	364-373	KPKPKAQVKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEV6	Velvet domain-containing protein	0.671	56-66	KKAKVAARIKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHE2	Udp-n-acetylglucosamine transporter	0.89	396-409	KKPNGKQKRKEKGE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNM8	Uncharacterized protein	0.991	185-209	NKRKGKRPAATEKGGPAKRRKENKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQJ6	Endopolyphosphatase	0.967	66-75	RKKPKKKKNR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQJ6	Endopolyphosphatase	0.809	389-399	KRKGGRKPGHH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y0S8	Uncharacterized protein	0.79	85-93	RENRKRRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0I9	Rna polymerase iii subunit rpc34	0.98	357-366	KRKKRKSKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0I9	Rna polymerase iii subunit rpc34	0.974	269-296	RRSKKKRKHRQSHPDPDDGSSKRNSKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0I9	Rna polymerase iii subunit rpc34	0.88	332-342	RSRTKKSKKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0I9	Rna polymerase iii subunit rpc34	0.779	313-321	KKSKRRKTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZI3	Membrane protein	0.765	723-730	RHHRRRRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XH14	Suppressor-like protein	0.705	747-754	RKERGKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XH14	Suppressor-like protein	0.632	160-163	RRRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XK86	Chitin synthase	0.939	945-960	RSRLRKLRREERRRRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XK86	Chitin synthase	0.66	413-419	KLSKKPS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKR7	WD_REPEATS_REGION domain-containing protein	0.688	1061-1066	ARRRPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMN3	Uncharacterized protein	0.822	206-213	RPKGKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNI6	Uncharacterized protein	0.836	268-281	ESRQKGKSARKKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ67	Uncharacterized protein	0.993	154-176	GRSRKRRRTRRSRSRSDSRRRSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ67	Uncharacterized protein	0.986	76-111	RRSGVANKILENREKERETKAESKGKGKEVKKKRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y3W5	Chromatin elongation factor SPT5	0.99	60-72	GKKKKRTKRRHKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y3W5	Chromatin elongation factor SPT5	0.654	318-321	KRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YYB5	RNA cytidine acetyltransferase	0.983	1076-1092	GGEGKKGTRRGGKKVKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YYB5	RNA cytidine acetyltransferase	0.907	68-82	RKKREAKMKRDVKRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WHY1	Uncharacterized protein	0.789	491-498	KVKRRRKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WHY1	Uncharacterized protein	0.723	784-790	RPKPRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WHY1	Uncharacterized protein	0.683	519-526	KKAGGRKQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRW6	Retrotrans_gag domain-containing protein	0.711	227-236	RKKREPIKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WW03	Uncharacterized protein	0.759	75-87	RRGRRGRWYATRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X025	Uncharacterized protein	0.972	384-396	KKPRPRKLRKPKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8D0	Uncharacterized protein	0.979	17-40	RARIRKVQARRTKNAKKNKRNKGW
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF09	Aconitate hydratase	0.96	117-131	KKKRRKGYQKTKKHK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSD0	Dipeptidyl-peptidase 5	0.68	510-518	KGWKKDEKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT15	Duf1682 family protein	0.965	311-365	KAKEEREQAKEDQKAAKRKAEEERIAKLPAAEQQKILEREKKRSIRKQQGRTIRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUD2	Uncharacterized protein	0.648	20-24	GKSKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXD8	Transcription factor	0.966	490-512	RGSKRKRDKDRMDPRKSRRPELP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y7Y8	Mitochondrial gtpase	0.93	400-412	EEKAKRKLKHLRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YDE6	Uncharacterized protein	0.871	322-331	GSAKQRKGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YDE6	Uncharacterized protein	0.716	47-55	KEKARSRPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YPH8	Transformer-2-beta isoform 3	0.957	213-249	RDSRDWRERRSPAPRRGHSPEYRRRRSYSRSPPRGSS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YPH8	Transformer-2-beta isoform 3	0.931	35-72	PPPPRGRSRSRSAPRENGYRSPYRRRSPPPAATPRRPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WL40	Uncharacterized protein	0.731	160-166	EKKKKFE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WL40	Uncharacterized protein	0.691	511-516	KKEKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3G6	Uncharacterized protein	0.616	124-127	RVKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCH4	Uncharacterized protein	0.989	8-49	RKKPPSFHHFPAARAKVLKKAWVEKAKIKSKWKAEKRKMGLA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCH4	Uncharacterized protein	0.935	145-161	RRKKGDATRKKGGGKGQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXB2	CCHC-type domain-containing protein	0.681	79-87	EKKREELKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YSD2	Actin-bundling protein	0.976	12-34	KPRSSKLKFKGDKSSHKSKKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWM7	Golgi apparatus membrane protein TVP38	0.638	296-305	KEWKARLPSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WLH9	C6 transcription	0.615	15-20	KRVIRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WM13	Aspartyl-tRNA synthetase	0.937	23-41	ELKKRAKEAEKAKKAAEKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WVM0	HMG (High mobility group) box domain-containing protein	0.648	156-160	RRKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X585	WD_REPEATS_REGION domain-containing protein	0.813	6-17	KPKKNRNKPAKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X585	WD_REPEATS_REGION domain-containing protein	0.779	104-109	KKKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5W6	Glycylpeptide N-tetradecanoyltransferase	0.983	44-54	SKKKKKKKSKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA84	Kinesin-like protein	0.998	612-633	QPSPKRPKKTKAKKKGKKDKDR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA84	Kinesin-like protein	0.915	469-501	ERERERPKEEEERRAVEHRRSTRSRSKSHSPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLF8	G-patch domain protein	0.959	336-367	RRDRDRERRRERSISPRRDSRAPSRRGSPDRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLF8	G-patch domain protein	0.785	411-429	RDRRRTRDRDDRDRRRDRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLF8	G-patch domain protein	0.732	309-317	KGSKRPEKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLF8	G-patch domain protein	0.623	120-123	AKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLQ5	Uncharacterized protein	0.999	176-233	RQRHRRSSGRHRHSRSRSDERDKDRHRHERRSSHKRPRSRERHSGSSRRHHKRHRTRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLQ5	Uncharacterized protein	0.98	249-275	ASRKHRKQDEERSSRRKSRRSRSRSLS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLQ5	Uncharacterized protein	0.912	100-131	KRERRENEIRERKARAEEAVAAEKRRRSNRRY
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLQ5	Uncharacterized protein	0.722	143-151	RTSDRKRKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRA0	Conserved eukaryotic protein	0.948	37-77	DKARGKRNKKIKLDPRSLVSSEKELINAKGKAKAKAGDIPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRA0	Conserved eukaryotic protein	0.81	178-190	RNKGKGKGKELRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTF4	Pseudouridine synthase	0.987	259-288	KGKGERGGRGRGGRGGRGGGRGGSGREDHR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTF4	Pseudouridine synthase	0.667	666-673	RKKQSRKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUN6	Uncharacterized protein	0.966	203-241	GEKKRLREEKEFLEKKREEERRKWEDSERRRRVRDKEAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUN6	Uncharacterized protein	0.634	178-180	KRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWL8	Uncharacterized protein	0.986	186-200	GSKKSKKKKEKKDRW
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWL8	Uncharacterized protein	0.953	215-224	RKKAKKKKSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YAR4	ATP-dependent DNA helicase	0.937	159-173	PGKSPAKKKDKGKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YAR4	ATP-dependent DNA helicase	0.923	927-957	PKALKVPPIIKAGSSSKGSAPRKPKALNKKY
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJD1	C2H2-type domain-containing protein	0.858	235-243	FKRRRKRAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYH1	Uncharacterized protein	0.684	55-59	KRRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0J0	Uncharacterized protein	0.998	645-665	KRGSGKKAKKRRMKKREEEKN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0J0	Uncharacterized protein	0.881	53-63	HGRKKEKKEKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0J0	Uncharacterized protein	0.869	724-734	KKKEDKKKKNR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X411	Nuclear receptor corepressor 2-like	0.993	207-286	RSPRRSLSRGRSYSRSRSPPFRRRSMSRSRSRSRSHSRSRILRRSRSHSRSRTYSRSPSLSRSGSRSRSRSRSRSRSHSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X411	Nuclear receptor corepressor 2-like	0.969	919-932	GRKGKRRTGKRKGN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X411	Nuclear receptor corepressor 2-like	0.899	1035-1047	RPAKRAKRSRKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X411	Nuclear receptor corepressor 2-like	0.603	1002-1003	RR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4G5	Uncharacterized protein	0.769	28-36	PPKKGHRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4G5	Uncharacterized protein	0.64	177-185	AKEPARTRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X918	Uncharacterized protein	0.819	248-254	RRRRKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAJ5	Uncharacterized protein	0.886	110-127	SLRKHKEKTKAKLSKYKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XES8	Uncharacterized protein	0.999	898-915	KGKDKKRRKRREKERRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XES8	Uncharacterized protein	0.989	376-404	LKRKNKEKEKEKEGQRRPNKKSRPHAFPI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XES8	Uncharacterized protein	0.902	650-682	RKRREQRKRTASPPPSAENVPVRPGQARKKKAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XH21	Uncharacterized protein	0.859	40-50	KRVRRKTRRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQQ7	Uncharacterized protein	0.601	19-19	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW39	Reverse transcriptase-rnase h-integrase	0.71	274-288	KDEKKQEEPKKLSKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWG8	Uncharacterized protein	0.854	10-17	PKKKEKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWJ1	DUF4477 domain-containing protein	0.849	260-267	ARPKKKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YIF3	Multiple RNA-binding domain-containing protein 1	0.966	107-127	AAKSELKKARKDKKEDGKKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YIF3	Multiple RNA-binding domain-containing protein 1	0.826	326-340	KKRTVKEEKAAKRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YIF3	Multiple RNA-binding domain-containing protein 1	0.703	90-97	PRPNKRPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YTF9	Pre-mrna splicing factor	0.935	59-83	APKDIEKKKKKASDRQDPSEKQARR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WM91	Reverse transcriptase-rnase h-integrase	0.647	22-25	PRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNG9	Atp-dependent dna helicase	0.786	132-141	KKTKKASKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPR8	CCHC-type domain-containing protein	0.97	229-245	RKKREPIKPKIARKEKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X007	UvrD-like helicase ATP-binding domain-containing protein	0.8	1830-1840	QKAKNKKKFAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHV4	Uncharacterized protein	0.832	663-671	PKQKRRRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNB8	Gtpase binding protein rid1	0.864	44-65	VAKPGLIGAKGFPEKRKRDIKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT73	Smad nuclear interacting protein 1	0.97	73-116	ERERRRDRDRYDRQRDRDRRSASPRSSRRPRSTSRSKSPVNKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVM3	Uncharacterized protein	0.905	648-663	RELEKGRDGRRKSTRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVM3	Uncharacterized protein	0.84	12-20	SKKNKKKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVM3	Uncharacterized protein	0.753	491-505	PSRIPRGSRSVKKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWI2	Uncharacterized protein	0.96	323-339	KKKREVRSRKRAKTVKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWI2	Uncharacterized protein	0.89	177-208	PPKPPRSLEPKAVSPPPLKPPRTPHKQRVGKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWI2	Uncharacterized protein	0.843	48-57	RPRRRRPKVP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWI2	Uncharacterized protein	0.651	297-304	RPTRRTKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y0S6	Tnfr ngfr cysteine-rich region family protein	0.927	682-701	RRRMRRKRAAATKQFARAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y234	Uncharacterized protein	0.615	98-100	KKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y9M7	Uncharacterized protein	0.929	856-868	RRGGKKGKGRHRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YQT6	Pro1 protein	0.757	8-21	KVKKSGAPKAKGAV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W6K2	Uncharacterized protein	0.995	16-47	PRIRRGQRKKRPRIPWEQRKKADKAAKDERAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W6K2	Uncharacterized protein	0.931	151-165	DRRRKARRPNARSRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W6K2	Uncharacterized protein	0.867	391-416	RRVRNDKNVARGPRGGKSKSATTGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W6K2	Uncharacterized protein	0.839	547-564	AKNTKQRKAGVSKRGRGG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJQ6	Uncharacterized protein (Fragment)	0.671	130-135	AKKREK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WS79	Uncharacterized protein	0.976	23-47	AKPRKSGGKKKPNDSEEKPKIGRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WVJ4	Uncharacterized protein	0.792	24-46	EEKKAERAEKEHQKAEEKERKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYG7	Phosphatidylinositol 4-kinase	0.838	62-70	KVKRKKKAT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7P2	Rsc complex subunit sfh1	0.74	523-532	AGGIGRSRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7P2	Rsc complex subunit sfh1	0.732	506-518	ERAARRLRRETSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE25	Nucleolar protein	0.985	105-119	KDSEKRMKRRKRKRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE25	Nucleolar protein	0.869	81-93	STKKKKKSSSENK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE25	Nucleolar protein	0.86	136-145	PPKKKKSKNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE25	Nucleolar protein	0.745	34-41	KKSKKGKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE25	Nucleolar protein	0.685	12-17	KGKKRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEZ6	Uncharacterized protein	0.999	131-150	KPKPSKKRKRLKSPKKKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEZ6	Uncharacterized protein	0.678	60-66	RPTRKRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS21	Atp-dependent rna helicase dbp7	0.961	711-733	KISGKSRENTRGKPQRKPKKNPG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS21	Atp-dependent rna helicase dbp7	0.812	29-45	DRLKTKRIVKRKTAWTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTT9	Nuclear prelamin a recognition factor-like	0.629	439-442	RRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVM7	Pseudouridylate synthase	0.997	66-105	KEKGKGKAKGREKMKRDARKRQEERPPRDPDEPREPRLPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXX4	C2h2 finger and ankyrin domain	0.992	555-580	EKKKARRKGLRDRVKERELKEREKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXX4	C2h2 finger and ankyrin domain	0.795	222-231	SKKKLKAPRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y9R0	Uncharacterized protein	0.981	175-216	GKKAKRKARERQLEEARRLAVLQKKRELKAAGIIMRHKTKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y9R0	Uncharacterized protein	0.95	258-280	NKRKPEEEEAERKKRQRKNASGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJP6	Uncharacterized protein (Fragment)	0.994	134-151	GKKNNKKKSNKKGKGKKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WVC8	Aminoacylase 1-like protein 2	0.765	19-26	KRKKHSRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X797	Major facilitator superfamily	0.671	505-511	AKRRAQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAD4	Uncharacterized protein	0.992	218-251	RGRGRGRGRGRGVAKRRGVPRAPYGRSGKELGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEW5	Nuclear export factor	0.707	67-83	LKRKLNESPQANKKAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHD4	Ell-associated factor 1	0.989	203-281	PPKAPVRSRPQPAPASKSAAPASVQPSKKGRRPEPSGGEETRNPPSKRSRPSPPPQPQPPAPVRTRRPPPKKPSPPPPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLJ9	Uncharacterized protein	0.966	83-115	EKQRLKEKKEKEKEKDDKAKDDKTKDDKKDDKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XR49	Transcription initiation factor TFIID subunit 2	0.927	1843-1868	KAGGGKKRKDGADKSNPQPSKKAKLA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XR49	Transcription initiation factor TFIID subunit 2	0.856	1225-1236	KGSKPKGRPPKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XR49	Transcription initiation factor TFIID subunit 2	0.683	1150-1162	KPPKPLKSGGPPA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y5F4	Other camkk elm protein kinase	0.998	554-586	RRVKSDRDAEAERERRDKKERERERRRRKKMAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y5F4	Other camkk elm protein kinase	0.886	725-742	GRERSRFKGKQKSKDKGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y5F4	Other camkk elm protein kinase	0.856	516-529	EKKDKGNKSKPKIK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YYQ1	Zn(2)-C6 fungal-type domain-containing protein	0.958	76-93	RKERRKGVKRGPYRKRDA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNB3	Uncharacterized protein	0.984	172-202	AKPKKGSGRKASSSSRQAKKRRMGAGGRTLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTG7	ATP-dependent DNA helicase	0.993	725-754	RRAAKKAGKSKEKEKAPKAASSRKGGASTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTG7	ATP-dependent DNA helicase	0.83	835-844	RRRPPRKRQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X243	Uncharacterized protein (Fragment)	0.905	37-72	EKLKKEPNSEEEASGPPRKKTRLNVPRPKPEASGKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4F7	Ph domain-containing protein	0.82	122-133	KKGERRKTWKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9Z2	Px domain-containing protein	0.868	1041-1050	PPGKKRKAKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAZ8	Nmda receptor-regulated protein 1	0.976	604-619	EKKAKKKAKKAAQKVQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJH1	Chromatin assembly factor subunit	0.952	261-286	KSKASRPKKPESIEKIAKAKKEKDAQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJH1	Chromatin assembly factor subunit	0.758	555-568	RKAEEDKKTSKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ82	Mitochondrial chaperone bcs1	0.904	499-513	RRERKEREEAKRRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRP9	Calcium channel	0.977	298-315	KPGTHKKNARADKKRRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W4G2	Retrotrans_gag domain-containing protein	0.858	229-243	RKKREPIKLKIARKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WX93	Eukaryotic translation initiation factor 2 subunit alpha	0.64	140-145	KRSRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X168	RING-type domain-containing protein	0.74	115-120	QKKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2F9	Uncharacterized protein	0.976	464-507	ERARMEKERERQKAKEKQGAADNGGAKGGANSRGGRGKGGRKGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8S3	Gtpase activating protein	0.861	833-843	KRKKKFGIWRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMB6	Abc transporter related protein	0.787	4-13	RRRTRRPPRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTP0	Protein kinase	0.854	927-971	PPRKRRASVLMKRQKSEKTPSPSTPPSPSPLPRRSLGGLWKKLRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XY44	Myb domain protein 4r1	0.988	479-496	KGKGKARPKPRPVPKRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XY44	Myb domain protein 4r1	0.919	516-529	KPRPKPKSIPKRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XY44	Myb domain protein 4r1	0.723	580-587	RKRGRPRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYG0	Ribonuclease p complex subunit	0.994	281-294	TGEKKKKKRKKDKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y8K8	Ste ste7 mek1 protein kinase	0.995	368-390	PSRKKNKPKDAEKAKKDKRKSKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y8T2	Retrovirus-related pol polyprotein	0.999	237-258	GGRAGKKNKKKKGKGSKGKKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y9F5	Wd40 repeat-containing nuclear protein	0.874	894-912	GGKGKGKGGKVKFGEEKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YX40	Pre-mrna polyadenylation factor fip1	0.969	569-619	ERDPRDPRADRDRDRDRREKTRTPSREPDDRASRKRRSSPGLDDGRSSKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0T6	Serine threonine-protein	0.768	144-151	PKFKKKPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUC8	Serine threonine protein kinase	0.972	592-614	KKQAKLLKKLHDREKSKGKGKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUC8	Serine threonine protein kinase	0.638	152-159	SKINARRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBU7	Spt3 dosage dependent suppressor of ty-induced promoter mutations-like protein	0.988	814-839	KVKKNGRRSSNAKARPLRKRLSKKRV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBU7	Spt3 dosage dependent suppressor of ty-induced promoter mutations-like protein	0.937	292-313	SKRKKDPNAPALERKRKDRAKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS04	Other wee protein kinase	0.872	296-307	HREKKGKAPRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUW7	Acyltransferase domain protein	0.853	484-507	EKGRARGLWESKAKYFSIRRRRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYJ9	Uncharacterized protein	0.707	4-17	RDKLKANSKSRRFK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WN69	Uncharacterized protein	0.945	143-156	RRRDGHEKRRRRKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WN69	Uncharacterized protein	0.711	67-72	KRKRGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WP02	40S ribosomal protein S30	0.97	23-38	AQEKKKTPKGRAKKRI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WU80	Uncharacterized protein	0.889	458-474	LRKEKERAARPKGGGGP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WVB0	Uncharacterized protein	0.702	63-68	ARRRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WX48	F-box domain-containing protein	0.614	13-14	RK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXT1	Fad binding domain containing protein	0.727	438-451	RRYRGKARLEKLRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X021	Serine/threonine-protein kinase RIO1	0.999	568-615	RKPRGHRHEDREAKKERKRAVKAEAKEKRKNKMPKAEKKKLMKKSRGG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1R3	Rna annealing factor	0.987	174-196	APTRGGRPRRGRVGGKRKSPRPQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1R3	Rna annealing factor	0.74	12-23	KPKGIRRASGRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4W9	Uncharacterized protein	0.65	4-7	KRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8D7	Uncharacterized protein	0.988	17-41	RARIRKVRARRTKFAKKNKRNKEWK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUY6	DNA polymerase kappa	0.915	639-651	KDPGKGKPRSKGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUY6	DNA polymerase kappa	0.636	470-473	KKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV26	DNA-directed RNA polymerase	0.769	1028-1041	KAKKNAKAQGKGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYP0	Zinc finger protein pegasus	0.774	91-105	RRRKHGFVPKLRKTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTB2	Chromosome segregation protein	0.975	726-744	PSPKKSKKKAKKTVVHEKD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTB2	Chromosome segregation protein	0.82	347-362	APKRKASSTRPRAKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTB2	Chromosome segregation protein	0.778	15-23	KPKRKKGSS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTB2	Chromosome segregation protein	0.733	258-268	PRRPRNAKGAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTB2	Chromosome segregation protein	0.691	493-504	RKKVGGGHKRTA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9E3	Carboxylic ester hydrolase (Fragment)	0.771	424-442	RRKPEPKEHSNKINKPRPT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJI3	Uncharacterized protein	0.815	206-220	KVRRRRSSRERDRDH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKD6	Yml020w-like protein	0.972	61-82	SEPEKKIKKEKSKEHKEIKKGA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKD6	Yml020w-like protein	0.89	21-52	KPKNKDIERLKKSEEGKGGGRGNRPASVRSAP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKD6	Yml020w-like protein	0.858	102-114	KDKEKGKKKSPAP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRE2	Uncharacterized protein	0.684	283-289	KPKTKKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRE2	Uncharacterized protein	0.679	911-916	KEKRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT52	Nucleolar complex-associated protein 3	0.986	11-40	ASRKKQKRNHKPQPNPKLQKSKGKGKEKAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT52	Nucleolar complex-associated protein 3	0.983	479-503	GSKGKKGKGKGREEHLSKKAVKALK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTI4	DNA topoisomerase I	0.99	138-235	KKATKKPPRKKVKNEDPDEAPSKPARKRKVKIESDAEPSEDDKPISKKAAKKAPVKKAKKEDVSDSETPKTKKRAPKAKKEQEEEVASSPTKGKGKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTI4	DNA topoisomerase I	0.756	359-374	AKKKAMSAAEKKEVKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZY7	Oxysterol binding protein	0.799	711-722	DRRKRGAEPKPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZY7	Oxysterol binding protein	0.719	41-46	KKRRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y0R0	Gyf domain protein	0.91	789-805	RIGRAERRAARRRAREA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1J7	Uncharacterized protein	0.942	184-201	RGKEKEKKPRNVLRRKPS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA57	Nucleolar protein 14	0.969	880-895	SMEREKTKEKRRAGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA57	Nucleolar protein 14	0.966	25-52	SKKRKRAAPTEKDKEKRAAKLDEIQRKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA57	Nucleolar protein 14	0.899	58-91	KVTKLKHDVGGRKLKGVTGKPAKSKMAGIEQRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA57	Nucleolar protein 14	0.867	321-329	KAERKRKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA57	Nucleolar protein 14	0.784	828-841	KKERKGAIRELRKD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBG9	Uncharacterized protein	0.993	55-82	KKHKSDKPEIKKGKTKKDEKGKHHKSRD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XC71	Uncharacterized protein	0.927	146-159	KKKPAKKNPKSKHP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XH71	Uncharacterized protein	0.901	99-116	PAPPRASKHRVRRPPRGH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XH71	Uncharacterized protein	0.671	409-413	PPRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTP6	Histone-lysine n-methyltransferase set9	0.995	649-714	SKRKRQSEEAEPEEKPPKKAKIAEHPTPKLAKGKASRTQAEAEPDPPKRKRGRPRLTSPRAQKKPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTP6	Histone-lysine n-methyltransferase set9	0.709	743-751	FEKKPGKPS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTP6	Histone-lysine n-methyltransferase set9	0.638	775-782	EREKQKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYF2	Membrane glycoprotein spo14	0.928	209-221	IKGNKKEKGKKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y084	Rsc complex subunit	0.993	1200-1233	PEAGPSGRGRKKKGRPPKNPVEESPIVVGKRKRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y084	Rsc complex subunit	0.73	1173-1183	RERKERRATNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y084	Rsc complex subunit	0.616	381-382	KR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y9S8	Uncharacterized protein	0.74	83-90	KKQKKKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YSK9	Bub protein kinase	0.663	141-153	IKRQARPTERLKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WM67	Uncharacterized protein (Fragment)	0.665	167-174	EKKTPKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQP5	BHLH domain-containing protein	0.88	416-431	KRRRRRESHNAVERRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQP5	BHLH domain-containing protein	0.743	686-705	KKGNGSVVRGRRTSTRRRNP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X173	Uncharacterized protein	0.994	155-248	RSPARSSYRRDSRSPPRLPRRRSRSPLPYRRPSRSPPPKRLKLGNHSIGSPHSSRSSPRHRYRSPSPRYDERRRSTSLDRHSRRHSPPPRPSSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X173	Uncharacterized protein	0.618	78-82	PRSRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1T4	Cell cycle arrest in response to pheromone-related protein	0.987	734-758	RPGRKRSRSASGIRSRGKAGRRRRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X212	Methionine aminopeptidase	0.931	90-108	PYAMKIKGARKRPKQEAKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7J1	Uncharacterized protein	0.773	847-857	KAKAEQRKRKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7S1	Uncharacterized protein	0.853	656-664	SRRRMKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XER8	Rnase3 domain protein (Fragment)	0.981	713-722	KKKRKSKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEZ8	DUF2235 domain-containing protein	0.721	328-338	KKKEKQDMKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKU9	HMG box domain-containing protein	0.89	149-177	KAKHAKEQHKKEYPDYKFKPVHKKKNKGA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKU9	HMG box domain-containing protein	0.619	87-90	PGKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XL28	Uv-damage endonuclease	0.993	72-87	KSPKKKAKRSPRKKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XL28	Uv-damage endonuclease	0.962	436-447	TKGRKSNKKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XL28	Uv-damage endonuclease	0.951	99-113	PKKPRKPRKETRFRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XL28	Uv-damage endonuclease	0.64	502-508	TRGRGAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XP76	Uncharacterized protein	0.888	39-55	PKKRKKTNRSVGGRVPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ17	Usp domain-containing protein	0.929	522-539	RRRLKRPPRRSAHLAKHR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ17	Usp domain-containing protein	0.639	328-331	RRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTR3	Meiosis protein mei2	0.604	287-288	RR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJN0	Retrovirus-related pol polyprotein	0.998	181-201	GRAGKKNKKKKEKGSKGKEKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPI6	Transcriptional regulator ngg1	0.99	171-181	EDKKKKKKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPI6	Transcriptional regulator ngg1	0.98	63-101	YKRMKERERDKGKGRERLDDARSRERDREKERERNRERR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPI6	Transcriptional regulator ngg1	0.946	538-551	TKGRKKSKKDKDKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WT91	F-box domain-containing protein	0.63	73-78	KREKIR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2J3	Uncharacterized protein	0.967	301-316	IHKERERRRLRKKSRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2J3	Uncharacterized protein	0.83	569-576	PSKRKKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2J3	Uncharacterized protein	0.627	415-417	RKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2J3	Uncharacterized protein	0.618	1305-1309	PSRPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2J3	Uncharacterized protein	0.609	1300-1301	KP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAV6	Uncharacterized protein	0.936	37-55	KARRRGKQRYRRSISRWRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XP89	Uncharacterized protein	0.919	23-31	SKKKKKKAS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVU1	Dna repair protein pso2	0.894	35-56	PRDSSKPKPQTKSVPAPKRRKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YT17	F-box wd repeat containing protein lin-23	0.867	655-671	KGKGKGKGKEGLQFKPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YT17	F-box wd repeat containing protein lin-23	0.763	363-376	RIKRYLRRERRTRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YUR6	Uncharacterized protein	0.865	581-590	RKRKKMKTKD
UP000017559	Moniliophthora roreri (strain MCA 2997)	F2WVM8	Hyp28	0.743	28-43	KKNPPCKAREGRSRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W9H3	Uncharacterized protein	0.989	230-276	LKQARELKRKEGVDRWFAGVRIRMRQRARALNKVRREKAKAAKRAAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W9H3	Uncharacterized protein	0.723	195-221	RRRQRARVEKIGREVELAKRVKWAATK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WIK3	DNA ligase	0.93	105-129	ERPKPKSKSPSRSKAAKTALSNGKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WL13	Uncharacterized protein	0.746	149-163	KGKEKASTKTKKHPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXG2	Proteophosphoglycan ppg4	0.944	23-36	KSKGKGKGKGKGRD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXG2	Proteophosphoglycan ppg4	0.847	235-258	KRKKLLGQEQNSPTKKAKKVKVVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WY54	Uncharacterized protein	0.611	622-624	SKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WY54	Uncharacterized protein	0.6	620-620	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0I6	Phosphatidylethanolamine N-methyltransferase	0.728	9-31	RKRRPGSPADTGGAGPEKREPKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5L6	Adaptor protein	0.881	746-765	KARGGGPRKRHELPPPPVKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLP1	UvrD-like helicase ATP-binding domain-containing protein	0.716	141-153	KPKTQRQMKNRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMW3	Uncharacterized protein	0.968	753-819	KNRPKNRNKHAGRNSRNAPAHMPSSSSPKSSIRKHQRDSKQSNHKLSKRGDAHAGKGKGRGGGGIKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMW3	Uncharacterized protein	0.962	274-292	RSERRRKEKQRKEREERQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMW3	Uncharacterized protein	0.817	401-412	ERRRREELKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMW3	Uncharacterized protein	0.794	316-335	RERERLKREAEKQERERKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XR33	Retrotrans_gag domain-containing protein	0.703	159-165	KKKKEKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSC5	Ribosome biogenesis protein	0.999	184-227	KKKKRKADDLEKEERRERKRAKKEAKETEKEKRSKKAEKKKKSG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSC5	Ribosome biogenesis protein	0.996	242-303	KEERRKRKQERREAKLKRKADRERGGEEREEEAAKSKIAEDKIGMGESSSRKRTKKTKAKDP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTL7	Retrotrans_gag domain-containing protein	0.868	150-165	ARKEKGQRRHPNPRQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XX05	Ccch zinc finger protein	0.961	240-263	AMRGQGRGRGRSHDRGRGRGRGRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XX05	Ccch zinc finger protein	0.61	232-233	RK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZH6	Rna-binding protein 39-like isoform 1	0.998	28-123	TRRSNRSSSRDRGERRDRHRDRGGHERRRSRSRDRYRDRERTPERYRERDRERHRDRDSDRHRERRRERAESRHSHRDYDRERDREDKDRDRRRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZH6	Rna-binding protein 39-like isoform 1	0.677	192-198	RRPYRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y6M4	Uncharacterized protein	0.996	64-127	RHQPTRTKATPRRSARIALKDRKPISSSRKGKGKAAPMPRLAHSTKTKNRLPAPRPKSAAGKRV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y9V3	Leucine rich repeat domain protein	0.884	551-559	KARRKKAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y9V3	Leucine rich repeat domain protein	0.779	585-595	PGKAKQKSKPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y9V3	Leucine rich repeat domain protein	0.631	575-579	KGHRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXN2	Uncharacterized protein	0.946	378-389	ARRTRRVKRKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0B5	Rho gtpase activator	0.699	29-38	KRAFAARRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1S9	Dead box family helicase	0.706	620-631	GAKSRYQKKAKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W9M3	p-loopcontaining nucleoside triphosphate hydrolase protein	0.984	56-70	KGKLWKKKSRKAKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWS0	C2H2 type zinc finger domain-containing protein	0.847	585-593	KRRKKPGEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWS0	C2H2 type zinc finger domain-containing protein	0.741	510-521	RGRKARSRTVPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWS0	C2H2 type zinc finger domain-containing protein	0.679	650-655	PPRKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3W8	Separase	0.992	886-919	SAKPSSASKKPPTRRLKPPKTRAKAPVTPKPRAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7A4	Pre-mrna-splicing factor atp-dependent rna helicase prp43	0.986	116-144	AQKKRSGGIDTSFSGKKNGKSAKRKHQKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7Y8	Uncharacterized protein	0.953	17-30	KKHRLSRRKRKFKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFX4	Uncharacterized protein	0.855	844-858	GGGKKAPKRVLSKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN75	Tbp associated factor	0.909	188-198	ERNRLKRKRKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XN75	Tbp associated factor	0.636	1022-1029	KDKDKEKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVV4	Uncharacterized protein	0.995	141-164	AGRSRRKIERIIKEDRRRRHKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZQ5	Uncharacterized protein	0.958	31-43	SKSKSEKKRKRKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZQ5	Uncharacterized protein	0.694	70-82	QKIDKKTKESKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YS57	Transcription elongation factor Spt6	0.999	78-94	RRRERRRKRRKKHHRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YS57	Transcription elongation factor Spt6	0.816	203-219	LRRERRKQQAEMRRKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YS57	Transcription elongation factor Spt6	0.733	1231-1242	RKKRQEVDKKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YYP3	Uncharacterized protein	0.676	851-856	RRKAKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKZ9	Armadillo repeat protein	0.911	632-648	RGRLRRVLREKKAKNRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNZ6	Uncharacterized protein	0.971	853-867	HQVVKRRKGKKKSGP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQ80	Uncharacterized protein	0.925	298-309	HRPKGKKKGKIQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X542	Dna polymerase subunit delta-4	0.977	60-75	RKKRKNRKSSAGKKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAA7	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	0.818	59-72	KGNKSRKGANKNRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEL9	F-box and wd repeat-containing protein	0.711	143-149	KRKNKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ99	Uncharacterized protein	0.757	421-438	RKVDKLRRGIRDIWRRRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQM3	Nucleolar protein 12	0.998	572-656	KEERKKAKATDSTRLARRLAKKKARMALAVPGKGSGSELKIQGKDRNRERKSAAAKKGKGKHGVGSATKGRVRSDKSAAKRNLKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQM3	Nucleolar protein 12	0.765	101-108	RGGKKRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRP0	Dna replication protein	0.947	265-288	KGKNGKQDKGKEKEKEEHKSKGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRP0	Dna replication protein	0.903	58-71	SPKKKRKAEGIRQP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRP0	Dna replication protein	0.703	558-568	KRKREETERKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU97	Atp dependent dna ligase domain protein	0.772	155-166	RKRISASKRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y059	G-patch domain	0.997	783-803	TKGSEPEDKKKKKKKDKEKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y059	G-patch domain	0.994	828-863	RPKKKKKNRDSKEKDRDRDKDVDRHGSKDKDKKRQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YAE8	Uncharacterized protein	0.763	54-69	KKSTRIPLFGRPRKKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YAE8	Uncharacterized protein	0.687	143-149	KSPRKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YDN9	Uncharacterized protein	0.824	39-52	RPGRTVLKRARKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WL14	Uncharacterized protein	0.842	443-457	GKRASRRKEKQNRDI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WL14	Uncharacterized protein	0.733	373-383	RRKEQKKHSKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQZ9	Fungal specific transcription	0.822	95-107	RVRGPNKPKPRPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSU1	Rap-GAP domain-containing protein	0.687	573-587	KRLRRQAEQKAKEKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAK7	3-methyl-2-oxobutanoate hydroxymethyltransferase	0.852	575-604	PKRAKREGGPTTTKGSDIGKRRGLGRQKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJN2	Methionine aminopeptidase 2	1	45-59	AKKKKKKKKPKKKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLH1	Uncharacterized protein (Fragment)	0.993	126-152	KAGARRTHKGEQPGSKKKSERRARRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLI3	Ubiquitinyl hydrolase 1	0.643	785-788	RKRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW42	Retrotrans_gag domain-containing protein	0.632	15-19	KKNKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y2A0	Uncharacterized protein	0.652	158-164	KRNRSKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y7K2	H k atpase alpha	0.671	110-124	RQKRDGKNVIKPPPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YLS9	Uncharacterized protein	0.908	325-336	KISKRRKKTKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YMY7	Translocation protein	0.97	233-243	PRSAKKNKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQK3	Uncharacterized protein	0.68	352-359	RKPLPKRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X052	CCHC-type domain-containing protein	0.709	226-231	EKKKKF
