ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD41	Zn(2)-C6 fungal-type domain-containing protein	0.856	320-326	KRRRRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH29	Prolyl-tRNA synthetase	0.953	30-59	KQKPKKQEKERKDQKIAHKSKAQQQPAKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJQ9	SPX domain-containing protein	0.762	678-687	KRFKAPKGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQU4	Uncharacterized protein	0.928	92-119	AAERKRQTRMKPGKDKEAERKDPMKALK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQU4	Uncharacterized protein	0.629	190-193	RRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSU8	Uncharacterized protein	0.978	809-858	QKRQRKKEEKHHKKELEEEERRGGYGRRNGGSHEHRKSNSRSRERRGSNE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSZ8	Uncharacterized protein	0.701	192-199	KPKQRRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWC0	GTP 3',8-cyclase	0.771	418-425	KRKKAKHA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY33	AB hydrolase-1 domain-containing protein	0.948	341-359	KRDQPKSRDASPKPKRRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q276	J domain-containing protein	0.992	156-210	EYGRSSRRSGHDVKEKEKEKSRGFFSRSTKENERDRRKEKIRKAEKDTRRDRDRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2W0	Uncharacterized protein	0.991	570-589	EKRKAARRKKRVARQKQEER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2W0	Uncharacterized protein	0.973	181-228	NKKGDSRAGSRRGGRSRSRAGSRRGGYDSDDSRSRSRGPDGKKRTERK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2W0	Uncharacterized protein	0.772	380-387	RSKSRKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2W0	Uncharacterized protein	0.698	149-157	RRREPERKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2W0	Uncharacterized protein	0.689	125-132	RDRSRRRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4N6	Tim44 domain-containing protein	0.841	333-344	ERRRKREERDRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q524	Uncharacterized protein	0.95	78-118	AGRGGRRSRSRSRSPPRRDNYGGNPYRDERREDPRRGTHRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKU5	Uncharacterized protein	0.798	7-16	KRSRSKRRRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJ59	Ribonuclease P	0.834	13-25	KRSRKQRKTQGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJ59	Ribonuclease P	0.67	97-100	KRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJX5	Uncharacterized protein	0.955	98-131	KPSHVVRKRRHGFLSRLRTRTGRMILKRRRMKGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGJ4	ADP-ribose 1''-phosphate phosphatase	0.883	262-278	PKKKSRGGGNARPPRAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGJ4	ADP-ribose 1''-phosphate phosphatase	0.76	297-305	KQRRAPKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIJ7	Ribosomal protein L19	0.965	135-176	KRALVEHIHKAKAEKLREEKLKAEMDAKRAKTKAARERRQER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIJ7	Ribosomal protein L19	0.912	60-83	RARARELTAARRIGRHRGFGKRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLW9	Uncharacterized protein	0.741	110-124	PKKAPGTQPHRRRPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLW9	Uncharacterized protein	0.663	267-275	RRGFKHSKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSF5	Uncharacterized protein	0.991	1087-1114	VRKGRPPGSKNLKPRKDIGIKKGPRKKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSF5	Uncharacterized protein	0.677	897-904	KKERKAVK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSY6	Iwr1 domain-containing protein	0.976	94-127	KRPSTPEAGVKKKRKAKLKEDGIATFIERRGKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUU6	Uncharacterized protein	0.691	261-265	GKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW18	Uncharacterized protein	0.996	68-109	RSDRRDRDRDDRRGGDRRNGGDRRGGRGGRGRGGGRGRGRGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW18	Uncharacterized protein	0.969	340-368	RRNDRRGGRGGGRGRGRRSSFDYGNKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW18	Uncharacterized protein	0.871	382-407	RSRRDKFQKKDRSESRSRSRSRSRSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY48	Uncharacterized protein	0.611	43-44	RR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYI8	Cytochrome b561 domain-containing protein	0.912	959-973	RRRRRAERARRAEAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYI8	Cytochrome b561 domain-containing protein	0.848	836-848	RATRRRERRSRRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYI8	Cytochrome b561 domain-containing protein	0.702	159-164	RERKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2P2	Uncharacterized protein	0.656	457-463	RSHSRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBP3	DUF1746 domain-containing protein	0.618	37-38	KK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCS0	Uncharacterized protein	0.929	61-92	RRESPERRRSRRSEDDRRRRYSRNWSRSPSPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCS0	Uncharacterized protein	0.895	212-241	RARRLSWDRIANGKEPGRRHSRDRRSHHSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCS0	Uncharacterized protein	0.734	21-29	KGKASPKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGD2	Chitinase	0.87	636-649	MKKRRGVRRGLRGE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIS3	Uncharacterized protein	0.865	493-508	RRSRKRRFRSDEEKPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIS3	Uncharacterized protein	0.63	52-56	KVKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRY7	Uncharacterized protein	0.731	344-352	RSRSRPRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUR6	Uncharacterized protein	0.964	574-590	DGKHWKKHKNRTRRKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUR6	Uncharacterized protein	0.681	139-158	KGSARSRSVGKEERATAKPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVP4	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial	0.736	116-123	PKKRARIR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY25	Uncharacterized protein	0.988	107-125	RREREEERKRGRRRRSREG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0N6	Uncharacterized protein	0.864	567-597	KKREATKRGMFAKQSLKSKRTFKPTFGRKMK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIV9	Uncharacterized protein	0.656	57-66	RRIKLTEKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKA8	Non-specific serine/threonine protein kinase	0.997	631-650	EPKKKKATRGKRAGKKHKEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE08	ABC transporter-like protein	0.651	1540-1548	KSKTSKSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGB0	Uncharacterized protein	0.715	379-383	KRKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGB0	Uncharacterized protein	0.696	141-149	RRRTIRPKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIG5	RRM domain-containing protein	0.984	104-136	RDGGRGGGRDGGRSDRRERSPRRGRSGSPPRRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIJ1	Sterol 3-beta-glucosyltransferase	0.994	108-154	KRKRSEDAVRPSAGGSGRSTPRQHERKKSSDSKKDKGEEKRRRRKLS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSN9	Uncharacterized protein	0.974	143-160	PKKRGRSRKRPSPENKDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSN9	Uncharacterized protein	0.964	112-127	LAAPAKRGPRKPKKAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSN9	Uncharacterized protein	0.875	174-182	PKRKRRGRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTK3	RING-type domain-containing protein	0.783	312-318	RKSKRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU04	Uncharacterized protein	0.964	510-520	LPKKKRNKRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVV4	Uncharacterized protein	0.965	492-507	RHKKKRHSKPRGSRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX77	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.965	534-593	NAAAPDRKADRFDRRDDDRRRSRSRSRSRSPERIQAPTGPRNNAPQRAAGFRPGPRFRPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX77	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.954	752-786	KVKDLRKHAQQFFEKAVKKKAASEAKRAERKDKKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX77	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.764	382-388	KKPRKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX77	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.632	678-682	KERKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ03	DUF4210 domain-containing protein	0.972	487-505	RQRRRQKAKRRSGSPKAPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ03	DUF4210 domain-containing protein	0.666	125-129	RKRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZU7	Uncharacterized protein	0.662	28-35	RKRVRHRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q067	Uncharacterized protein	0.601	628-628	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1E6	Uncharacterized protein	0.875	321-334	ARGRGGRSRRGRHS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4L7	Endonuclease III homolog	0.704	345-350	RKRKVK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4L7	Endonuclease III homolog	0.694	77-99	RSPRKASKIGESSPSSTPKPKRQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNQ6	Protein kinase domain-containing protein	0.65	580-591	RTRSRSPDRLRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3V8	Uncharacterized protein	0.951	67-113	RARAKKHKYKRRAADEHDDEPAPRPSAKQDRRRSRAQTPGPGRRHKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3V8	Uncharacterized protein	0.602	138-138	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YHY8	Uncharacterized protein	0.641	225-229	RRPRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLX3	Condensin complex subunit 1	0.879	883-908	KRRKADKEKSNPPASAKKAAGSRAVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLX3	Condensin complex subunit 1	0.697	148-158	ARGKGVKGLKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMU5	Uncharacterized protein	0.98	475-496	IKKAIRESRRKRPKQRPASEVR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW06	Uncharacterized protein	0.883	66-103	KKLPKLPPPTDPRRQHAREQYRREVRDVARRHHRRKER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW06	Uncharacterized protein	0.724	223-240	AKRSERIQERREAKAAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWR0	Uncharacterized protein	0.807	6-32	KVKKREISVHSRAARRSSPPPKDIAGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWR0	Uncharacterized protein	0.691	119-125	KKKEGKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXY7	Uncharacterized protein	0.817	215-225	AKKPKRPALGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY86	Uncharacterized protein	0.617	782-785	AGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY86	Uncharacterized protein	0.605	17-18	KK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYM5	Ribose-phosphate diphosphokinase	0.757	255-275	HRRHSPRSSIEHRRPPPAARP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1E0	Uncharacterized protein	0.928	128-151	KAKGQGEGRSKEERGRSWRRRRDG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q215	SAP domain-containing protein	0.983	187-222	KRGREGAENDGGIRKRSKVRPVKKGGGGAGEAKPKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4V8	Rho-GAP domain-containing protein	0.724	764-779	RLDRKEKDPEKRSGTP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4V8	