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X174	RNA-dependent RNA polymerase	0.851	206-223	ERASKGPSNKAKRRFGSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5Z9	Nuclear protein snf4	0.661	14-21	RKPSSRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAU9	Helix-loop-helix dna-binding domain-containing protein	0.996	491-516	GRKRKKPKISPPPKKELKEKKPAPPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAU9	Helix-loop-helix dna-binding domain-containing protein	0.916	531-540	EKRKRGRPRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDG3	Krr family protein	0.999	484-497	SKKDKKKKKKKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDG3	Krr family protein	0.999	694-709	GAEKRKKKRRRHRKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDG3	Krr family protein	0.997	365-409	GTRKEARKRRKQRKEEELQKRREEVKRMKALKMKELRIKLDKIGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDG3	Krr family protein	0.996	639-661	ERPAKKRKGKKERMKEKMAAKPE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDG3	Krr family protein	0.983	228-246	SKDKKEKKKKAKTGASDKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDG3	Krr family protein	0.713	671-677	SSGKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZM4	Uncharacterized protein (Fragment)	0.607	641-642	RK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YB28	Atp-dependent rna helicase	0.995	753-771	DAIGGMRKKGKGKGKGKGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YB28	Atp-dependent rna helicase	0.992	689-725	AAIRSAKKAARPAKIGEPERRFERSSSKAKKKARAKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YB28	Atp-dependent rna helicase	0.987	647-676	KGKSKKAVEEKPKRDKFSGLSRKAKRRKLA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YB28	Atp-dependent rna helicase	0.729	73-81	RRKSSKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YD12	Uncharacterized protein	0.757	69-76	TKRRRAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W1P2	Retrotrans_gag domain-containing protein (Fragment)	0.91	122-140	KKEEKKKEELKKLSKKERF
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WGT3	Uncharacterized protein	0.743	391-412	ARKMRRPPPLPTRTSNIRVKNR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPQ5	CCHC-type domain-containing protein	0.678	302-306	RKKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYD7	Ribonuclease p complex subunit	0.998	63-98	ARESRTKKEREEKRKRRVADKEKKRLGIISRREAKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5N3	Proteophosphoglycan 5	0.901	153-168	PKKPKPSNKQRKLGRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6U4	Uncharacterized protein	0.626	172-175	KRRQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X727	Uncharacterized protein	0.614	81-83	RKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEM7	Uncharacterized protein	0.935	71-82	KSRRKKAKGKGS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGR5	Uncharacterized protein	0.742	202-210	RRKRMSKLR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLF4	Uncharacterized protein (Fragment)	0.782	1249-1256	PKPKRRPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLF4	Uncharacterized protein (Fragment)	0.61	731-732	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQM9	Dna dependent atpase	0.991	91-114	PKKQKVAEKGKGKGKNTKNAKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQM9	Dna dependent atpase	0.773	192-204	QAPRKPKTPAEKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW13	Uncharacterized protein	0.894	259-274	SRRRFRKRLYMRRKRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXE1	Svp1-like protein 2	0.657	419-426	SKDKGKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQY9	Set-domain and phd finger containing protein	0.977	1308-1381	AQEKAEARRKEEERLKEEARVREEQRLREEARAREEARLKEERRLREEARIREEARLREEAKAREEARLKERKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQY9	Set-domain and phd finger containing protein	0.888	194-219	RKTSPGLDRRSRKPSSAIEGSKRKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQY9	Set-domain and phd finger containing protein	0.631	1644-1648	RARRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXW4	Uncharacterized protein	0.774	319-332	RKDLRRRQRAFRAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYP5	Atp-dependent rna helicase	0.999	13-36	EKTKAKKRYLKRKKERRKIKKYSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYP5	Atp-dependent rna helicase	0.784	76-82	PPKKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYV5	CCHC-type domain-containing protein	0.646	226-233	KKPQRSFR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZU1	Uncharacterized protein	0.722	17-30	RKKLKMDIKQKKSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4Z7	Calpain catalytic domain-containing protein	0.968	6-23	KISRTPKRGKSSKKKSKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X690	Purine nucleotide binding protein	0.989	1275-1289	SQDKRRKRKGKKGGA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X690	Purine nucleotide binding protein	0.988	1253-1264	RRRRRKKKKNDN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X690	Purine nucleotide binding protein	0.938	168-190	SPPKKKAATASSKTAKPKAKKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X690	Purine nucleotide binding protein	0.912	337-377	KGSGKLDEKTKKKMEKEQEEIKKAARELEKREREAAKEATK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X690	Purine nucleotide binding protein	0.887	114-127	KPLKKKPAPAPKPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6X8	Uncharacterized protein	0.799	12-39	SKPAKKEKVFHPESRKAAQLNRKSVRKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6X8	Uncharacterized protein	0.776	100-107	RRKGRPKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7J9	Apurinic apyrimidinic endonuclease	0.995	403-421	AGGGKEKKPKPKGKLKKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEU0	JmjC domain-containing histone demethylation protein 1	0.702	106-115	KGPARKSERK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNW6	Increased rdna silencing protein	0.893	348-361	RRAKQQRHRARKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNW6	Increased rdna silencing protein	0.614	596-598	RKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWE7	Proteophosphoglycan ppg4	0.883	455-473	EREARSRQRREDRRARKSS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWE7	Proteophosphoglycan ppg4	0.791	618-623	KKKKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWI4	Uncharacterized protein	0.713	162-167	NRPKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJ04	Uncharacterized protein	0.786	278-287	RRGHRRRAGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X112	Uncharacterized protein	0.93	82-99	RRRRRRRSSSSPQRRVSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCH6	Uncharacterized protein	0.935	225-234	PRRRKRKRIR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCH6	Uncharacterized protein	0.885	88-97	GKKKAKRMKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XG76	Poly [ADP-ribose] polymerase	0.905	68-80	TKKPASKKAKKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XG76	Poly [ADP-ribose] polymerase	0.823	234-246	KGKGKGKKDAADK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XG76	Poly [ADP-ribose] polymerase	0.812	553-564	KAKKRATKGIGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XG76	Poly [ADP-ribose] polymerase	0.624	50-52	KRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGF7	U1 small nuclear ribonucleoprotein	0.974	193-255	RTVRGWKPRRLGGGLGGRPKRAESAPMPARGGGFRGGFGGGGGRGFGDRGGFRGGRGGFRGGG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGF7	U1 small nuclear ribonucleoprotein	0.872	79-90	RQIRREERKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ62	Uncharacterized protein	0.992	283-295	PRRKRRRKRRTPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ62	Uncharacterized protein	0.732	680-686	KKGRRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ62	Uncharacterized protein	0.658	383-389	RRPSRRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ62	Uncharacterized protein	0.637	706-709	RKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKI1	Uncharacterized protein	0.98	334-356	GKRKHSRFESERKNVKKKSRKSA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKI1	Uncharacterized protein	0.873	301-321	RRKGKKAGVLERSRDMQKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKI1	Uncharacterized protein	0.635	239-242	ARRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKU6	KRR1 small subunit processome component	0.954	303-354	KHEKEARESEKRRQKQAEMAEKRRAEREEAFKAPAEDRALTVEEKRKRKRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKU6	KRR1 small subunit processome component	0.639	238-250	KKHLKTSEKTAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWT3	Uncharacterized protein	0.73	304-310	KRKSKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZB9	Uncharacterized protein	0.84	249-260	KDTKSKSKKRPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXU6	Rnu3ip2 protein	0.941	10-51	KTRKRKRSEPSGSKTIPKKSHTFFPKSKNSKPLLNNGSAKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WHC1	Putative rok1-atp-dependent rna helicase	0.993	514-565	LPKPSKMKRREMGKIARSEFVNPARKIGRKDALKKKEMIAGSKRRKAKEKSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WHC1	Putative rok1-atp-dependent rna helicase	0.972	64-84	PGKRKADGKTKGSPGKKRRLE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTD0	Uncharacterized protein	0.714	37-46	RSRRFRARRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2I4	Serine/threonine-protein phosphatase	0.866	450-459	KEMTKAKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2I4	Serine/threonine-protein phosphatase	0.835	7-17	KKSKKGGKEKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8M3	Uncharacterized protein	0.956	62-82	KKLARKIKKGAKENGNTKKRI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XC60	Uncharacterized protein	0.923	294-310	KRKVPKGHRLQRRRREH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD51	Pro-pol protein	0.932	78-90	KKDKKKKEEPKKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFM1	Non-specific serine/threonine protein kinase	0.852	807-826	VKVRRGKKSIRIVAEEHKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQL2	Origin recognition complex subunit 4	0.84	67-77	PGPKRRGRQKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQL2	Origin recognition complex subunit 4	0.74	113-130	PRKTVAKKPTRQYGSKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWR1	Uncharacterized protein	0.982	177-222	TRPRPRPRSRSRSRSGSVSPTKPSAKRPGHAKSKSFSATKSKPKSH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWR1	Uncharacterized protein	0.862	367-375	ERRRRRRPA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWR1	Uncharacterized protein	0.779	140-165	PKIDKGLKRFKSMGMLKPLRSRTRAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y8N1	Proteasome subunit alpha type 1	0.76	541-547	RKGKRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YVL2	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	0.78	139-145	SRRRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YVL2	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	0.607	118-118	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YVL2	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	0.604	114-116	RGP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YVL2	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	0.6	120-120	P
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WS90	BHLH domain-containing protein	0.919	1609-1634	KHQHRRKTKSRTTKPSPPRLHHSRRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYU6	Uncharacterized protein	0.716	248-255	KPTKKRTR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYU6	Uncharacterized protein	0.652	164-168	KKRPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X179	Signal recognition particle receptor alpha chain	0.938	201-220	KNRLRGRGGRRGGRSGGRPL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X179	Signal recognition particle receptor alpha chain	0.782	239-248	PKKKNKIKTQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9S5	Gata transcription factor	0.721	42-47	PPKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCF1	Uncharacterized protein	0.948	41-61	RWGTGPRTSSKKQPKPRRRSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGJ0	Endothelin-converting enzyme 1	0.984	382-399	GKKPGNKPKRARKLAKKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGU2	Transcription regulator	0.996	483-522	KQEKKKKKEKKEKVPVPSTSKAVPKPPKTSTSSSKKKSKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGU2	Transcription regulator	0.836	596-615	TAPPKRSRPGKGTGTGGLKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGU2	Transcription regulator	0.753	316-322	PKKPRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGU2	Transcription regulator	0.614	299-300	KR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XK65	NADPH:adrenodoxin oxidoreductase, mitochondrial	0.666	254-263	KGSKNKTKQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKV6	Uncharacterized protein	0.6	29-29	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPY3	Structural maintenance of chromosomes protein 6	0.835	40-49	RRARKGKGKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRF6	Uncharacterized protein	0.956	433-469	AKEKEKARASGQRSVRYKPGPVSKAQKPSQRKKPRSA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRF6	Uncharacterized protein	0.955	294-335	KTRSTSPNKRSRGRPPKAVKEAQPQSKGQIRSTSPTKRGRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRF6	Uncharacterized protein	0.758	363-371	KRGRGRPRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRF6	Uncharacterized protein	0.666	57-61	KAKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU54	CCHC-type domain-containing protein	0.802	190-203	KKDERRREEPKKLS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZI8	Uncharacterized protein	0.976	411-423	KSKRAKKKKKQGT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZI8	Uncharacterized protein	0.732	478-493	KPELTKRDIRRARQAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YQV3	Uncharacterized protein	0.615	275-277	PKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMN9	Homeodomain mating-type protein	0.93	275-291	KEKREERLKRRRVGHKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWR9	Uncharacterized protein	0.865	214-237	RKSNVPKEKKRFEFTKGNSKKDRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCU2	Uncharacterized protein	0.993	148-162	PKKHKENPKKSKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEM8	Uncharacterized protein	0.905	384-411	SRPPPPPPTKSKESRPRPPSLALRRPPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEM8	Uncharacterized protein	0.881	597-617	PRKSPDAKAKPTPKKPVSSKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XME7	Uncharacterized protein	0.724	74-80	KGKKKQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRR2	Uncharacterized protein	0.627	615-620	KNKSRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSF5	Histone-lysine N-methyltransferase, H3 lysine-79 specific	0.88	61-71	APKKKRKSQSD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSF5	Histone-lysine N-methyltransferase, H3 lysine-79 specific	0.807	73-91	EVGVRVKKKTKITTTAKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSF5	Histone-lysine N-methyltransferase, H3 lysine-79 specific	0.611	322-324	KPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y576	Rum1	0.921	1461-1471	RPLKPKKKKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y576	Rum1	0.864	941-954	KQPSRKRARRSVKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y6D8	Zinc finger protein 133	0.61	229-230	RK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z022	Uncharacterized protein	0.947	1380-1396	RSRKIRRRGSSKSRGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z022	Uncharacterized protein	0.946	1483-1494	PRKRPKGKKAKN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z022	Uncharacterized protein	0.648	1126-1129	KKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WS82	Hexose transporter	0.848	362-371	PRKPRSRKRH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXH6	Uncharacterized protein	0.82	38-50	RPGRTIAKRGRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6X2	Integral membrane	0.933	37-54	APRPQRRRGGKNRNRGQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAD0	Uncharacterized protein	0.999	8-44	RKTRKTLSSKKPKSSKKPKSSKKPKSSKKPESSKKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XED4	Uncharacterized protein	0.984	324-347	EKKRSTKRRKLEKSLPSRRSPRKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XED4	Uncharacterized protein	0.964	295-306	GKKRPKKRKSAG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XKI4	Uncharacterized protein	0.922	427-442	RPRSKSKSPRRSRKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRW3	PARP-type domain-containing protein	0.999	106-203	KKALKKGHVDEKDAQAQKAKSDIARVKEAEKEKEKKEEKKRKSENADTDGEPKTKKKKTKNSEDSEKPKETKEKKPKKKEEKEKHVAPRTKEEKKTQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRW3	PARP-type domain-containing protein	0.999	262-289	PRSDKDAKEKGKEKKKSPKKQKSPKKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRW3	PARP-type domain-containing protein	0.953	227-248	KHKAEEKKSPKKDKDRRLSKNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRW3	PARP-type domain-containing protein	0.899	354-391	KEDPKAKTTPKKASTTKGTAKPKTAPQEKVKAKLAPRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXS5	Wd domain protein	0.999	294-315	RKKRLRRKKRAKEKKDKEPKDK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXS5	Wd domain protein	0.864	938-950	SEGKKRKRVNLKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YLJ6	Guanine nucleotide-binding protein alpha-4 subunit	0.767	57-63	QARKKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXY8	Atp-dependent dna helicase hrp3	0.993	91-113	RPRKKVLKKKKKSPAFSAPRPRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXY8	Atp-dependent dna helicase hrp3	0.924	130-139	RSKKKKKSRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXY8	Atp-dependent dna helicase hrp3	0.716	992-1001	PKKPKPAAQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXY8	Atp-dependent dna helicase hrp3	0.681	1273-1277	KRKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WFX1	Retrotrans_gag domain-containing protein	0.73	192-202	KKKRELIKPKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X230	Tudor domain-containing protein	0.995	141-178	KRKLSKQEEEEREKKKKKNEKKLEVRAAKAKEQIAKQA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X230	Tudor domain-containing protein	0.617	185-186	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X891	Uncharacterized protein	0.884	517-541	EGISRKGKEKKDPTSSARPKLILKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X891	Uncharacterized protein	0.686	509-513	KKRKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPH0	Nicotinate-nucleotide pyrophosphorylase [carboxylating]	0.604	241-241	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPH0	Nicotinate-nucleotide pyrophosphorylase [carboxylating]	0.601	243-243	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU23	Uncharacterized protein	0.932	365-373	RRRRRRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU23	Uncharacterized protein	0.845	317-330	RGQKISKRRRERQE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUI6	Delta(24(24 ))-sterol reductase	0.998	671-706	KGKFKPIGFKPIGAPIEEKPKKRKAGESEKKKKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUI6	Delta(24(24 ))-sterol reductase	0.985	878-891	KKRKRKEKQKTKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUI6	Delta(24(24 ))-sterol reductase	0.681	536-542	PRKVKKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YH70	Reverse transcriptase	0.851	189-205	KKDERKKEEPKKMTKEE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YH70	Reverse transcriptase	0.609	142-144	KQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YNN5	Uncharacterized protein	0.807	219-232	PPAERRRAGKHTRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YSF4	U1 snrnp splicing complex subunit	0.707	301-314	RRDRDRSRSPRSSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YSF4	U1 snrnp splicing complex subunit	0.604	239-240	KR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W4S2	CCHC-type domain-containing protein	0.798	229-240	RKKREPIKPKIA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W4S2	CCHC-type domain-containing protein	0.64	526-528	KKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WGR5	Uncharacterized protein	0.715	117-121	KKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WLH8	Choline-phosphate cytidylyltransferase	0.611	13-15	RKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9U0	F-box domain-containing protein	0.869	54-64	KRPRKKKTQMR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBB6	ATM homolog	0.931	213-229	GSKKRRKREAPTPQPPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XC08	Uncharacterized protein	0.827	300-313	GPERRGRKRQLAIR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFH4	Uncharacterized protein	0.821	124-131	KRRRRTRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFW6	Uncharacterized protein	0.884	394-404	KGKSKGKKKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFW6	Uncharacterized protein	0.642	171-177	KAKPSAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFW6	Uncharacterized protein	0.626	329-332	RKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ23	TFIIIC_sub6 domain-containing protein	0.999	148-194	PQKKTRRKGPKPKEKEKETGNAGDGLDPAAKPKKKGKKKSGRKGKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ23	TFIIIC_sub6 domain-containing protein	0.695	217-221	KKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YQP2	Eukaryotic translation initiation factor 5	0.812	153-161	VKTKKGKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK26	Uncharacterized protein	0.943	119-137	RQAANQRRRAENRKHKKRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WP27	Non-specific serine/threonine protein kinase	0.75	450-467	SKRKRTDVHGLGSKKARK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WP27	Non-specific serine/threonine protein kinase	0.715	408-416	KAKPVRRKF