Rho-GAP domain-containing protein	0.702	664-670	KKKRHRW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKB9	Uncharacterized protein	0.983	219-238	AKKRETAAKNRRKGRKGRDT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKB9	Uncharacterized protein	0.945	394-426	KPDKPSAKKTAKTPRGKAKTSVNDAKPTKPARK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKB9	Uncharacterized protein	0.837	375-385	KKTKKERKAEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKB9	Uncharacterized protein	0.774	1026-1055	KAKASVKAARSRVANKANSQQPQRKSKARK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKI9	P/Homo B domain-containing protein	0.928	80-91	KADLKRRRRKRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKI9	P/Homo B domain-containing protein	0.611	796-797	RK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSU7	Uncharacterized protein	0.987	480-512	SRWKRKRQEAAQAKRDERRKRLFRIPGKVKERK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1W6	Uncharacterized protein	0.656	93-101	RKRTILRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XM31	Uncharacterized protein	0.908	96-108	PPGEKKRAMKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLR5	TAFII28 domain-containing protein	0.99	100-116	KKRKRGEKRPRGRPPTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMN3	Uncharacterized protein	0.668	331-335	SRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCZ0	Uncharacterized protein	0.827	7-15	KRGRRMKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE25	PPIase cyclophilin-type domain-containing protein	0.616	233-236	RGRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK45	Uncharacterized protein	0.61	170-172	RRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKH8	Uncharacterized protein	0.774	9-24	KKRLRDRFSKAMGRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLI6	Uncharacterized protein	0.703	182-196	KPKRPSLPRPESPFR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM89	DUF3824 domain-containing protein	0.991	384-417	RVKSMRSLRGSKSRSRSRSRSGERQRRRRHHRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM89	DUF3824 domain-containing protein	0.991	900-913	RKHRRRKRKGKDRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM89	DUF3824 domain-containing protein	0.885	574-588	GRGRRRHSRSRSRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM89	DUF3824 domain-containing protein	0.877	464-475	RHGRRSRSRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM89	DUF3824 domain-containing protein	0.846	994-1001	KSRRKHRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM89	DUF3824 domain-containing protein	0.83	351-367	RHHRKRRGEEVGGRGRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM89	DUF3824 domain-containing protein	0.805	648-657	RRRRSRSRGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM89	DUF3824 domain-containing protein	0.747	521-533	RSKSRGGHRSKSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM89	DUF3824 domain-containing protein	0.701	679-692	SRERSRSRAASRER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP97	Uncharacterized protein	0.984	636-683	RKDRSERKERDERRDRDERRERDERRERDERRERDERKERDDRRSGED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP97	Uncharacterized protein	0.804	847-861	ERRRREREQRQRERE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP97	Uncharacterized protein	0.614	691-694	RERR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPT6	Uncharacterized protein	0.833	526-538	RPRGRSMPKKKLP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQD5	BSD domain-containing protein	0.693	609-613	KKRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRK2	Uncharacterized protein	0.986	183-202	TRPKKRTRRSKAAKRAAGSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3M0	DNA ligase	0.947	113-137	KKQRHKASATKKGLAKKTNGKSKVK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHV8	Uncharacterized protein	0.969	144-181	KRQQQKPETPKSKGKGRCKASGKKTTPRSLRKPDSKRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCK5	Uncharacterized protein	0.817	225-235	LKPGRRPRKSL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCU0	Uncharacterized protein	0.878	230-246	KIKTGAKSRAKRAKDLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCU0	Uncharacterized protein	0.676	67-72	REAKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFB6	Bromo domain-containing protein	0.985	971-1016	QRFPKPRLPPTGKISSPRKRPLKEQQQAAKKKRKLEESEGKAKALK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFB6	Bromo domain-containing protein	0.735	406-413	GRKAPKKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFN7	RNA exonuclease 4	0.999	356-371	AAKRKKSKKKKRTKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFN7	RNA exonuclease 4	0.84	32-50	AVKRKRPAPSTAHPFKKTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFN7	RNA exonuclease 4	0.82	297-314	RKHFGQKRPPAKAGAKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFN7	RNA exonuclease 4	0.666	59-64	KLGKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGP4	Uncharacterized protein	0.861	375-384	PSPKKRKAKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLA4	Uncharacterized protein	0.948	369-404	PSRTRAAAAQAPQAPSKRGRPRKDATQAPPKPAPKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLA4	Uncharacterized protein	0.826	461-477	PAGARKKPQLRRGQMKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM17	PH domain-containing protein	0.926	884-901	RNRTGRGSPTKGHRRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP91	Zn(2)-C6 fungal-type domain-containing protein	0.607	674-675	KK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPF2	Zn(2)-C6 fungal-type domain-containing protein	0.793	7-14	RKRAKKPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR70	RING-type domain-containing protein	0.997	677-760	RRKERERRKRKERDDRYDEERNGSRDAEKSSKKHRSRSESRADDNSRRRHRDKDDEHRSSRSHRDRSKDRRHRRHRSKSPARES