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WP27	Non-specific serine/threonine protein kinase	0.695	422-431	KRIRKTLKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSI2	Uncharacterized protein	0.917	19-45	GGRSRGVRGHGRGQRTGESNPRKRRRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUG2	Splicing factor u2af-associated protein 2	0.858	222-241	GERKVVDRKKATRRIGKMQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUG2	Splicing factor u2af-associated protein 2	0.677	106-115	KRSKPERERK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6X4	DNA ligase	0.709	642-647	KKRKIT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6X4	DNA ligase	0.674	1006-1013	KRTSKPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6X4	DNA ligase	0.609	631-633	KRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDF8	Ring finger domain protein	0.984	253-270	PPERPGRPARPRRRARRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIG4	Uncharacterized protein	0.615	93-96	RKPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRM2	Uncharacterized protein	0.991	487-515	AQRKRMAYIKKRIERSKEKTRHRNRGKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV48	Uncharacterized protein	0.821	396-411	KKMGQKMRLNQRSKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YFW4	Uncharacterized protein	0.652	534-538	KKRKW
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YIC1	Uncharacterized protein	0.993	39-62	KPRRTKWRERKSKGAVKTRKAKRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YNH6	F-box domain-containing protein	0.828	20-52	PPPKKRHRIAPNHVASASPSIPREKKRVIAFGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZV9	Uncharacterized protein	0.744	152-169	KKKGPAKPIPSLWKSAKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZV9	Uncharacterized protein	0.717	44-55	KTYRRNAKKPLP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMV1	Structural maintenance of chromosomes protein 4	0.911	137-166	KPKRRATRTTRAQRGRPTSSRSRRSSAKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMV1	Structural maintenance of chromosomes protein 4	0.684	237-242	GRKPRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMV1	Structural maintenance of chromosomes protein 4	0.612	96-97	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPN2	Nuclear pore complex subunit	0.723	1456-1468	RAPSPETKPKRPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPT3	Uncharacterized protein	0.997	168-191	RRRKGNRKNRRSLRRRKGSPRLGP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPV9	Vacuolar protein sorting-associated protein vps13	0.906	376-396	RSRLRKDRALRKRLEEEKAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X209	Proteophosphoglycan 5	0.801	801-821	KGLLLRRKFTLRRHHRTSKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X209	Proteophosphoglycan 5	0.632	638-640	RRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3S4	BTB domain-containing protein	0.627	234-242	KPVRAAIKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6M1	Uncharacterized protein	0.824	302-308	VKRRKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8A9	Endoplasmic reticulum ca-transporting P-type atpase	0.668	1215-1222	RERREARR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAI6	Snf1 kinase complex beta-subunit	0.703	39-51	APRPHRSLRVKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAI6	Snf1 kinase complex beta-subunit	0.658	452-456	RRKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE70	Uncharacterized protein	0.89	411-431	RRSLRIKSKPRKTWSKRDFGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XR01	Reverse transcriptase-rnase h-integrase	0.659	209-213	KKAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWD7	Rna binding protein	0.943	291-303	RGGKRRKTRKPAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWD7	Rna binding protein	0.909	97-108	SRPKKRKRENEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWD7	Rna binding protein	0.824	229-249	KLRERNKKLHDQKKGTKSAKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWD7	Rna binding protein	0.804	7-24	LTKKQKKAFAFRERKTGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y225	Extracellular dioxygenase	0.767	59-68	KRKAKRALAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YHL2	Hmg box	0.989	103-130	RKGKRKGKGKGKNCTKEPVKKVARRSRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YHL2	Hmg box	0.978	5-29	KSKAPRTPRKASRPKKPQPAPIPRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YTN7	Sas10 domain-containing protein	0.989	584-609	PHRSKSVRNPRVKKRQKFEKAKKKVA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YTN7	Sas10 domain-containing protein	0.746	3-17	RKRASKFKNESRKPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YTN7	Sas10 domain-containing protein	0.74	539-546	KERKEKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YTN7	Sas10 domain-containing protein	0.668	388-392	KKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W6D9	Polynucleotide adenylyltransferase	0.997	128-190	EKKERRRRSRTRSRSRERDRNRDRDRDRDRDRDRDRKGKDREREWDRGKPRPRERSRERGRDR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W6D9	Polynucleotide adenylyltransferase	0.996	76-96	RRESRKRKKKSRREDSNKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W6D9	Polynucleotide adenylyltransferase	0.899	30-39	SKRRRKKGSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WDD1	Glycoside hydrolase family 76 protein	0.655	436-440	RKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WHT1	60s ribosomal protein l11	0.935	139-158	GARVAKRKQKKARVGFQHRI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWS1	And tpr domain protein	0.815	429-444	RRLSEAKKQIKMRRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWX0	Uncharacterized protein	0.69	39-42	KKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7H0	Uncharacterized protein	0.832	152-162	KRREARRKRNA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7I9	Dna-directed rna polymerase i complex subunit rpa43	1	295-345	RKADEAKKKAEEAREREKDKEKEKKKKKKRKERDDADKDAVPAKKKKGSKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7I9	Dna-directed rna polymerase i complex subunit rpa43	0.931	22-40	AKKMKHSTTPKKDKKGKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XC47	Uncharacterized protein	0.748	10-23	RRNQRKSQARRAKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XH77	Dna repair protein rad5	0.911	196-228	KQKKGASDKKSGKKQMSIASMMKAKPSKPSKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHF7	Non-histone chromosomal protein 6	0.959	52-80	KRKKGKGKDGVEDEGGKRKRTKDPNAPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHF7	Non-histone chromosomal protein 6	0.824	240-256	KKQKVEKPTSKAKKSRT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJL2	Putative fungal zinc cluster transcription factor	0.917	52-62	GKKKKTSKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMX1	Reverse transcriptase-rnase h-integrase (Fragment)	0.855	303-318	RKKRELIKPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y0Y2	Uncharacterized protein	0.706	1049-1055	APRRERK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WS57	Nwd2	0.989	1102-1127	RMRKRRAGQERSKSEPPAKRRRKTKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1J6	Uncharacterized protein	0.89	72-85	KKFRRAEKRRERPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRT3	Pre-mrna splicing factor	0.802	196-215	RKRLDERRRERQREGIPAAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRT3	Pre-mrna splicing factor	0.693	141-154	KRAAADADRSRKKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z189	PDCD2_C domain-containing protein	0.989	123-152	KKLEKKLARKREREEAKRKAEEAEKAKAAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WEM9	Putative thioredoxin	0.955	580-599	GRKSPSRKSSEKRPGGRGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WEM9	Putative thioredoxin	0.819	722-745	RPRPRPRPTSPKPSLKSFGSSAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WEM9	Putative thioredoxin	0.818	764-772	KTKKKKGGA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXQ3	Set domain-containing protein	0.981	1672-1689	GRKRKGAKSKASPRKPKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXQ3	Set domain-containing protein	0.837	434-446	PRLRPKPQKKAKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXQ3	Set domain-containing protein	0.743	296-304	SRKGKEKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXQ3	Set domain-containing protein	0.703	108-119	RKKASDRPPKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXQ3	Set domain-containing protein	0.674	382-386	RRRPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEI4	Uncharacterized protein	0.828	278-287	KASRRPKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIM9	Rho guanine nucleotide exchange factor 17	0.912	585-605	KRRRKSYGGKEPSERRRRLSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIM9	Rho guanine nucleotide exchange factor 17	0.772	785-800	KEKDKDKIGRKLSKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ20	Grf zinc finger family protein	0.756	74-87	NRSSRKVAKKDAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPY4	Protein that interacts with silencing proteins at the telomere	0.985	466-497	RKEKDKKGLFGKWGSDKSKKEKEKEKEKEKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPY4	Protein that interacts with silencing proteins at the telomere	0.611	254-256	KIR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSC4	Uncharacterized protein	0.828	341-374	RRVPVVKKLFGIGKRKAASADVDDRKPKGQKRQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZV1	Duf221 family protein	0.818	402-414	GKVLRRKTRKEAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZV1	Duf221 family protein	0.653	357-362	RTRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YBQ6	Non-specific serine/threonine protein kinase	0.895	61-85	SERSRRERDRGRPHHDSRGRRDGSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YN94	Uncharacterized protein	0.819	1050-1060	KRPQRKRKTGP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YU14	Btz domain-containing protein	0.861	29-43	QGKKTRVVRRRGRAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YU14	Btz domain-containing protein	0.726	155-163	RKQKKTHKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z220	Ste ste11 protein kinase	0.777	649-658	RRGIRKGKKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z220	Ste ste11 protein kinase	0.707	378-394	RPKFSKPNSNREIRKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WEK0	Histone deacetylase	0.998	525-549	TRKPSRGRGRGRGRGRGGRRRGRAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WEK0	Histone deacetylase	0.841	479-494	GTGRRGGRGRGARVSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WI98	Uncharacterized protein	0.99	79-106	RRLGGRDRNPSRRLKAKKRLHRSDRRNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNZ9	Uncharacterized protein	0.909	272-285	ERRRAKDRERKKLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSG0	Abc fatty acid	0.955	53-75	RPTKPSGKGKGKGKDNKESGKPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUA9	5'-3' exoribonuclease 1	0.684	99-114	SRRFRTAKEAREVREK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUZ8	Centromeric dna binding protein	0.865	376-387	KKRKRTTKSRSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUZ8	Centromeric dna binding protein	0.793	291-309	KKQRVAEPSKEKVIKKPKQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUZ8	Centromeric dna binding protein	0.734	69-75	GKGKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6C9	Uncharacterized protein	0.997	16-40	PKRKAKGKGKDKEKPTPKEKKGKKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X922	Uncharacterized protein	0.98	100-117	TKKRKSPPAVHRKRGRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X922	Uncharacterized protein	0.759	278-300	GRGRGRGTHVAPARSPVRTRRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCM0	Reverse transcriptase	0.838	418-433	PKKDKRKQEEPRKMTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHN0	Ectomycorrhiza-regulated protein	0.817	149-164	RRHKNTIAARRSRRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNV9	Mitochondrial genome maintenance protein MGM101	0.911	227-236	KKKKKVWRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTX1	Aspartic peptidase a1	0.91	481-490	KRRRKKARRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW99	Duf1168 domain-containing protein	0.991	115-135	KTAKNRAKRQKKKERSRAAKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRS6	Uncharacterized protein	0.668	81-85	KLRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUI1	Retrotrans_gag domain-containing protein	0.865	229-244	RKKREPIKLKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZQ7	Uncharacterized protein	0.823	189-200	KRQRKAKKPPQP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X713	Uncharacterized protein	0.998	721-760	KSKEKKEKKEQKKREREEDKDKKDKDKEKGKSKNKDKGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X713	Uncharacterized protein	0.995	1583-1596	KRKRSRKKKAKKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X713	Uncharacterized protein	0.993	784-810	PKRVKLKDITSKPRHRRSKKGRGKSSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X713	Uncharacterized protein	0.659	603-606	RRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X976	CobW C-terminal domain-containing protein	0.986	8-67	KAKVKRIVAPLSGSSKGTKHKSKNKDKKGTKSSSAKDSHRHQHVDSKPKNTKGKQQRIRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDQ3	Uncharacterized protein	0.998	14-51	EAGRRLRKKEKKAIKRRRHEHDSDEGKSRRKRSRLSPS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDQ3	Uncharacterized protein	0.991	186-226	KNERASRRAKEKVIQAETERLEKAAAEERRKKKREKENRKW
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIU4	Signal transducer	0.968	687-712	KGKGKRGSRKKAVVPIAPVRRSARGA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIU4	Signal transducer	0.857	490-509	PKLFGAPGLKDRMKRRQKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIU4	Signal transducer	0.851	431-459	KPDTKEKGKITGKKTVIPVTGKGKGKGKQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIU4	Signal transducer	0.664	131-136	KKSRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIU4	Signal transducer	0.64	479-484	KMKPKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSA9	Xylosidase arabinosidase	0.933	829-860	QRREELAKELKRRQKEMEAQKVKISAKRRPRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUM2	Uncharacterized protein	0.928	8-28	AKAARAKALLKKRQAAKKDKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW11	Uncharacterized protein	0.96	486-501	KGKRNTRVLRRSKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WI11	Uncharacterized protein	0.806	14-27	KKKYKPVAKKVKPI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6N7	Macrophage erythroblast attacher isoform 1	0.675	32-39	GKAPKPSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XC21	Uncharacterized protein	0.792	429-440	YRRSSKRGSKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XC21	Uncharacterized protein	0.614	393-395	RKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEN5	HMG box domain-containing protein	0.726	164-173	KGISKKGKGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ27	THO complex subunit 2	0.985	1716-1787	RDRSEGEREKDRDSRRDRHGDRERERDRDRDRERERDRDKDRDRERDRDRHGDRHRRDDKDRERERERKERD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ27	THO complex subunit 2	0.977	1823-1872	GKRRRGPDDEFERGSKRGSRKDAHREDRSRRPGDKDKDTHRESDRRRRER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJA5	Cellular morphogenesis protein	0.943	180-193	HRPRHPRRRPLRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ71	Helicase sen1	0.79	1045-1057	KSPKIKKQPERRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ71	Helicase sen1	0.674	894-898	KGKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUG6	AP-3 complex subunit delta	0.997	681-707	DKKVKKGRKGKGKEVNGSKSKNGKKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUG6	AP-3 complex subunit delta	0.875	874-893	RSKKKKTGTSGSGTGAKKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUT1	Transcription corepressor	0.822	427-435	KKNKSKKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YDK6	Uncharacterized protein	0.743	262-278	PKTFRKREFARGFRAKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YNE7	Uncharacterized protein	0.9	577-587	PQRRKLRKRKQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YNE7	Uncharacterized protein	0.821	38-50	RPGRAIVKKGKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YUG3	Uncharacterized protein	0.896	279-292	RAKKIKLEKKPKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YYY5	Protein-tyrosine-phosphatase	0.623	235-237	KKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRW5	Uncharacterized protein	0.793	379-404	KLKHTWKKIGQKMQLNWRHRRKETKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1R6	Zn(2)-C6 fungal-type domain-containing protein	0.726	77-81	RKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3Y9	Uncharacterized protein	0.98	213-250	KSKKRKSTGKRKLSGAAAVNASRAAARKKAAAAAASKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3Y9	Uncharacterized protein	0.967	133-149	SKTKPKSSKKRERGKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBT8	Mrna export factor elf1	0.887	1062-1084	VKKKKKLTRNQLKVQEERRRLRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XP42	Uncharacterized protein	0.832	513-521	KRRRKLRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWJ6	Uncharacterized protein	0.966	138-162	KKVKRKVSPKPEGSGKTSRPRKAKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXZ3	Uncharacterized protein	0.871	669-678	RRRGRNRPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1D3	Uba ts-n domain protein	0.961	758-781	CRRALAPPPPKPKAPAAPPRPKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1D3	Uba ts-n domain protein	0.66	584-589	RPKPKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJC7	Uncharacterized protein	0.826	4-16	GKNKGGRPAKKAH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKW9	Uncharacterized protein (Fragment)	0.663	117-121	KKKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WR24	Eukaryotic translation initiation factor 4C	0.925	3-16	KNKGKGGKNRRRGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WV40	RING-type E3 ubiquitin transferase	0.979	12-38	KRGRGGRGGRGGRGGNRSKAAGRGGNR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WV40	RING-type E3 ubiquitin transferase	0.903	744-756	GGGGKGKKGKGKQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWA6	Uncharacterized protein	0.733	77-88	RKKSAKLRIQRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4Z0	Denn (Aex-3) domain protein	0.858	189-197	GKRRRRPKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHH8	Atp-dependent rna helicase mak5	0.988	760-777	AKKKKKDKKNVKTKSHKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHH8	Atp-dependent rna helicase mak5	0.923	381-394	VKKRSRPKNQGKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHH8	Atp-dependent rna helicase mak5	0.765	8-24	KKRKQASGSSQIKKKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHH8	Atp-dependent rna helicase mak5	0.631	652-657	KPPKTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XI60	Uncharacterized protein	0.875	9-22	RSKKQKGSKKKTAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYS4	Chromatin remodeling complex subunit	0.955	276-292	LSRQNSKKKGAKKRVKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YA49	Peptidyl-prolyl