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR70	RING-type domain-containing protein	0.987	923-941	PRGPKGDRGRVKKGKKERR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR70	RING-type domain-containing protein	0.766	782-795	ERKESRRSNKHSKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR70	RING-type domain-containing protein	0.727	767-777	SRRKSRGDRER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR70	RING-type domain-containing protein	0.627	855-858	RKDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR70	RING-type domain-containing protein	0.611	848-849	RK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRC2	Uncharacterized protein	0.665	856-865	KIKAQRKSEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRC2	Uncharacterized protein	0.623	381-383	KKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRC2	Uncharacterized protein	0.601	867-867	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVL4	NADPH:adrenodoxin oxidoreductase, mitochondrial	0.757	434-444	KRGKEKGKERE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVU6	Uncharacterized protein (Fragment)	0.99	395-441	KPTRTPKPKPKPRDFALPSKGRYIHKRGPYRRRRPEERPAAPLVKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY87	PHD-type domain-containing protein	0.991	311-346	KKRPAPAKTKKGTASMVKKDKAAPPAKKRKVELKKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYF6	DUF4604 domain-containing protein (Fragment)	0.816	160-168	KKVKRKAKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYX3	J domain-containing protein	0.763	197-207	RRKKLEKLRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ39	Uncharacterized protein	0.855	103-118	RVRKGEVVKKRKASRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKQ8	AAA domain-containing protein	0.973	18-50	DKKKSGDKKDKPKYEPPPQPTTRIGRKKKKQSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNC7	CYCLIN domain-containing protein (Fragment)	0.85	317-328	KRRKLEREKRAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC16	Dihydrolipoyllysine-residue succinyltransferase	0.867	112-142	SKPEPKKEEPKQESKPQPKQESQPKKDPKKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD63	HUN domain-containing protein	0.999	80-127	AKLRKQRKPREPKAAGDEKPKEKKPRKPREPKVKKEIDAAPAPRKRQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD63	HUN domain-containing protein	0.961	581-613	KKDPNAPTTRGRGRARGTGAPRKPRITKADRER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD63	HUN domain-containing protein	0.892	494-501	KPRKRRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD63	HUN domain-containing protein	0.823	555-567	SRGGRGRGRGRGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG19	SH3 domain-containing protein	0.919	165-183	ATKERPPRKSRHTERRLKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGV0	Uncharacterized protein	0.683	307-316	KNRKTAKSRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJU4	Kinesin-like protein	0.651	645-652	RSPSKKMR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU09	INCENP_ARK-bind domain-containing protein	0.99	802-870	QRKKEADERAAAEKLEKKRELERKRAAKAEEEKRAEEERKAAEQQRVHEIKLAAHRKAAEKQAAEARKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU09	INCENP_ARK-bind domain-containing protein	0.645	630-636	RKEKELK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU09	INCENP_ARK-bind domain-containing protein	0.64	647-656	KERHKEAQKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXL5	Eukaryotic translation initiation factor 5B	0.996	136-171	KTKAQKEKEKKEREKQRKKEQAAAKKKTVAPPPAAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXL5	Eukaryotic translation initiation factor 5B	0.966	51-62	KKNKDKRKKKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXL5	Eukaryotic translation initiation factor 5B	0.963	303-358	KKPTTKDMRKKNPRKEAEERKAQQAREEEEARKKMEELKLREEQEKKAAEEAEKAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXL5	Eukaryotic translation initiation factor 5B	0.917	246-273	AKVAKKAKEKAKIEEMKKAGTYKTEKER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXL5	Eukaryotic translation initiation factor 5B	0.695	191-196	GKKGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXL5	Eukaryotic translation initiation factor 5B	0.636	6-9	KKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYA2	Ribosomal_L18e/L15P domain-containing protein	0.978	38-67	NKKIRRGRGPASGKGKTSGRGHKGQKQHGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ92	SET domain-containing protein	0.843	403-426	RKERAQWRGKDGRRVVKSKAGIRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBY0	DNA ligase	0.951	666-681	TKPAPTPKAKKGKKSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE60	FHA domain-containing protein	0.999	83-128	GRDLKRHRRRHSRSRSRDRRERRRSRSPPAKKRRSRSRSPLKRARG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN64	RRM domain-containing protein	0.996	241-281	IPGRGSRSPIGRRGTPREGGRRPGERRERGGGRGGRGGRVG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN64	RRM domain-containing protein	0.983	12-52	RPAPRGRGGRGGGRGGDRRGPPPPVRTAPRREEYPRDGVRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN64	RRM domain-containing protein	0.843	208-230	GGREDSREGGRRRRYRSDSPQKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNT2	Uncharacterized protein	0.659	117-122	KKEKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q268	Mitochondrial