cis-trans isomerase	0.778	11-25	KKSGNKKANDKKGKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YH51	Structure-specific endonuclease subunit SLX1	0.916	417-427	PKRKRGRPPKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YH51	Structure-specific endonuclease subunit SLX1	0.666	390-398	RVRSKAFRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRE5	SMI1_KNR4 domain-containing protein	0.929	604-625	EKKHKRTKSGLAKKLGKLGIHK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YUD6	Uncharacterized protein	0.994	183-206	SGKKKAAAKKAPAKKAKAGPSKLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YUD6	Uncharacterized protein	0.928	93-116	KRKAAASSTQPKRKSRKSENGKKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W7X7	CCHC-type domain-containing protein	0.641	228-231	KKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WGP2	Uncharacterized protein	0.778	45-58	RKPKKPSGDKNKDK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WW22	Uncharacterized protein	0.887	127-139	LNKNKSKKASKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5P9	Uncharacterized protein	0.739	528-536	KKSKRARSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF86	Uncharacterized protein	0.858	540-548	PRKKKKHHK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMD4	Uncharacterized protein	0.999	299-337	PAKKKKEKKAKEKKTGKAGDEGAEKSKVKPKAKKKEKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMD4	Uncharacterized protein	0.978	189-206	IKKKKEAKAKEPKSKAKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMD4	Uncharacterized protein	0.969	402-426	PRKKQKSGAKGRERNNAPNPSRKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMD4	Uncharacterized protein	0.949	597-616	NRRTPPPLPPPPPPKKKSKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XP19	Uncharacterized protein	0.774	45-55	KIVKGPKKPKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRD1	TAFII28 domain-containing protein	0.943	31-48	PGRPKGSTGAKRGRKPRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSB8	Nucleoporin nsp1	0.737	545-553	KKHKAKGTR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSL1	Uncharacterized protein	0.887	5-22	RNKSSKSRKNSPKSAKKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSX6	Glyco_trans_2-like domain-containing protein	0.854	490-503	SKEGGFKRRGKFKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ42	Uncharacterized protein	0.968	237-250	KAKAARKRKREKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ42	Uncharacterized protein	0.757	637-645	APRKGKGKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YEF7	Uncharacterized protein	0.969	24-50	FKKPPAKRQISEPGSEPPSKKPKSKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YEF7	Uncharacterized protein	0.806	163-181	IGKKKLPDPERGGAGKGRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YYX1	Dna mismatch repair protein msh3	0.692	97-108	KRKARHEEFKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQ07	Chromo domain-containing protein	0.623	196-200	HKLKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WS40	Retrotrans_gag domain-containing protein	0.99	130-164	KKKSLSSRSQRWTRRNAAKKEEKKKEEPKKLSKEE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2S4	R3h domain containing protein	0.965	950-987	DRQKKAAKKREREMERLLAAADPLSPRKGGKKARKLEG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2S4	R3h domain containing protein	0.953	39-70	RGGRGRGGRGGGGRGRGGFDRGGIGNRGRGRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2S4	R3h domain containing protein	0.87	928-941	KAGKRKNKSKHLPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2S4	R3h domain containing protein	0.733	829-841	RKQSQKDKGKGKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2S4	R3h domain containing protein	0.696	632-649	KHRHRVQWARRTESKKGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2S4	R3h domain containing protein	0.667	1097-1105	RGNGKGKPT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X425	Ef hand domain-containing protein	0.975	1194-1250	PPRAKSPPPRVGSPKPPRPSTASGSSRDGQEKEKKEPPPRHSKLSIRLPFGKKKKQQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XG35	Transcriptional corepressor	0.791	871-884	SKSKRSSRRSGKEE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XG35	Transcriptional corepressor	0.67	841-846	KSRRRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ25	Uncharacterized protein	0.861	199-209	KRNQRRRLKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMQ3	Uncharacterized protein	0.622	677-679	KRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XR98	Uncharacterized protein	0.645	463-470	KKPQRSFR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSZ7	DNA polymerase	0.931	90-112	KKKSTKKSQSTAKSKGKPKAPPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSZ7	DNA polymerase	0.67	647-655	RIGRFRRAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y784	25S rRNA adenine-N(1) methyltransferase	0.644	5-8	RKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YF89	Uncharacterized protein	0.998	81-124	KAGDSKKRKRGTAKKSRKPRAPQPSGTGGKSSDKRQKTGASKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKF8	Mucin-like protein	0.71	328-338	GRRSRYRLKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WL29	CCHC-type domain-containing protein	0.825	90-104	KKDEKKKEEPKKLTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WLX8	Calpain catalytic domain-containing protein	0.99	6-27	PKTLKRSSKGGKTKKKSKPGKN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5Q1	Uncharacterized protein	0.997	58-91	ARKKKKEAKEEKKVRDKLRRREERAREKAEKAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5Q1	Uncharacterized protein	0.952	197-211	PRPRKKRPAVRKGWK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA68	Uncharacterized protein	0.724	616-623	FAKREKKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA68	Uncharacterized protein	0.652	604-611	RIGSKIRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHS2	Uncharacterized protein	0.626	338-341	KGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y316	Uncharacterized protein	0.626	121-126	RKDRPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y316	Uncharacterized protein	0.621	302-304	RKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y3T3	Uncharacterized protein (Fragment)	0.641	186-192	HRHRVRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WHR0	Catabolite degradation	0.82	160-169	RKRRLRKAAL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WHR0	Catabolite degradation	0.605	589-590	RK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WIM2	Non-specific serine/threonine protein kinase	0.88	483-504	PRRKRPVGAIRKARNGSSENRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPX4	Uhrf1 protein	0.909	31-44	PKQKRQPKQAKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUY1	Uncharacterized protein	0.865	427-446	GSKKRKKLEFALKVWKWGKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDE8	Nwd2	0.973	373-427	KQKRRRRMERQEKEWERERQEWERQRQEWERERERERERERGREREREWKREREK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDM5	PEHE domain-containing protein	0.751	366-373	RRPAKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDM5	PEHE domain-containing protein	0.719	139-154	HKKFEAFEKRGRLREK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGK1	Mitochondrial translation initiation	0.709	221-229	RRHKSKGKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGK1	Mitochondrial translation initiation	0.632	262-266	KKSKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ69	Ck1 ck1 ck1-g protein kinase	0.63	345-351	RRERDRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRQ5	DRMBL domain-containing protein	0.922	869-893	RGRKRPRSRSPSGSFIPHRERPKWP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS22	Uncharacterized protein	0.853	283-312	RKPRVNTRKRLDKANKENMRVEGEGRRKGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVN4	FACT complex subunit	0.957	1047-1076	RLKKKKAAPANGKASTKTNGKVDGKAKGKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVN4	FACT complex subunit	0.663	1028-1035	KRAEAKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYY2	Vhs domain protein	0.975	172-206	AEKEAKRKAKQEKEERARQEEEERKRQKQRAKTKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YDP4	Reverse transcriptase	0.958	210-233	PKKDEKKDEKKREEPKKLSKEERF
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W6I6	CFEM domain-containing protein	0.77	143-163	KKKDKKCGHSSGSGGKDKKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WAG6	Uncharacterized protein	0.759	4-16	KKTRKPHGKPQWP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WX29	Uncharacterized protein	0.97	539-564	RAAREEPSTKEEPQRRRRGRPPKARP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2P1	Ubiquitin-like protein 3-like	0.735	166-171	KKKRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3V9	Epsin domain-containing protein	0.719	160-167	ERRKAKAN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X447	Hsp70 family chaperone lhs1	0.611	279-282	RKDR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y068	Cmgc ck2 protein kinase	0.898	72-82	KPVKKKKIKRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YA02	Condensin subunit cnd3	0.959	1002-1057	KRATKRMSRPSPTKQAPVSPVRKKRGQTAKVTTKTKRQLAPKKQATTKAPSRRSTR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W9E2	Fungal_trans domain-containing protein	0.928	710-722	RAKKGTKIKKRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X232	Rho guanine nucleotide exchange factor	0.987	763-781	KSGKEKKAAKKKGGERRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFW7	Macrophage erythroblast attacher isoform 1	0.683	58-64	KRKPSRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLG0	Vesicle-mediated transport protein	0.675	358-369	RRRRDSSTRRRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ59	Sir2 family histone deacetylase hst4	0.749	409-414	EKKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ59	Sir2 family histone deacetylase hst4	0.623	160-164	RPRLR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZR5	DNA-binding protein RAP1	0.961	298-309	KSKKKRKRPAPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y645	Uncharacterized protein	0.743	117-126	KRSKPPEKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y6V5	Uncharacterized protein	0.868	57-71	KNQKNTSKARSKRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W9C4	Uncharacterized protein	0.716	301-311	RKLTLAKKKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W9D2	Uncharacterized protein	0.737	408-416	KLKEERKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WB14	Retrotrans_gag domain-containing protein (Fragment)	0.934	185-201	KRDREKKKDHKPNGKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMV7	DUF262 domain-containing protein	0.706	289-294	GRKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMV7	DUF262 domain-containing protein	0.624	449-452	KKNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WS83	Mfs drug transporter	0.922	562-580	KALEELREKKKRGEKASRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDN6	Uncharacterized protein	0.805	127-138	RRRRNDARKRPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIB1	Uncharacterized protein	0.647	224-228	RPRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJX5	H/ACA ribonucleoprotein complex subunit CBF5	0.996	462-509	KAERKKRKKEEKKAAKEAAKEAAGEDEDEEARKERKRLKKEKKAKEKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJX5	H/ACA ribonucleoprotein complex subunit CBF5	0.925	436-445	EKEKKRKRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUZ0	Rrna processing protein enp2	0.989	463-500	RIRSKKQAIGVKVNKGLAEKILKDEEKAKKREERKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUZ0	Rrna processing protein enp2	0.869	30-42	RKRAASKGKGKRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XY02	CCHC-type domain-containing protein	0.634	171-173	KKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ51	Ring finger domain-containing protein	0.768	48-54	QKKRRKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXR8	Uncharacterized protein	0.824	526-537	KAKAKERPRPKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXR8	Uncharacterized protein	0.78	186-195	RARKRKAPAS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXR8	Uncharacterized protein	0.669	865-870	KSGKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXR8	Uncharacterized protein	0.656	202-206	SARKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXR8	Uncharacterized protein	0.645	605-610	KAKSRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYC6	Eukaryotic translation initiation factor sui1 family protein	0.781	363-377	AAKKAKKEEIAEKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZ64	Uncharacterized protein	0.803	66-78	REGKKDRRRVIAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3T7	Uncharacterized protein (Fragment)	0.861	122-135	EDKRRRKEEKESAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6F0	Nfx1-type zinc finger-containing protein 1	0.603	2255-2255	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6F0	Nfx1-type zinc finger-containing protein 1	0.602	2252-2252	R
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDK3	Putative lipase esterase from carbohydrate esterase family ce10	0.797	786-798	EKHRRRHLERAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF21	Ribosome production factor 1	0.982	12-53	KNKIKREEISNKNKKAKRQDKLQRRLGRAKFEASDPAIRKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLX4	Uncharacterized protein	0.995	356-396	KEKGKKEDVKKKSTTKKRKENTDKPEKEKTKKVKEKSAKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLX4	Uncharacterized protein	0.993	179-217	KEKWWTIGRGRKDSKEKEKQKEKEKEKVKARPDPPRSKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLX4	Uncharacterized protein	0.87	1759-1775	RPRNRARARGQGHRRRI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLX4	Uncharacterized protein	0.835	68-84	PPRRKLVPKKSKLGLLG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLX4	Uncharacterized protein	0.801	529-539	RRKEKESKRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLX4	Uncharacterized protein	0.716	2056-2066	RPRPRGRPTPA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLX4	Uncharacterized protein	0.616	1908-1910	RRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLX4	Uncharacterized protein	0.603	89-89	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQW9	SP-RING-type domain-containing protein	0.901	42-55	RARAKEKRSKGKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XR90	Uncharacterized protein	0.96	117-162	PKRRKEQRPRPTPIVEIPKRPGRTTRRRQTKDASPSKPSTSAFKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVT0	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	0.937	162-174	KKKKSKKQRQKEN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVT0	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	0.925	514-551	KPKQKQEKRAQGITRDLGKGKKEEGKTRSKMAVAERKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0T2	Heat shock transcription factor 4	0.873	135-148	KRRVPPRLPKPRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK34	Retrovirus-related pol polyprotein	0.999	239-257	GGRAGKKNKKKKRKGSKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPG6	HMG box domain-containing protein	0.788	157-172	TKAKGGTEKRKVREVG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPG6	HMG box domain-containing protein	0.698	261-274	RSSSSRNISRRAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPG6	HMG box domain-containing protein	0.609	256-257	SK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQP7	U3 snornp-associated protein cic1 utp30 family protein	0.982	314-375	AEKEKPKKKAKAQASEPKAPATAKAQLDSDKSKAKKRKEAEPPAPAPESKVDDASSKKKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQP7	U3 snornp-associated protein cic1 utp30 family protein	0.913	297-306	VKKGKKKRAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3E2	Gtp binding protein	0.878	202-218	RMHGPRLSGGKRRERRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3E2	Gtp binding protein	0.761	1022-1037	RGPAAGIGKGRPSRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3E2	Gtp binding protein	0.681	609-623	SPLRGRSSSPRLRPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5K7	Rho guanine nucleotide exchange factor gef2	0.841	706-715	SSKKRKQRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5K7	Rho guanine nucleotide exchange factor gef2	0.702	960-976	GRTSLSRAPSKRNSPRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8H3	Uncharacterized protein	0.745	263-270	NRLKKRRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAQ5	DUF262 domain-containing protein	0.844	27-36	RSKKRPRRQG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAQ5	DUF262 domain-containing protein	0.602	479-480	RR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCA4	Dual-specificity kinase	0.97	876-911	KDAQRAKDAEKEKARQEKEKEKEKQKKDDKDRSESR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCA4	Dual-specificity kinase	0.774	1607-1614	SKGRRRRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCA4	Dual-specificity kinase	0.699	918-923	GRKRGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCA4	Dual-specificity kinase	0.649	201-207	RPSARKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCA4	Dual-specificity kinase	0.636	224-229	KGKERR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XII7	Uncharacterized protein	0.88	333-342	SKRRKKEKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSY6	Uncharacterized protein	0.727	17-31	KPKALRMIKKANARK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YBD7	Uncharacterized protein c3orf19-like	0.898	295-313	KRKREIEERRKMVEAKRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YW46	DUF4604 domain-containing protein	0.998	137-189	KKPPKEKPSLSFSSAKASSGKSFKRKVLGGDSEDEKDKEKAKKPAKKKSKKKN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z234	Uncharacterized protein	0.665	534-540	LAKKIRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z234	Uncharacterized protein	0.619	421-424	ARPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WML6	Uncharacterized protein	0.943	408-424	ARAEARKERKKEKERVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRB4	Proteophosphoglycan ppg4	0.673	41-46	RRRRIG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WVU3	Ribosomal protein l12	0.763	87-97	EPPRDRKKEKN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXH3	Fanconi-associated nuclease	0.995	932-959	HNKKVRAEERVKKKAEKQVEKRKGKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3J4	Uncharacterized protein	0.931	714-742	PKLRRRVRRVEPMEPPRRSARLSGKSKRL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3J4	Uncharacterized protein	0.745	759-776	SKTRKKPVAQPTGPLRRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3W6	Uncharacterized protein	0.989	1411-1437	RLKKSAPKPPRPKPRPIPPKMMLKANK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6D7	Major facilitator superfamily	0.664	505-511	AKRRAQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6J7	BHLH domain-containing protein	0.829	155-168	KKANKKSGKKEEKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6J7	BHLH domain-containing protein	0.769	81-92	AKRGRKPGTMSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAP0	Uncharacterized protein	0.997	14-33	RSKRSKRSKRSKRSKRSRRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIH6	Uncharacterized protein	0.844	83-97	KERVKKYLKKRHRVE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLB0	AAA domain-containing protein	0.786	442-450	NRRRERRRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XM76	Uncharacterized protein	0.999	3-48	RIRKKTSKRGTTHERRRLQERIKESKRKKVKAAKKNPQWKSKHKKD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XM76	Uncharacterized protein	0.916	562-608	KRKRTDPVAHPPSKKVAFAKAGDRSLPKAAISKASKLKAPPKSAMKD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMJ3	Histone deacetylase complex protein	0.996	205-295	GGATAGPGPGHGRGGGHWRGDSSGAPRGGRGRGDRDTDRSERRIPPPRRGSPQRGDGGWGGRGGGGGGGGGGRVGRRGSRSRSRSPPRKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMJ3	Histone deacetylase complex protein	0.63	194-200	AREPRGG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSX5	Uncharacterized protein	0.996	34-129	PAKRGRGRPKGSRNKNTKTAGASASASTSSPAIPRKRGRPPKEKPTTGDGTEEPAPKRKRGRPPKNPKPADDADGGATKGDGEPKRRGRPPSSAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y845	Calpain catalytic domain-containing protein	0.825	7-20	WRRGRRGGRTHKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YPQ0	Uncharacterized protein	1	34-176	SRRSRSRSRSPIGVSRSSNRSRSRDMERGRRRRSQSPVRRDGGRSRSPKRRSRSRSRSRSPPSKRRWHSKSMSRSRSRSKERTWHKDRKRRRERSESISSVSSSGSERRRRRKKDKKRSKSKERERREKKERKREKKEKKKAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZ46	C3H1-type domain-containing protein	0.98	78-144	RRRSHSRSVEPRRGRSRDKDWSSGRQRTRSPTYPDRRGRSPVRSRERDRDGGRSKGRYRASSRPRRD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W8J8	HEME_HALOPEROXIDASE domain-containing protein	0.828	331-342	SKRKRLIRKAAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WFX8	Uncharacterized protein	0.904	425-448	ALAKPPRNKKTRSARWGRYERVLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSV0	CP-type G