Rho GTPase	0.907	411-422	TKARKRRNKPGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2L1	Isoleucyl-tRNA synthetase	0.66	726-733	KNKNRSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XK78	Brix domain-containing protein	0.962	11-44	NKIKRQEQHLKAKKLKESTKRDDRLRRRRHEDKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XMK6	Uncharacterized protein	0.923	190-208	AKGRDANANRKKNNKKGRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4N5	Uncharacterized protein	0.988	73-119	KPKKSQREVKRLQDARKQRRERSSHRKPRNQVAFPSHPLKKRNGSKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI00	Uncharacterized protein	0.921	448-461	KAPPKRSKRRIREA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCW6	Uncharacterized protein	0.862	9-39	TKRVTKKKGSKINALHENSRDARRLRRAGAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDM4	ATP-dependent RNA helicase DBP10	0.994	932-1010	GKRFKHKQERAPKEADKFRDDYYKRKKKVDAAREKRVGKFADGPGKVKSEIRGVEDVRKLRKLQDRRKEKNARPQKRGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDM4	ATP-dependent RNA helicase DBP10	0.97	431-447	KKANAPKKNDKKRKRGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDM4	ATP-dependent RNA helicase DBP10	0.891	716-729	KRRRAKMESKPKKQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDM4	ATP-dependent RNA helicase DBP10	0.721	857-867	KGLRWDKKSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFB3	SEC7 domain-containing protein	0.977	79-98	PAAKPRSKGKGRKLLKGPRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFB3	SEC7 domain-containing protein	0.963	1945-1975	SQKRRKAVEEWKAREAREARQRRINRRRGAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQP4	Zn(2)-C6 fungal-type domain-containing protein	0.776	12-27	KPTVRAPKVGHKKSRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVF0	Uncharacterized protein (Fragment)	0.964	165-186	KAKWGRRKRDARDARQERKKRW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXQ9	Uncharacterized protein	0.618	275-279	NKLRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXQ9	Uncharacterized protein	0.609	266-267	PR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXQ9	Uncharacterized protein	0.608	270-271	RS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYZ9	Uncharacterized protein	0.89	121-138	RRTRKPARRQPGLRSARK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Q8	rRNA-processing protein	0.996	67-121	KAEKEEERQRSAQAIKDKRAAKEEKERYEKMAEKMHKKRVERLKRREKRNKMLKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Q8	rRNA-processing protein	0.605	34-35	KK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q481	Uncharacterized protein	0.94	202-257	RRSKFPDDDRPREEPPRRRRYEDDEVPRRSKPVREPYEGDDRRRKPSRPDESRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGR2	Uncharacterized protein	0.995	237-256	ARRNRPPPKKKGGPGRGKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFB4	Uncharacterized protein	0.938	707-738	PGSIKVPGLRPGAKDASKNKDARKRSAGKAAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFB4	Uncharacterized protein	0.801	471-486	KSPAKGKNAGKSARKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFB4	Uncharacterized protein	0.644	75-79	KRARI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFB4	Uncharacterized protein	0.602	81-81	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGN2	Uncharacterized protein	0.896	6-54	RRKVSHGEGKDASPVQVPKKIAKRKDTASGHEAPAKAAPSKPSPERNKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGN2	Uncharacterized protein	0.685	484-501	RGGKGSGSGISSGRAKKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHA5	Uncharacterized protein	0.831	39-59	KRPKRAPAQPRDYRDRSRKPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQC9	Uncharacterized protein	0.971	248-275	RARKNKSSLRPRPSKAPKSTGHKAGKRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUR1	Uncharacterized protein	0.993	14-44	HLKDTLERRKGLKKIKQKQQLKAKKKARRAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUR1	Uncharacterized protein	0.94	688-713	KAREEKAKVVEQGRKEEERRRRKDKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUR1	Uncharacterized protein	0.859	89-98	PKKKGSKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUR1	Uncharacterized protein	0.669	179-183	KRKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWP6	Uncharacterized protein	0.868	188-200	RKGNNRRRARRAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMV7	RRM domain-containing protein	0.922	743-756	RRRRRQEREKGKRQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBL1	RRM domain-containing protein	0.986	143-170	RRRRRQQLAPGRWRRRLRSARRLWWRPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKQ4	Uncharacterized protein	0.997	43-62	PKPKKKRHRGGRNHKRKNRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKQ4	Uncharacterized protein	0.806	351-358	RRRRKRAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKS7	Uncharacterized protein	0.808	189-201	RRRRKRQEAAARR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWT4	eIF2B_5 domain-containing protein	0.969	100-109	KKKKKKKVKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWT4	eIF2B_5 domain-containing protein	0.949	64-76	AKKKKKKSASKEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXV7	SRP9-21 domain-containing protein	0.989	152-162	GGGKKKKKNKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYH5	Uncharacterized protein	0.96	286-309	GPRPLPPALKPKRKNEKWSGRRPW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYM7	TRP_N domain-containing protein	0.913	772-784	RPPKPVKEKKKKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Q3	Uncharacterized protein	0.989	288-304	KVKKAKKSKKEKRTRHK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Q3	Uncharacterized protein	0.987	71-99	REKEERRKRKDAAKKARDLAARNEKLKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Q3	Uncharacterized protein	0.888	617-636	KGSGKGKTEKRLKKIEDEKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Q3	Uncharacterized protein	0.684	364-368	LKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Q3	Uncharacterized protein	0.683	121-129	KRQRKIDKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1N5	Uncharacterized protein	0.617	1088-1091	KQRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Q0	DNA-(apurinic or apyrimidinic site) lyase	0.998	394-433	KPTKAKKPKAAAKKAAKTAPKKEVKAAIPGERRSARSKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Q0	DNA-(apurinic or apyrimidinic site) lyase	0.917	317-328	KKPVKGRKRKSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Q0	DNA-(apurinic or apyrimidinic site) lyase	0.705	366-374	KTRGGRAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q551	rRNA-processing protein EFG1	0.99	90-131	KAKKRSEMIGKYHKIRFFERQKAERRLKKARKGIKEATADGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q551	rRNA-processing protein EFG1	0.871	229-241	VKKVRKDKKKDSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q551	rRNA-processing protein EFG1	0.606	22-23	KR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC61	Uncharacterized protein	0.857	171-183	RRRKEKLVKKLRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD23	Uncharacterized protein	0.755	173-181	KRSRSRKRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEU6	RING-type domain-containing protein	0.701	355-371	ALRQRLRDAARRDPRPH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEU6	RING-type domain-containing protein	0.642	343-347	RPRRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEY3	Uncharacterized protein	0.704	572-579	RKSKPARK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHQ4	Zn(2)-C6 fungal-type domain-containing protein	0.872	142-152	ERKKRGKASRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL23	Transcriptional adapter 2	0.614	163-164	KR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVA7	Chromatin modification-related protein	0.995	263-304	QPARPAGNKKAQPAPSKKGPPQSKRRTRPSGGTKKSDRRRQL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVJ7	Glycosyltransferase family 31 protein	0.668	373-379	RSRRRAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY21	Uncharacterized protein	0.86	107-122	TIPEKKASRGRRGIKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY21	Uncharacterized protein	0.711	19-28	KKAEEKRMKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZI1	Bms1-type G domain-containing protein	0.992	1060-1133	RKEKVEKRRAKQEERRQPHRAKVAENESMRKEREKKERDDFWRREGKKRKGWSDSADGGGRGGGGGKFKKQRKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZI1	Bms1-type G domain-containing protein	0.904	10-29	AHRPSKEKKAKDKSQPNPKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZI1	Bms1-type G domain-containing protein	0.626	324-326	KRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q444	Uncharacterized protein	0.817	676-692	KKQGPAVAPRRGAKKIK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKB7	Uncharacterized protein	0.882	43-60	SSRKTKPTEKIRKPEKPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKB7	Uncharacterized protein	0.748	137-144	KQRNKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKQ9	Uncharacterized protein	0.999	21-43	KKLKKEKKEKKEKKEKKEEKAKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKQ9	Uncharacterized protein	0.97	109-127	KAEKKAKKRVEKAVKKAAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKQ9	Uncharacterized protein	0.858	71-84	KEERKALKRAKKEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRN3	60S ribosomal protein L20	0.76	128-137	HRAPPKRGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS55	Uncharacterized protein	0.865	59-68	PHKPKKKGRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUF4	Uncharacterized protein	0.982	280-300	EAEKKKAKAAGRKAKTKDEKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVP9	Uncharacterized protein (Fragment)	0.969	391-409	GKKDRRRRRRPNALAMGRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVP9	Uncharacterized protein (Fragment)	0.937	244-258	ARRRRKATGRAKPKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Y3	Uncharacterized protein	0.607	89-89	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1N7	Uncharacterized protein	0.989	731-760	RNRSKKAAKSKVRAKKAEVKSEQRRARSRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1N7	Uncharacterized protein	0.761	254-262	RLRRRAKKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1R0	tRNA (guanine-N(7)-)-methyltransferase	0.789	5-23	PKKRQRREDRQEGELPRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q219	C2 NT-type domain-containing protein	0.692	302-311	GHHDRKGRQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q592	RING-type domain-containing protein	0.608	180-180	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMY6	DNA helicase	0.927	812-840	KKGAANKALAKSRNAFFKKEDRLKERKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLL2	F-box domain-containing protein	0.772	124-131	RRKKGKGH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNE3	Uncharacterized protein	0.739	12-30	SGGRGRGGFHGGGGNRKRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEA1	WD_REPEATS_REGION domain-containing protein	0.945	254-262	KKKKKKTKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH62	Inheritance of peroxisomes protein 1	0.937	198-214	KVRKKVKSHGRAKKWKM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL82	