domain-containing protein	0.93	530-544	NRKNLKRDRKRERKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSV0	CP-type G domain-containing protein	0.823	5-27	KPKRATVPVKSKLKKDPGIPRLP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSV0	CP-type G domain-containing protein	0.623	500-503	KRQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXC8	Uncharacterized protein	0.795	153-161	HKKKKSHPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9V0	Aspartic peptidase a1	0.9	486-498	RRRRAKKNAKGKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBS5	Uncharacterized protein	0.997	2-36	RKKREGKKNSADKASGKKGKKLSASKGPAKRGKAP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBS5	Uncharacterized protein	0.961	75-95	KRSNTKKAGDRKKDKVSKRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBS5	Uncharacterized protein	0.815	116-127	KEWPKPKKIPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBS5	Uncharacterized protein	0.644	202-206	RRKHK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBS5	Uncharacterized protein	0.609	231-233	RSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNA5	Reverse transcriptase	0.915	4-19	RKKREPIKPKIARKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV52	Bromodomain and phd finger-containing protein 3	0.991	635-674	EKPPPPPPPPRPRKASKAKHDRSEYNARRREQRAAAKAER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV52	Bromodomain and phd finger-containing protein 3	0.727	915-926	RPRRERKQTAKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV52	Bromodomain and phd finger-containing protein 3	0.706	876-885	REKNNRRKAE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV52	Bromodomain and phd finger-containing protein 3	0.681	770-775	PPKKRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y6U1	Uncharacterized protein	0.718	636-645	RSRAKGKERR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YFI1	G-patch domain-containing protein	0.847	341-352	RKRKEKHGRGYR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YFI1	G-patch domain-containing protein	0.649	215-218	PKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WAV1	Uncharacterized protein	0.907	1407-1443	PPKDERRGRTQARPSSPSRDRGRSVGRSAARRSQPRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WAV1	Uncharacterized protein	0.896	54-73	RKKTSTRRSDTARKRKSKPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WAV1	Uncharacterized protein	0.629	520-525	RLRSRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WHD7	Uncharacterized protein	0.938	152-166	RAKRTRGRKGKPVRL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WLG0	Uncharacterized protein	0.988	189-209	PKKKAGKKTGKKMGKKTQGKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMF3	Chromo domain-containing protein	0.638	252-257	KRHKLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPT9	Retroelement pol polyprotein	0.996	218-237	GRAGKRNKKKGKGSKGKEKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRP8	60s ribosomal protein l2	0.976	185-204	RKLRAGKGKMRNRRHRQRRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRP8	60s ribosomal protein l2	0.909	342-354	KQERQKKKGPKKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X313	Endoplasmic reticulum protein	0.851	496-510	KRPGHKRGLSWRRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3F3	Uncharacterized protein	0.997	674-936	ERAREEAKRQAEEARLEELRKREEEIRRREELERARQEEEERERRAKQREEEARKKEEKAKRLAEEARRKEAEARKKEADARRREKEIRMREEELRRREEELIRREREDEERRKEEELAKRLEEEARQQEEATRKREEELKRREEEARRREEMLREREEFRRREEEARRREEEARRREEELRRREEEAKRREEEEMRRRQEEERRLREEEERRFREEAEAEKRHQEEEEARRKEEEKQQAEARRLEAAKRRREQREKEEARKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3F3	Uncharacterized protein	0.936	554-570	RRRYARRRRSPSPKPPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3F3	Uncharacterized protein	0.833	637-661	RRNRRMEEERRKRQQMEEERRRREE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3F3	Uncharacterized protein	0.828	987-1005	GEEKKRREEEKVREEQRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5A3	Ser thr protein phosphatase	0.999	497-527	DKDKEKEKAERKREKKKEKREKEKEREKEKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5A3	Ser thr protein phosphatase	0.725	550-558	PKSPRPKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7E9	Membrane protein	0.67	384-388	KRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEK5	Plasma membrane fusion protein PRM1	0.731	643-648	KRRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLQ6	Uncharacterized protein	0.962	86-107	RNPHIRRQRRRKLPIKPLPKPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVT1	Homeobox domain-containing protein	0.718	254-259	KKKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y6J5	Gata zinc finger domain-containing protein	0.946	385-408	RGKDRPLSLRRNKIKPRTKHAAKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y9T8	Gc-rich sequence dna-binding factor-like protein	0.685	232-242	KKSRKAEATKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y9T8	Gc-rich sequence dna-binding factor-like protein	0.642	45-50	KTKRNG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKX1	Histone acetyltransferase	0.945	79-89	KPVKRKKKPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKX1	Histone acetyltransferase	0.943	238-249	KPPKRPRGRPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKX1	Histone acetyltransferase	0.817	940-948	KRGRGRPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKX1	Histone acetyltransferase	0.757	694-707	KFPRGRKNGVARRH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKX1	Histone acetyltransferase	0.733	269-277	PRRGRPPKN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKX1	Histone acetyltransferase	0.655	327-336	RLAPQKGKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKX1	Histone acetyltransferase	0.653	984-992	KKSASPRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0B9	Rnp-1 like rna-binding protein	0.999	153-172	AAKPKKKKKKPSRKAKKARV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0B9	Rnp-1 like rna-binding protein	0.998	104-126	EQKDKEKKERKPKRRPGRRGSKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0B9	Rnp-1 like rna-binding protein	0.83	190-203	ESRPRKARAVRPPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W3D1	Uncharacterized protein	0.842	429-449	KGKMKARCKQLLKRNKMRKNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W3D1	Uncharacterized protein	0.793	111-132	ERKKKPDIYELLKPKAPKKAFK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W3D1	Uncharacterized protein	0.687	409-418	GKWDGKNKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPI4	Uncharacterized protein	0.815	213-221	PTSKRKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WS41	Uncharacterized protein	0.974	256-283	KKHKSPKKPHKHDKEPKQDQESKKPKNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WV57	Uncharacterized protein	0.816	513-522	KVDKRKRSKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXM5	Uncharacterized protein	0.898	437-452	RHEKLRRKQQRRKDRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZW8	Uncharacterized protein (Fragment)	0.996	650-681	KKKAAQKAKKKQGGPAPRKASATAKRKSTTKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4S9	Uncharacterized protein	0.97	558-573	EPRPRKKRPAVRKGWK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCX6	Uncharacterized protein	0.864	20-34	KRSLRWRRMKIRRRL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFR8	Uncharacterized protein	0.971	185-206	RKERKERRLAKLRRRYPRPLSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFR8	Uncharacterized protein	0.927	103-113	LRTKRARKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFR8	Uncharacterized protein	0.753	251-258	IRGKRRRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNI5	RING-type domain-containing protein	0.844	325-352	KRKFLRKRHGTKFDEASTRSSKRLKTRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XP26	Snf2 family helicase atpase	0.998	253-312	RRTRMKPLPPKTRPMPGDASSKEAPKKPEPKKPQTRNIKGNGRGRGRGRGRGRGRGGRNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQI2	Cytochrome oxidase biogenesis protein (Oxa1 mitochondrial)	0.616	447-454	RREGPFKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW17	40s ribosomal protein s23	0.691	12-31	ARKLRNDRRENRWADKAYKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YAF1	Double-strand break repair protein	0.992	605-635	PPSKKKAPAKKAPAKSTTTKAKAAPKKRGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YAF1	Double-strand break repair protein	0.872	663-686	KRTNRAAVLSQPAKKAAPAKKKTA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YAF1	Double-strand break repair protein	0.782	560-570	SAKAKGKSKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YJI1	Uncharacterized protein	0.988	683-698	DKKKKKTKGRGRGKDK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWD2	Aaa family protein	0.991	363-396	KQKKKDKGKQAGSKGIKRPRVLRAVQKQTRKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W3G0	Actin cytoskeleton-regulatory complex protein PAN1	0.998	546-634	EEKAKAAEKEAAEREAARRERLERERAAKEGKTSPAPSTPPSTAKTAPPPAPAPKSAPPPPKPKAAPPPPKPRGAPRPPPPKAPAPAPA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W3G0	Actin cytoskeleton-regulatory complex protein PAN1	0.932	1247-1261	KPPVRRRSKRRPPPA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W3G0	Actin cytoskeleton-regulatory complex protein PAN1	0.907	345-369	HEKLPEVERKIKARDERREREKRQW
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W3G0	Actin cytoskeleton-regulatory complex protein PAN1	0.611	1727-1728	RR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKI0	Uncharacterized protein	0.995	34-65	KTHKKKREGDTTAAAVGSKKKRKHKAKKNSSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2Q5	Forkhead box d1	0.817	197-209	KRERKRGTKSGRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5E8	Rrna processing protein	0.998	841-875	RKGAGGSGKGKGGKGGKGGGSKRPGKSKRMAARSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5E8	Rrna processing protein	0.987	720-769	RAGIKKAEEKRKERENKKFGKQVQIEKLKERERSKKEMEERLKGLKRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5E8	Rrna processing protein	0.985	793-826	KRPAKRLRPEGGKKISRQARDKKFGFSSRGRRAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5E8	Rrna processing protein	0.965	455-479	AKPPKGKSPAKKGDEKNKKSTLKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5E8	Rrna processing protein	0.954	406-436	RKRRRIIRPPNRFEVPESSGKKRMPKHRPRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9C8	Ccaat-box-binding transcription factor	0.995	551-586	DKKGKAKEVPLDRKGRAMDGKRGAKTKGKKKGNASK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9C8	Ccaat-box-binding transcription factor	0.99	91-135	RSDKQSEKEKKGEKKLDRTTPREDEKQTSVERPAKEKKGKKGKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9C8	Ccaat-box-binding transcription factor	0.989	1087-1103	KKRKRKDERAVKRKKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9C8	Ccaat-box-binding transcription factor	0.835	5-28	RKEKGGRTRTAPKLASDGKKQPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9C8	Ccaat-box-binding transcription factor	0.763	909-923	RKREREQAKIKSAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCX9	40S ribosomal protein S8	0.947	8-42	RHKRSASGAQRAHYRKKRKFELGRQPANTRLGAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHM8	Uncharacterized protein	0.984	235-320	RGEAKWEGEERRMRKTEMREREHREQERRRLEEAQTRRAAEEAERRRQAEREAEVLRRRQARKREEENERKRVEEEKRRERILADR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHM8	Uncharacterized protein	0.751	28-34	RRKRKPT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRU3	Pol ii transcription elongation factor	0.96	1018-1028	PKKKRKGKLRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRU3	Pol ii transcription elongation factor	0.922	990-1003	KEKERKPRRSRKVR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRU3	Pol ii transcription elongation factor	0.889	1052-1061	KPTKKRPKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSM3	Uncharacterized protein	0.985	38-50	NKKSSKKRKRKGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTX6	Atp-dependent rrna helicase spb4	0.998	533-587	KRKATLSSKPSEGAAKPNKKTESKKANVPWSRKSAQKEEREKRKQKKASKKKWLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y4T8	Mrna-decapping enzyme subunit 2	0.937	257-272	RKPRNIPRKPPKSKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y972	Uncharacterized protein	0.603	231-232	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YHB5	Uncharacterized protein	0.84	193-203	RRQRRNEKRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YNL9	Uncharacterized protein	0.938	62-96	KKERKDHEKMRDSTARKLAARISGKKEKFEAKKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKY8	RNA-dependent RNA polymerase (Fragment)	0.659	45-48	KKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMP7	Atp-dependent rna helicase dhx8 (Fragment)	0.992	138-179	KKRPSELERSPKRQRTERSPPRRRSPSPPRGGRGYDDRRGRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQG4	Uncharacterized protein	0.995	222-244	PRKERADAHQKRGPKKKSSKKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQG4	Uncharacterized protein	0.627	445-453	RRVARVHRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WV11	Uncharacterized protein	0.986	721-736	RFPKRGGKKGGKKGRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XC11	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.935	671-695	ERQKKSKDKDKDKDRKKSSQSSAER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XC11	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.892	408-417	KGNKKKKGKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIW5	Uncharacterized protein (Fragment)	0.658	12-16	KKKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQ75	Uncharacterized protein	0.952	115-133	KPKSKKKQKAKLAAKSSSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS38	U4 tri-snrnp-associated protein 1	0.973	273-286	KKFKSKKKRPSRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS38	U4 tri-snrnp-associated protein 1	0.925	597-622	HKFHGKGSGKMKTEKRLKKIEDEKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS38	U4 tri-snrnp-associated protein 1	0.89	674-688	KGKTEKMKKKKETKN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS38	U4 tri-snrnp-associated protein 1	0.876	95-108	KRSKKREKELAKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS38	U4 tri-snrnp-associated protein 1	0.871	325-336	RSRRAKIKKPKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS38	U4 tri-snrnp-associated protein 1	0.771	762-778	KRKAGEEPAGSPPSKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS38	U4 tri-snrnp-associated protein 1	0.721	50-68	AKERESKRIADRIAKVRNR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS96	Uncharacterized protein (Fragment)	0.768	40-49	QPKKQRSRKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWY7	DNA-binding protein RAP1	0.726	363-371	HRHRGKEKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y572	Mitochondrial import receptor subunit tom20	0.723	39-47	KNLRKQKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WKS5	Gag-pol polyprotein	0.973	318-335	GKKNNKKKSNKRGEGKKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WW71	Myb_DNA-bind_2 domain-containing protein	0.971	117-162	PQKPTKSAIEVQKKRKRPSDEDAKVEKRAKIPESKGKEVTRKKPEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WW71	Myb_DNA-bind_2 domain-containing protein	0.7	1127-1135	REKRRASAG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2I1	Uncharacterized protein	0.833	143-158	RERRRSERAARKSPPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2I1	Uncharacterized protein	0.655	219-224	KRKDKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCL0	Rho GTPase activation protein	0.657	95-103	SSRLPRPRQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEB3	F-box domain-containing protein	0.96	50-74	PPAKKSKSQKPPLARPRARTGRRTR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEB3	F-box domain-containing protein	0.63	35-37	RKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XH96	Uncharacterized protein	0.893	171-188	KPRRFQMARDKKKRFEKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XH96	Uncharacterized protein	0.801	105-114	KKEKKEKRAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJN3	Uncharacterized protein	0.973	208-313	ERREREKDRGRDRDRIRDRDREVEKAEGRDRERERDARARERLREDPQARVKERDAMEKERDRAKDRDQDRGRERDKEKTYRDRDRDRELERREKTDRERAKMRET
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJN3	Uncharacterized protein	0.759	710-718	GHRSRRKHR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJN3	Uncharacterized protein	0.629	356-363	RPRGQSRH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XL20	Uncharacterized protein	0.999	265-278	SKKKRKRRKRKKNK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XL20	Uncharacterized protein	0.777	121-127	IKKKKRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XL20	Uncharacterized protein	0.639	101-104	KKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNF6	PAPA-1 domain-containing protein	0.975	201-251	TARKRKNLSEKKLEDEKLETINRLLKKQSKPRAKKGAATGTRGGKVSRGGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXF2	Histone deacetylase sin3 component	0.994	1270-1288	NKPAKSSSRRRRRRRRPPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXF2	Histone deacetylase sin3 component	0.989	341-383	PPKKAAQVPKRKKRVEKEPTPVPPAKAVAPSRQTKRPKHSHKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXF2	Histone deacetylase sin3 component	0.971	1475-1496	MRKMRDVEQKMKRKKARRTKEE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXF2	Histone deacetylase sin3 component	0.938	1503-1536	EKQAKSKKKIWARATARWKANAHYTAWKRRGKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y689	Uncharacterized protein	0.701	68-77	KLRAEEKKKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y689	Uncharacterized protein	0.626	133-140	KPLKQKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YVH0	Wd repeat-containing protein 46	0.999	539-602	GKKKSREEREKRKMRGKGKSLKRYLRKQRKNVIDPAAVAIRAKLEKQKEERKREILKKKAIAAG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YVH0	Wd repeat-containing protein 46	0.633	16-19	KKHK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WFR6	Chromo domain-containing protein	0.995	574-617	KSSSAAPVSRRKAAREGRVKKEGETPASAGKKRKHPEGSRKRIK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMS3	Elys protein	0.94	791-813	TKKASTRSSRASEAGTKGGRRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXC4	Dna repair protein rad8 (Fragment)	0.933	1508-1524	PKKKTKPTKLAKPIKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXC4	Dna repair protein rad8 (Fragment)	0.915	1542-1567	KSKITKKGTKRKGPEDDDRPAKKQKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXC4	Dna repair protein rad8 (Fragment)	0.886	1452-1474	SRKRTSKVKPAAHQKPSIRRRSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WXC4	Dna repair protein rad8 (Fragment)	0.786	1348-1375	KRLKGKSYHEAAEKHEAEKKPEKPAPTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYR7	Uncharacterized protein	0.998	326-361	REAKAALKAAKREAKQDKKKARIARRERKLERKRLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X1D7	Macrophage erythroblast attacher isoform 1	0.633	51-55	RKPNR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X2H7	Siderophore transcription factor	0.93	236-256	RPGKKSRKGSKSDGRPTLKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XC10	Uncharacterized protein	0.999	87-130	KAGGLKKRKRGTAKKPRKPRAPQPSGTGGKSSSKRRKTGASKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCI8	Uncharacterized protein	0.959	515-529	RTHRKRAEKRRRAKC
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCR1	EF-hand domain-containing protein	0.803	601-610	RARKSKGRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRM6	Magnesium transporter	0.862	349-380	KLAKIRKVGLSRNPGSRQPRKPWLPLPLRRRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ22	U3 snornp-associated protein rrp5	0.958	79-101	KKSKKSKRKSEGNAAGSGPRDKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ22	U3 snornp-associated protein rrp5	0.934	1173-1180	SKKKKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZI2	Uncharacterized protein	0.949	211-221	RKRRRRSRAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YFJ8	Antiviral protein	0.666	1774-1785	PRPKPQARTIPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YY96	Lysophospholipase	0.81	631-641	KKRRERERAKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W4L7	Uncharacterized protein	0.609	221-224	KGER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WEI2	Uncharacterized protein	0.781	867-873	RKRKRGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WEI2	Uncharacterized protein	0.694	723-735	KQSGKEEKDKKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WJJ0	Atp-dependent rna helicase dhx8 (Fragment)	0.993	101-141	RPSELERSPKRQRTERSPPRRRSPSPPRGGRGHDDRRGRSS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMI1	CCHC-type domain-containing protein	0.609	6-7	KR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWS9	Protein fam63a-like	0.978	399-418	RNRRRLAEEERQRKKKGKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAS8	GATA-type domain-containing protein	0.972	163-174	GRKRRLRKRKGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAS8	GATA-type domain-containing protein	0.687	52-57	NGRKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAZ4	A g-specific adenine dna glycosylase	0.903	35-49	RRHASKVTKRKKQRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCG2	Wd repeat containing protein pop1	0.638	752-755	RRRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCZ6	HECT-type E3 ubiquitin transferase	0.829	2833-2844	KRAASKKGKGKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDR7	Uncharacterized protein	0.703	95-102	QRKSLKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ96	Uncharacterized protein	0.745	324-338	GVERERAEREEKRRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVP6	C3H1-type domain-containing protein	0.791	368-379	GRSRSRDPKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YAQ0	Uncharacterized protein	0.975	541-565	RKLLSFKKKRKWAAHRKPSQGQKSA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0I5	Uncharacterized protein	0.997	85-128	GPRGSRREEWRLSKGLSARPKSKGMNRQGGVAARRKAGRSKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0I5	Uncharacterized protein	0.793	6-18	RSKAKRDFRSKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WNU8	Uncharacterized protein	0.785	421-431	RRRHRRGTGRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUT6	Uncharacterized protein	0.758	157-166	KDVKGKAKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WUT6	Uncharacterized protein	0.742	1154-1164	KRSRSKSPKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WVN4	Uncharacterized protein	0.708	334-339	KKREKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWJ6	WW domain-containing protein	0.989	229-254	GKKRKRPSKKDVERFKEQKRQKKIAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3L3	Transcription initiation factor IIE subunit beta	0.975	252-270	PKAPTGKKKGKRGGAPRQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X674	60s ribosomal protein l27	0.905	50-69	PRKVTKRMGQKKLARRSKVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6R3	Serine/threonine-protein phosphatase	0.917	316-330	PVTPPRKQKKKEGKM
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9H1	F-box domain-containing protein	0.973	238-252	SAAKGKGRGRGKVRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9H1	F-box domain-containing protein	0.832	14-23	PPTRKKRKMK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGT7	Ccch zinc finger and rrm domain-containing protein	0.764	379-392	GGGRGRGKPGSFRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGT7	Ccch zinc finger and rrm domain-containing protein	0.707	646-663	GRARGFHRGGFRGGPPRT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGY7	Dna repair protein rad14	0.987	255-281	RVAEKKKKKNRKFEEGLKDLRRRTKEG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XH01	Werner syndrome atp-dependent helicase-like	0.988	351-391	PAKPKKEKEEDGDKDEKEMSKNKAKKEAKKAEHAAKRERER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XH01	Werner syndrome atp-dependent helicase-like	0.698	439-447	RGGNRRRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJU5	Uncharacterized protein	0.921	153-161	KPKSKKKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJU5	Uncharacterized protein	0.74	213-220	VKKPKSRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU86	60s ribosomal protein l33	0.653	16-20	KRGKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YT83	Cmp dcmp deaminase family	0.978	77-88	KGRKRQKKRRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WK55	CCHC-type domain-containing protein	0.833	274-289	KKDERKKEEPKKMTRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WW10	Uncharacterized protein	0.688	74-78	SRKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYD3	Zn(2)-C6 fungal-type domain-containing protein	0.975	79-114	PKRRGPDKRPGTRQRSCKKRPADGSAPPPPKRKKTD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEP6	F-box domain-containing protein	0.709	932-941	KRRKDSLKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF55	Snare binding protein sec1	0.789	747-753	EKKKKKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSI5	DNA helicase	0.982	673-692	PKRQRRKKRKLNTGGVARRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YN82	Uncharacterized protein	0.935	124-141	AHERRKKEKELKKNVAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YT91	Uncharacterized protein	0.782	6-16	KAKLKRKSSRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YYQ9	60S ribosomal export protein NMD3	0.949	415-432	PNRRKKNKPRNWKLRSIG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0D6	Uncharacterized protein	0.93	760-771	AKKTKKKRKWWR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4C6	Uncharacterized protein	0.959	64-84	NKKRKNTKKDPEHEKRRAEKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4C6	Uncharacterized protein	0.908	1111-1127	DSKKKVEKKTEKKPEKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4C6	Uncharacterized protein	0.796	986-999	KAKEKESAKKAKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4C6	Uncharacterized protein	0.617	601-604	QKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4C6	Uncharacterized protein	0.609	597-597	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDC8	Pathway-specific nitrogen regulator	0.94	106-126	SGRRRKRTRREMEEAEKEKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJJ5	Duf159 domain protein	0.992	313-341	KKVKKEKAPDSPSKKQKSKSPAKPKKQPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJJ5	Duf159 domain protein	0.842	263-281	PQPKASPIPKASSGKRKRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQR9	Uncharacterized protein	0.684	282-289	RRGRGARR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT89	Uncharacterized protein	0.805	314-326	RGRRGSPRRPPAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVS6	Cgi-48 family protein	0.663	118-125	LKKTARKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WR16	Vacuolar protein-sorting protein bro1	0.963	676-699	GRGPGARKWEEREKRKKTAIRRFQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSZ8	Uncharacterized protein	0.876	183-192	KVRRRHRRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X309	Gag-pol polyprotein (Fragment)	0.999	16-41	PGGGRAGKKNKKKKGKGSKSKEKEKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCN6	Zn(2)-C6 fungal-type domain-containing protein	0.782	57-69	KKKRGPRQGSSKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEW6	Uncharacterized protein	0.985	560-614	RLQREREAIRRRLAANREKRRSSGRVSVGRVGAGGPRKSGLKLQKAPPKPAPANK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEW6	Uncharacterized protein	0.779	978-1008	GGPAPRKSGVGARRSHVGVAGGGRREARESA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEW6	Uncharacterized protein	0.706	1012-1018	SAKKRAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFE3	BZIP domain-containing protein	0.86	11-28	PERSRNAKAQARHRAKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUK4	DASH complex subunit DAM1	0.953	168-188	PAKKVVKGKKPKMTAKERKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y4B6	Uncharacterized protein	0.602	235-235	K
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YAG0	Uncharacterized protein	0.952	278-309	ARKPRVNPRKKLDKENRENLKVERESRRKGRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0A5	Srf-type transcription factor	0.893	159-190	HKRKRSRSRSSSLSLSRSRSSSPARSPRRGAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0A5	Srf-type transcription factor	0.679	486-494	KRGGGRTRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0A5	Srf-type transcription factor	0.606	122-123	RK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6C2	Uncharacterized protein	0.96	154-164	GRKKKGKKKNA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6C2	Uncharacterized protein	0.74	27-37	KKKSKAYKERR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X764	Uncharacterized protein	0.996	148-206	KKKEKAPKAAPEESATPAEAPKEKEDKQQEKKDKKEKKEKAAAPQDAGKKGAEKKGGKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDR8	Uncharacterized protein	0.881	42-53	RARREARRRRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDX4	Uncharacterized protein	0.754	135-161	RRREMERRKEAARTELDKLKMIKESHK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPK7	Retrotransposon ty3-gypsy subclass (Fragment)	0.997	28-47	KKNKKHKKLSKKRRESKRKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPK7	Retrotransposon ty3-gypsy subclass (Fragment)	0.99	118-144	SKRKKHKQKSYRESSREKKRAKRIIKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPK7	Retrotransposon ty3-gypsy subclass (Fragment)	0.748	907-919	QKRWREKIERRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTV7	Uncharacterized protein	0.999	583-604	RREREEATNPKKKKKKKGKKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUJ0	Phospholipid-transporting ATPase	0.97	1391-1425	GKKGKASSSPGGGHSSRMFSLKRGFKKKKPHSPPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUZ7	Cohesin-associated protein pds5	0.995	1212-1240	RGARGRAKAKAKRKAQTKTKVQKAKEKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUZ7	Cohesin-associated protein pds5	0.994	1135-1165	KEKRERKAPKRRAPAATSNGQAKRSRKRKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVZ1	Uncharacterized protein	0.759	61-78	SKRKGEPSHESERPKRPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYS8	Uncharacterized protein	0.629	163-166	KRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKR6	Uncharacterized protein	0.686	288-298	WGRRNKLGHKF
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKR6	Uncharacterized protein	0.633	972-982	QRKTTSKSPRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WN54	Amidohydrolase	0.725	221-232	KRRRLIREGRAG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE81	Uncharacterized protein	0.996	577-614	SGRVPLKKRSRTRDFMKKLGIRGRKERSHAKKRRGIGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XE81	Uncharacterized protein	0.777	414-425	KNKLKREVRRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTM6	Exosome complex protein	0.998	257-271	AKKKKKARKKKNKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU93	Histone acetylation-related protein	0.988	108-143	AKGSKKRKASPEPSDASQPPKKKAKPAPKVTKGRVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU93	Histone acetylation-related protein	0.987	206-229	KRETKAEKKEKREKEKAEKKRQQE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XU93	Histone acetylation-related protein	0.878	239-258	PNAKKSSGAAAAKKAAKKAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW93	C6 finger domain	0.904	8-31	KKKRASPSETKPPAEGDHRKRRRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYJ2	U4 u6 small nuclear ribonucleoprotein prp31	0.992	394-411	PNDGPKKRRGGKRARKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y6K3	HMG box domain-containing protein	0.977	205-223	RVRDKDGKARNKKHKPRKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YU57	Pro-pol protein	0.754	27-36	RKPKRSFRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YU57	Pro-pol protein	0.696	80-89	DEKKREEPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXI8	Uncharacterized protein	0.953	549-568	QNRKHGKLKRAREKVVKGKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXI8	Uncharacterized protein	0.772	61-69	TTKRAKRKL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXI8	Uncharacterized protein	0.768	623-633	TSKKSRAKNPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YXI8	Uncharacterized protein	0.661	949-954	SKGKGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1K8	G-patch domain-containing protein	0.99	357-385	DIRKARRKEKETREKRSDIWKKPKKVKTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1K8	G-patch domain-containing protein	0.959	46-55	KRKRRKKGGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1K8	G-patch domain-containing protein	0.646	76-83	GGKTGKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1R8	Pre-rrna-processing protein esf1	0.996	559-573	KAERKKKGRKREKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1R8	Pre-rrna-processing protein esf1	0.974	480-493	RKLREKRKKRKEES
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1R8	Pre-rrna-processing protein esf1	0.728	14-21	RFRRPKKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1R8	Pre-rrna-processing protein esf1	0.618	664-667	RGKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	F2WVM9	Ribosomal protein S3	0.836	276-285	KKRVRKRLRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7Q9	Uncharacterized protein	0.771	91-104	TRRKLEGRPRSVKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X871	Uncharacterized protein	0.967	47-63	RRRRRGGRGGTKFKKRE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRX8	Cell division control protein	0.809	900-913	RGKSRRTKDKGKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS27	Uncharacterized protein	0.713	80-90	KPRRSRLKAVR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XX77	Zn(2)-C6 fungal-type domain-containing protein	0.635	60-62	KKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPE1	Uncharacterized protein	0.905	352-379	KLKGKDKVKRLIKRASMVFSKGGKGLKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQ82	HMG(Highmobilitygroup)box domain-containing protein	0.996	128-167	EEKRKHKEKHPGYKYRPVAVGVRARPKSRGRPKISPKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WZG4	Elongation factor 3	0.985	1026-1051	NKKAKKLTSSEARKLKKERMARKKRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0E3	Uncharacterized protein	0.952	78-103	SNRRIDKPGASRKTAKSNKKSSKRAG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3E8	C2h2 conidiation transcription factor	0.718	216-221	KRRRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7R8	Trna guanine-n1-methyltransferase	0.998	567-589	KRAVRKRKAILKRRKRARERARG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7R8	Trna guanine-n1-methyltransferase	0.985	423-458	KRDKEKAIVSPREKDKERGRKRNRAAPPSVPPTPEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7R8	Trna guanine-n1-methyltransferase	0.981	480-491	GGGGKKKKKKRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7R8	Trna guanine-n1-methyltransferase	0.654	354-359	RRSKRD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X963	Regulation of carbohydrate metabolism-related protein	0.869	876-895	RDRDRPQRSSSRGRERKERK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X963	Regulation of carbohydrate metabolism-related protein	0.868	418-434	SGKRRKPLPTHISRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9Z5	Phd finger domain-containing protein	0.998	277-348	RERPKPPRPVNKGKRKRGAAAQGTTRKAKKTKSSRTTATKAKAKGNSNGRTKAKEEPPTPGRRTGGRAAKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9Z5	Phd finger domain-containing protein	0.981	574-636	HRKRSSRIAMKESEKEEARLAAQRKAEEEEKMGRARRAEARQKKEESERMKRETAREQRRKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLJ4	Brct domain protein	0.86	871-894	VKKKTSNGNIKGKAAGRGPLVRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLJ4	Brct domain protein	0.784	953-963	RSKRPRGTRAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLJ4	Brct domain protein	0.676	1042-1051	KRTGGRKSTR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMP4	Uncharacterized protein	0.997	317-352	DKKELRKLRWQRRGGEARLERKFRRKARKAEKQRAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMP4	Uncharacterized protein	0.611	267-268	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMZ2	Protection of telomeres protein 1	0.953	281-298	APPLPPKKLSKKERKKLR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPF6	1-alkyl-2-acetylglycerophosphocholine esterase	0.786	421-430	RRKDGRPKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XRP6	Uncharacterized protein	0.88	82-91	PKPPPRKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW04	Uncharacterized protein	0.64	98-102	RRHRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW65	Dna helicase	0.954	347-378	SKKKVGGGKSGSGGRDKGTTKPRGAERKRMWE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XW65	Dna helicase	0.862	476-484	KKKKKKEVT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXD0	Proliferating cell nuclear antigen	0.998	267-296	GKKRKKKSSGGKAAKKPKTVNGKSAKSKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXD0	Proliferating cell nuclear antigen	0.964	214-230	KTKKEKREEKKVKKEKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ54	Histone acetyltransferase	0.772	416-422	RRRKKHK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ54	Histone acetyltransferase	0.716	72-78	TSRKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YYU4	Nitrogen permease reactivator protein	0.616	52-55	RRDK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W4Z7	Chromo domain-containing protein	0.713	141-148	KLKRKNKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W4Z7	Chromo domain-containing protein	0.659	35-41	KERSRRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQX1	Gtp binding protein	0.996	1108-1170	QLERRKEKKAEKRAKYQKEVEKEAAKKGEKEKEKKKEYMRIAGQKNKRQADLEEGRSSKRRKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQX1	Gtp binding protein	0.987	6-52	HKPHRLAHSGSKAEKKDKGKGKERQHGFNEKAFAPKSGRKADRQGRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQX1	Gtp binding protein	0.604	323-324	RK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6P1	Uncharacterized protein	0.734	369-386	RKAKIQRESKKSQSRTPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8H8	Duf803 domain membrane protein	0.609	625-628	RTPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X8X4	Smr domain-containing protein	0.985	190-208	NRKTKKKNTAEKKKSKPKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAK2	1-phosphatidylinositol-3-phosphate 5-kinase	0.832	1626-1727	RPSPEKRSTSGKLRSRPSSPPDIKLPSATPLKQSKVKISARSKDKTPAHHATPASRSAFRRPPPGTGGKVSNIAKHFERLGRDAERSKNRYNVIRGRRARPV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJS5	Uncharacterized protein	0.801	11-24	AKKKAKPSATNKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XPM3	CCHC-type domain-containing protein	0.68	223-234	PKRFRIADEKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWF3	Uncharacterized protein	0.783	535-544	SSKYRKRKPN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWF3	Uncharacterized protein	0.652	387-390	RKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y0L7	CCHC-type domain-containing protein	0.78	228-241	RKKRELIKPKITRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YI74	Uncharacterized protein	0.892	382-396	KSKKSSRSKKSGRAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W8K8	CCHC-type domain-containing protein (Fragment)	0.674	278-289	ERKQEEPKKLTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQ76	Uncharacterized protein	0.762	257-263	KRRRKGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYV4	Uncharacterized protein	0.909	73-87	RRRERPPRKHRGDRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6J3	Fungal specific transcription	0.714	315-325	KKEKHKTPREK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6J3	Fungal specific transcription	0.688	153-157	KKRRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X6J3	Fungal specific transcription	0.684	1170-1176	KKSKKPP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7X6	Uncharacterized protein	0.868	857-870	SRKKSGGGGRKKEP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X840	Chromo domain-containing protein	0.908	542-549	GVKRRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X840	Chromo domain-containing protein	0.817	76-82	RKRKPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD31	Fermentation associated protein	0.645	338-341	PKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEG1	Transaldolase	0.771	474-485	WKKQRSPRKDRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFV0	U3 small nucleolar rna-associated protein 11	0.821	304-332	GGRNKKRTKVVDEKTYKPRVYKWRLERKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFV0	U3 small nucleolar rna-associated protein 11	0.721	276-283	GARKKIRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHL8	Nucleus protein	0.991	462-475	KAPQKKRKKKKGSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVI5	Phosphoinositide phospholipase C	0.97	506-524	IKHKLAAKSHRKKAEKKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YS63	Chromatin-associated protein swi6	0.928	109-146	RATSSKKRKREQIIPSESTNSRPERSRTRKRTRKTSHK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWH5	Rna-binding protein	0.852	202-220	GHRKAKQLEKELKKNRHKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWH5	Rna-binding protein	0.742	80-92	GSGGKLAKGGKRT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0L8	Kinesin-like protein	0.986	894-970	PSSPGKRAPSTPRGASKSRRRSNIGPVRAEKGRRRSSMIPQLSPPNGEGSKPRRVLLGTPAKRSKRLSLSRPAPIPM
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0L8	Kinesin-like protein	0.804	700-713	PRRHKSPRKSLRSS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z0L8	Kinesin-like protein	0.618	725-728	KEKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z338	Protein-tyrosine-phosphatase	0.683	524-529	KPKRRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WU07	CCHC-type domain-containing protein	0.617	38-39	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WYB4	Uncharacterized protein	0.664	166-170	ARKKM
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XCE1	HMG-box	0.766	166-176	RNKPKVARRKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XER3	Hmg box transcriptional regulator	0.926	148-172	PRKRSGVKKGTRPSSRRQESRSRHN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFP8	Dna repair protein rad5	0.937	652-662	PKAKSGKKRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFP8	Dna repair protein rad5	0.931	1017-1031	SAKKKTQKREKRPKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XFP8	Dna repair protein rad5	0.765	929-938	KRPRKTKNPS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XJ41	Uncharacterized protein	0.987	488-512	ERQRREKDRRRKLKRELAETKERKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XME0	Forkhead box protein i1	0.978	117-133	RQRRARREKRQRKGKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XME0	Forkhead box protein i1	0.921	437-464	GGKRARKVEDGEGSVGPKTKRAKKDKGP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XME0	Forkhead box protein i1	0.617	674-679	KNAKQK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQZ8	Gag-pol polyprotein	0.998	207-227	GGRAGKKNKKKGKGGKGKEKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS11	Uncharacterized protein	0.997	585-624	HKREGSEHKSSSKLEKKHDKKHEKKHEKGDSKRKDKDHKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XYC6	Gram domain protein	0.894	64-73	KKKEKKPRRS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YCE7	Peptidyl-prolyl cis-trans isomerase	0.992	387-433	HRRDRDRDSRRRRSRSRSPRRDRDRDRQDRDYDRDRRRDGDDHRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YT07	Peptidyl-prolyl cis-trans isomerase	0.941	354-371	KVRQRKKEKRDKEKAAYK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WB33	Uncharacterized protein	0.721	522-530	RPTKRKRCR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WH68	Uncharacterized protein	1	749-800	RKKERERRSGKGKEKEKEKEKEKEKKRKGKEKEKSKDKEKQRDKRKDSDRIR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WH68	Uncharacterized protein	0.939	1021-1037	KEKEKEKEKEKGKRRVL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WH68	Uncharacterized protein	0.805	542-564	RKSKGKDGSSGDLKGKGKEKEGE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WHX4	Uncharacterized protein	0.679	416-422	KRRSRRI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQY0	Uncharacterized protein	0.912	183-209	RVKLAADERARRQRMRNKGVKGKVTKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWW7	Peroxiredoxin q	0.795	530-545	RPPRVKRRSMQHSRRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X3K9	Uncharacterized protein	1	154-182	QKRLAAKAERRRRKKERKNRRRAREREKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9X4	MYND-type domain-containing protein	0.779	604-614	RRIRGRRIAKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF35	Uncharacterized protein	0.87	20-38	PRRRPGKRIAAAPATNKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XF35	Uncharacterized protein	0.738	133-140	MPRRRRPH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQC2	20S-pre-rRNA D-site endonuclease NOB1	0.913	461-472	RKNPNERRRHKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQC2	20S-pre-rRNA D-site endonuclease NOB1	0.679	394-401	KKRADGKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT26	RF_PROK_I domain-containing protein	0.999	229-255	KEELKRAKQQERERRRRKKAKKKALEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTH1	Xylosidase arabinosidase	0.978	617-652	KKERREELARELRRREEKAEAQKAKAKDSVKRRPRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XUA6	Uncharacterized protein	0.942	114-135	VPPKRKPKVPIQPSESRKRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVR5	Uncharacterized protein	1	588-609	KSKKKKKKKPKKKKKKAGGEAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVR5	Uncharacterized protein	0.887	438-448	RAAGKKGKKKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWS8	Uncharacterized protein	0.971	23-33	VKKKKKKSKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y1M6	Uncharacterized protein	0.954	221-238	RTPHRPRHTPRRRKPAPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y1M6	Uncharacterized protein	0.778	353-363	SPRRIKRRTSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WDB3	Ribonuclease Z	0.991	227-246	KRPKADKGKPLKKKGKQKGG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRX3	Kinase-like protein	0.971	631-643	KRRKRGARKGKGA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRX3	Kinase-like protein	0.719	1005-1013	PRKQRSRKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRX3	Kinase-like protein	0.695	845-856	RGRRGRDLSPPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WWL2	Mitochondrial escape protein 2	0.652	522-528	KKDKHSR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X478	Transcription factor iws1	0.998	54-84	PGKAIKKKKKKVRVRDEGEGGERRKRKRTST
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X478	Transcription factor iws1	0.914	119-130	KSKRSSRPKKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XA07	Ccr4 nocturin family endoribonuclease	0.885	18-25	KRKKKKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XBT5	Uncharacterized protein	0.692	477-483	PRSRKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDN4	Eukaryotic translation initiation factor 3 subunit A	0.976	776-830	KKGEEFARKRDAALKKIEEEKAKRRKTVFAQREAERKRIEEEERIHREKEEEERR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDN4	Eukaryotic translation initiation factor 3 subunit A	0.765	602-629	RREKEEVSRRAEQSRREKEEEERKARLE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XDN4	Eukaryotic translation initiation factor 3 subunit A	0.663	1023-1028	RPRRGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEG4	Serine threonine protein kinase (Nrc-2)	0.704	309-319	KREMIERKKIK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XHC7	Trna (Cytosine-5-)-methyltransferase	0.675	4-14	KKRVGGQNRGK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIS4	Chromatin remodelling complex atpase chain isw1	0.977	1037-1082	KNKGGSKGKKRGIEEVQKADKKESRPSTPTNGSAASAKRPAKKKKT
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIS4	Chromatin remodelling complex atpase chain isw1	0.944	59-71	AKRRQKKEKRKAA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIS4	Chromatin remodelling complex atpase chain isw1	0.935	127-145	KPKGRGRKKAADNSTRHRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLS3	U3 small nucleolar ribonucleoprotein protein MPP10	0.995	686-756	QALRRKERKARKKRRDALETSVDKYAKSKKVGSVKKQKEEALKSVVKSGKGVTVVGKKSKDILGKGKKGKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLS3	U3 small nucleolar ribonucleoprotein protein MPP10	0.988	344-383	APPKSKKSYRKSSESPKKAGSVRFHEKVRVKKIRPKGKNR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XLS3	U3 small nucleolar ribonucleoprotein protein MPP10	0.733	78-84	RKRKRSP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XMS9	Uncharacterized protein	0.872	240-255	AQRPQKKVKREPKVKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQJ5	Glycosyltransferase family 90 protein	0.759	129-137	RRYKRKPPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTF7	Uncharacterized protein	0.984	317-347	PGAMKRELEAKRGRREWQKHIRREAKIKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XTF7	Uncharacterized protein	0.916	205-238	KRSRSAVPERSKKLEQMRQNREARREKAARRAEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWL6	DNA topoisomerase 2	0.99	1450-1484	SGSSSAEKKAPEKPEKKSIAKSMKPRSPPKAKKAP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWL6	DNA topoisomerase 2	0.966	27-65	AKKTKAPAKPKSKATTTATKAKPAAAKTAVKGKGAPKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWL6	DNA topoisomerase 2	0.937	1404-1417	KGKGKGKAAPKRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWL6	DNA topoisomerase 2	0.915	1259-1268	KGKKGKKKNA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWL6	DNA topoisomerase 2	0.903	1289-1325	PIKVAPKKKAPASKPTPAAAATSSSEKAPAPKRKIVA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWL6	DNA topoisomerase 2	0.902	1349-1361	PKKPPKRKAAATK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWL6	DNA topoisomerase 2	0.628	1159-1162	PRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XXQ1	Agc akt protein kinase	0.916	515-525	RQRRKKPRKAS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKE2	Proline-rich family protein	0.918	14-33	RKQQRKKELKKNKTERSKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKE2	Proline-rich family protein	0.728	449-460	KKRKVEESKLKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YYT1	Trna (Cytosine-5-)-methyltransferase nsun2	0.985	4-67	RAKNKQPPPKSLEDAAGTSPKKLGKRKAEAIDDKPNSRPAKKAKDQAVKVKTNSKKDKLKTRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WL89	Uncharacterized protein	0.626	45-49	GSKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WMF0	Uncharacterized protein (Fragment)	0.839	228-240	GRRRRKEGERLWG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQH0	Uncharacterized protein	0.653	258-265	KRKGGYKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQH0	Uncharacterized protein	0.61	112-113	KK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRL8	Developmental regulator	0.998	459-487	RSRSKKKDAKDKGKKDKDKKEKRDKKRTR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTE1	Zf-PARP-domain-containing protein	0.998	157-195	EEEQPKKAAKPRAKKAAKEENGETKPKKKPTAKKAAKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTE1	Zf-PARP-domain-containing protein	0.996	256-287	GKKRKKPASKTAAAKPPSKKAKASSSKAKKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTE1	Zf-PARP-domain-containing protein	0.994	121-155	KPKKKGRATKKKDDGEEKPKKGKATKKAAEGGDEG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTE1	Zf-PARP-domain-containing protein	0.987	223-239	KPKAKPAKKPAAKKAKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X103	Uncharacterized protein	0.98	911-954	SKELKGRAARSSKTSPASRKKATRTVEKVKKVSEARKGKALVKV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X103	Uncharacterized protein	0.763	961-973	QLVRRSKRLERRG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4P8	Uncharacterized protein	0.786	168-176	KRARKGKGR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7V0	Uncharacterized protein	0.814	297-314	PAKAKRKTAQTKSRPTKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9J3	Uncharacterized protein	0.976	54-97	ERPNHHRRSAAKSKLVEVKVKLAHERAQRKKEKINVKRRYAKSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEA3	Mitochondrial chaperone bcs1	0.947	294-312	HRRRAEKKVEKEKSKAKRA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEA3	Mitochondrial chaperone bcs1	0.656	338-341	RRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGZ6	Pre-mrna splicing factor	0.867	227-242	KYAKWERNKREKEKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XGZ6	Pre-mrna splicing factor	0.768	475-490	RRKKEEEAERERRKER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XNS2	Lin1 family protein	0.811	198-206	QARKRKKQQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVG1	Uncharacterized protein	0.996	110-135	PFKSDKVKAEKKPKAPKSPKKDKKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVG1	Uncharacterized protein	0.984	202-241	EKEEKKEEKKEEKKEEKTPKAAKVGRRLSARVGDFFKPKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YIF7	Snf2 family helicase	0.998	491-527	KQKRALKKKKAKKKAERANTVAEAVARMRGKGKGKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YNE2	Uncharacterized protein	0.982	410-423	KRKPPPPKKERKKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YNQ6	Ubiquitin carboxyl-terminal hydrolase	0.983	374-392	IEKERAERRKVRKRTKKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z2A6	Uncharacterized protein	0.996	795-895	QERSDKEAKRESRRQEKEKEREREREKERERQKEKERASRSRRQHSVDATRAPPTRKAPRRSNSAESHSRREVPVEIARPDDSRSSRSKEPKKEKRSNRKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z2A6	Uncharacterized protein	0.698	26-40	RKLSKRTKGNMFKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z2A6	Uncharacterized protein	0.692	606-614	KRQPPAKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WQT6	Uncharacterized protein (Fragment)	0.833	4-17	GKNKGGRLVKKKHR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSL2	60s ribosomal protein l7	0.838	21-53	KKRKQNEKAREERLAAATAARKARLAQRKVIFK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X326	Uncharacterized protein	0.988	264-282	PGKRPRGRPKGSKNRKGSG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XAS1	Uncharacterized protein	0.716	54-60	RKRRARR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD14	Uncharacterized protein	0.919	431-446	PKEHGRPRRTIKKPKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XD14	Uncharacterized protein	0.647	419-422	RKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XEH7	ERF-3	0.713	498-505	RKSKKPPQ
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XSY4	Uncharacterized protein	0.986	92-144	AGRPQNRSPKTGSRKPRNRTKNPQQIKRRRRQIFRLTHTQRQARIYRLRARRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV69	Uncharacterized protein	0.986	100-131	KPRKPSPKEKRPGDPEAKKEPQRTNKKRHAGV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XV69	Uncharacterized protein	0.906	141-153	EERRLRKRAKREA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XZ71	Heat shock protein	0.732	523-530	PKKKKVVK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y735	Uncharacterized protein	0.799	656-678	GSTSKKWDRGGRNGQGRASGKAR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y735	Uncharacterized protein	0.746	574-588	KRKSKSAGSSSKRRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YTL6	Uncharacterized protein	0.842	326-340	RKKQKAKVKAKSEAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YWC1	Pentatricopeptide repeat protein	0.637	597-603	KRDRKTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WH77	Uncharacterized protein	0.868	204-222	STRQKRIRAPSPEKRSKRH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WM50	Retrotrans_gag domain-containing protein	0.807	361-375	RKDERKQKEPKKLSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WRA6	Uncharacterized protein	0.997	289-338	KPATKAPAKAPPKTAAKPATKAAAKKPATKAAVKKPATKKTAAKKKPRSL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X135	Uncharacterized protein	0.844	437-444	KPRKKRRL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X436	Ring finger domain protein	0.998	313-377	HSRSSPRRRRSTSRLRDRGRRRSRSKSRSPSWSPSGRRYSREPGPEPEIGRNSRGKRGRRSRSRD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X436	Ring finger domain protein	0.984	116-157	SRPPVTARNRRRIPREVRERSRREREKREEADRFDRAVAKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X4J0	Uncharacterized protein	0.769	210-216	PKKPKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7C8	Uncharacterized protein	0.845	203-211	KRRKLPRKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7E7	Rna-directed rna polymerase 2	0.932	373-384	AKEKKEKKKKVE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X9H4	Brain factor 1	0.767	266-275	KRQRKRGPSK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XH25	Zf-c3hc4 type zinc finger	0.755	343-349	EKKKKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XL71	Metacaspase-1	0.818	193-207	RSSSRPRRHSSPKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WEF0	Endonuclease III homolog	0.97	78-100	PKRKRKTNPTPKSPSKSPRKPKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTD3	Uncharacterized protein	0.961	28-48	SQRIKREKAAERQRRKRERDR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WTD3	Uncharacterized protein	0.903	91-113	RRERVRAAARERQRKHRALVKQR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X437	Uncharacterized protein	0.939	206-235	KRAADKAKDDLKKKIAADEARKMKKASRKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XH29	Uncharacterized protein	0.88	146-158	GSQRRTRRKARRN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XS84	Uncharacterized protein	0.816	96-110	WRIKRGKTELKKPKI
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVF7	Uncharacterized protein	0.993	87-138	PKRRGRPPKNGISAQPRSSNQRARQPSRRPPPQNKSKVGIKKKPTAVKRKRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XVF7	Uncharacterized protein	0.695	789-798	KELRRERRLK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Y8Z2	Uncharacterized protein	0.759	407-422	RRRKIIRRVIRHLSKH
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YDM5	Uncharacterized protein	0.903	313-333	KEARRARAKEWIAKRREASKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YFQ9	Ace1 transcription factor	0.91	155-166	RKSAPRRRKKEP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRX2	Nucleolar protein	0.815	44-53	KNQEKKKRRV
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRX2	Nucleolar protein	0.781	27-35	KKRGRKDHG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRX2	Nucleolar protein	0.776	61-69	ESKKKGKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YRX2	Nucleolar protein	0.658	553-557	KRKAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2W5W8	CCHC-type domain-containing protein	0.851	90-107	KKEEKRKEEPKRLLKEER
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WPS8	Translation machinery-associated protein 46	0.892	49-74	RAALEKEKEKELRNKQKAEEEKRKKE
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2WSI5	Uncharacterized protein	0.628	517-523	RPSLKRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0N6	DUF262 domain-containing protein	0.971	24-35	KSKKRRRKIKNR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7F9	Prib protein	0.868	59-79	KHRRGRKPGSKLSEASKMLRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XIH0	Uncharacterized protein	0.649	95-99	KRRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQT7	Uncharacterized protein	0.749	89-97	KRRVRKLKG
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWX0	Uncharacterized protein	0.973	390-400	ARKRKRRRPRM
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XWX0	Uncharacterized protein	0.779	334-342	QNRRRERRK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YCI8	B-related factor 1	0.999	297-333	KEEAERKERELREMGIEPGPEPTRKKKKKGKGKKRKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YCI8	B-related factor 1	0.952	505-520	PKARSRKRRKTAGNKP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YPA6	Uncharacterized protein	0.845	9-19	KLKKQTRKKRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YW05	Ankyrin repeat protein	0.994	1694-1719	KRKREEAKKKRREAKEEEEPKAREKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZ01	Uncharacterized protein	0.922	209-229	PSPVKVKARRSSAAPRKSRKS
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZ01	Uncharacterized protein	0.906	119-136	PPRPEPPKRRRSSAAPRL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YZ01	Uncharacterized protein	0.843	59-72	KRRASKFKKERLKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0V8	Single-stranded dna binding protein	0.993	507-571	GGRGDRGGRGGGRGGGRGGGRGGFGGDRGGWGDRGGWGDRGGRGGRGGRGGGRGGRGAPRGGSAK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0V8	Single-stranded dna binding protein	0.991	6-48	KTEKKESAKAEKKGKTAAVKSKKAAVTKTEPEKKKELKGKKKA
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X0V8	Single-stranded dna binding protein	0.648	170-185	KAASKPAAPTKSAPPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5J5	Uncharacterized protein	0.89	62-83	NDGRDGKRQKVDDRKKKEEKEK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5J5	Uncharacterized protein	0.839	4-27	KRAKRSVRERERSEKGHDMAPGKN
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X5J5	Uncharacterized protein	0.754	46-60	KIREDFKAKKRQLGD
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X788	Deoxynucleotidyltransferase terminal-interacting protein 2	0.624	288-292	AKTKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2X7H3	Uncharacterized protein	0.869	252-273	KPLKQLPRLRKKDYKPLPRKLL
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XM95	3-5 exonuclease for rna 3 ss-tail	0.819	36-53	SGRPRPKNQDARPKPRTK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XQI0	Uncharacterized protein	0.98	27-58	PPKKASAKKPAAPPAKKPATPARPPTPPPQRP
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT20	Transcription initiation factor IIF subunit alpha	0.83	154-171	KGKGGSGGANGKKKFQKK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT20	Transcription initiation factor IIF subunit alpha	0.694	16-30	KKNKKQTPAASPRPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2XT20	Transcription initiation factor IIF subunit alpha	0.634	591-594	PKKR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKU2	Zn(2)-C6 fungal-type domain-containing protein	0.67	344-348	RRKPK
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2YKU2	Zn(2)-C6 fungal-type domain-containing protein	0.666	51-56	RKRGPR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1F4	Formin binding protein	0.725	607-638	RKRKELSRDDRDHRDRDRDRDRERDRDRDRDR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z1F4	Formin binding protein	0.703	698-709	DRRRDRDRERDR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z267	Zn(2)-C6 fungal-type domain-containing protein	0.688	307-311	RKRRR
UP000017559	Moniliophthora roreri (strain MCA 2997)	V2Z267	Zn(2)-C6 fungal-type domain-containing protein	0.684	339-346	APKVPKRR