Uncharacterized protein	0.943	150-161	TQRKKARRKERK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLH1	Uncharacterized protein	0.998	152-172	KPKKKQAKKPVKKPAPKKRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLH1	Uncharacterized protein	0.985	257-290	PKKKRQKKTETGSKAKSTAREAKAKATKAKPAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLH1	Uncharacterized protein	0.976	82-105	PKVPTKPASKPKSKASAKASRKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLH1	Uncharacterized protein	0.814	117-125	KPPRRRKAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP24	Uncharacterized protein	0.999	35-87	MPPKEAKKPKPAKEVPRTPEKPKAKPKAKEETPKKVVKAKDETPKKTPAKKKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRU7	Velvet domain-containing protein	0.98	412-431	VKKGSEARKGKSKGGKGAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRU7	Velvet domain-containing protein	0.937	467-476	RKKVKRRKRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q358	Uncharacterized protein	0.83	54-66	RRYRRRSKLKWAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLP1	SAM_MT_RSMB_NOP domain-containing protein	0.934	636-660	LKKQLKKKGIDPKASKSKAVKSLSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLP1	SAM_MT_RSMB_NOP domain-containing protein	0.895	23-72	SSKKRKSAAPTNSAIKKQKTVEVKAAKKPTTNGTAKKPAPAVKAPTTKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5N8	Uncharacterized protein	0.886	72-80	KRRAKKRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJR6	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.992	873-904	AVKEKAKKKRKTKKELLAEQEALKAEAKKAKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJR6	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.925	656-703	KSRRGQRPLRPHDPNSQRGRRGDRERERGPSNAFVDERRRKPAQRPAH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJR6	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.918	374-426	KKMKDERVKRESISAPSAPEGRPAKDSPAPPLNAPKGPASKAAKPPPAGPRGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YND9	Chromatin-remodeling ATPase INO80	0.976	1428-1444	KAGGKRKRKNAAGGKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YND9	Chromatin-remodeling ATPase INO80	0.944	282-303	RGRGRGGRGGGTGRARKSKEQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YND9	Chromatin-remodeling ATPase INO80	0.93	1481-1495	PAKKRKGTSKKAKTV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YND9	Chromatin-remodeling ATPase INO80	0.919	164-178	KERKKDQQRKRRREK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YND9	Chromatin-remodeling ATPase INO80	0.848	439-491	VAARAKRAMREMLGFWKRNERDEREGRKVAERAELDKAKKQEAEREANRQKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YND9	Chromatin-remodeling ATPase INO80	0.665	116-120	KRKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBL0	WD_REPEATS_REGION domain-containing protein	0.962	317-328	LQRKRRRRREKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCD8	Uncharacterized protein	0.866	421-440	QRKARKVKAETAASKKPVRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCD8	Uncharacterized protein	0.7	192-199	RRRARARA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE42	Uncharacterized protein	0.996	60-83	PASAKKPKKVKEKQKERRAKRKEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF56	60S ribosomal protein L29	0.955	14-62	KKAHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG89	Polynucleotide adenylyltransferase	0.976	739-754	SKKQKKNKPKPNKMKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG89	Polynucleotide adenylyltransferase	0.962	72-102	PPRKRPLKDNKKKSQQGGRPPWQPRAFKPRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGL3	APH domain-containing protein	0.702	55-62	LRKKPPGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGV9	General transcription and DNA repair factor IIH subunit TFB4	0.988	353-363	VPKRKKKKKRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIH5	Uncharacterized protein	0.92	16-31	GRCRRRSRSRRRSRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJV0	TPT domain-containing protein	0.989	86-100	RKKRRRRRRQHTKPD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUX9	Uncharacterized protein	0.651	60-68	RAGPRLHRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1D1	Uncharacterized protein	0.994	447-516	RRGGRGGHRGRGADGEFRGRGRGGGNFRGNRGDGEHRGRGRGGFRGGRGEGEGRGGRGGRGRGGPRGGAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1D1	Uncharacterized protein	0.767	19-25	ARKKKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1E7	Uncharacterized protein	0.941	232-247	RPKGKPKGSRAKAKQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4M1	AAA domain-containing protein (Fragment)	0.998	567-588	KAPKKKKAATAKAGKKKKKARD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4M1	AAA domain-containing protein (Fragment)	0.976	598-611	EKPKKGKGKARANK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIK3	Uncharacterized protein	0.736	247-262	KRAKDAAKDKGKGSSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YII9	MFS domain-containing protein	0.601	349-349	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN71	UBA domain-containing protein	0.634	533-535	RKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBU4	Uncharacterized protein	0.998	136-188	GRTRGGLSRGRGRGGWKRLLKGTEHADLFEKPRGNPRGRPRGRGRGRGRGRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBU4	Uncharacterized protein	0.876	729-737	PKKRRRGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI23	Uncharacterized protein	0.894	335-344	KVKKRKRRLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ77	DUF2428 domain-containing protein	0.627	1566-1568	RKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQA1	Polynucleotide adenylyltransferase	0.74	1054-1062	KKGHKKSKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVJ8	Uncharacterized protein	0.616	36-37	KK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX16	PSP domain-containing protein	0.925	14-30	KARKPTKNELRRAKKKQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX16	PSP domain-containing protein	0.905	581-597	KRQKRDRERAAQRGGKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLV5	Uncharacterized protein	0.761	217-230	KLVRRRKAELSKGI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL61	60S ribosomal protein L36	0.983	67-90	NSKDKRARKLAKKRLGTFGRAKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBZ8	Uncharacterized protein	0.702	137-144	KEKKEKPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBZ8	Uncharacterized protein	0.639	11-16	AARKLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBZ8	Uncharacterized protein	0.605	7-7	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMJ3	Uncharacterized protein	0.696	44-54	DKKHKHSSGPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR22	Pre-mRNA-splicing factor SYF2	0.825	255-264	RLKKRRERGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTW9	Uncharacterized protein	0.649	47-51	KRRHK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVB9	Uncharacterized protein	0.793	211-221	RKDKKHRRVRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZG1	Uncharacterized protein	0.625	366-368	RKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2J9	Uncharacterized protein	0.912	331-342	PKRRRRRWSRGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3D0	Uncharacterized protein	0.757	88-114	KQTRAIRRRLSPEEAKLVTEKQKKKQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4W7	Uncharacterized protein	0.977	212-232	RIKEKTKRRNRHVRKVKSKHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q562	DUF2183 domain-containing protein	0.812	649-666	RKKPSPSPPRPPKPQGLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q562	DUF2183 domain-containing protein	0.608	687-689	RPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5B5	Uncharacterized protein	0.821	156-168	RRRKRQRVAGSRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5B5	Uncharacterized protein	0.808	1044-1063	RKRKAAGDDGREQRAAKKRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJF6	WD_REPEATS_REGION domain-containing protein	0.804	173-180	KSKKKKSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YHQ3	Uncharacterized protein	0.907	338-348	SLPKKFRKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKM8	Condensin complex subunit 2	0.772	210-218	KKSKKKTKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKM8	Condensin complex subunit 2	0.73	500-509	KETTKKPRKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKM8	Condensin complex subunit 2	0.653	572-580	PKAKLGARK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDM6	Uncharacterized protein	0.853	47-55	KPKKKRRII
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGJ3	Uncharacterized protein	0.897	23-43	KTKRKSLGKAPPLKRIRTIPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL36	Uncharacterized protein	0.934	240-272	KSKASKAPTKAASKAPSKAPSRAPTKASSRRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL36	Uncharacterized protein	0.901	317-332	RRFKKGKTRMPKRLVR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL36	Uncharacterized protein	0.819	191-204	SIHRRRPPKSERSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTK0	Uncharacterized protein	0.995	374-397	SQKRMKSGGKGGKPRPGKSKRAKM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTK0	Uncharacterized protein	0.986	327-362	RAAKRAKSAADGPNRKRQKKDEKFGFGGKKRFSKSN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTK0	Uncharacterized protein	0.83	252-274	ARKKASADARRQRDLKKFGKAVQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTK0	Uncharacterized protein	0.81	10-24	QKKLQKEADKRKRQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTK0	Uncharacterized protein	0.682	53-62	RKKESKAAKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q134	Nascent polypeptide-associated complex subunit beta	0.874	17-30	GKGTPRRKVKKVHK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3E4	mRNA cap guanine-N7 methyltransferase	0.963	13-50	RRGGPPKRKRETPASRAAKTSRNGTPNAFARRSPPREP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3E4	mRNA cap guanine-N7 methyltransferase	0.922	62-99	RSPPRKLKRPGAGARVSQANREAIERERKQREEATRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q558	DUF3074 domain-containing protein	0.993	430-465	EKKLKKTEDKHRRELEKLEHKKAKELRKVEEKRRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5D0	14_3_3 domain-containing protein (Fragment)	0.67	158-163	GRKRAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XG60	C2H2-type domain-containing protein	0.712	387-405	KSGNKTKQKHFKPDVPGRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJN9	SWIB domain-containing protein	0.999	164-189	STRGGGAKRKAPIKKEKKAKKKSKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJN9	SWIB domain-containing protein	0.849	131-141	PKKAKKSKAPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCN2	CUE domain-containing protein	0.974	271-293	RGGFRGRGRGRGGRGRGRGGNVA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCN2	CUE domain-containing protein	0.925	304-332	AQKRKEANKSSRANHSRRDQRAKKMARGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCX2	Uncharacterized protein	0.909	754-763	REKAKRQRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCX2	Uncharacterized protein	0.799	697-727	YKRERKGALRELRKDANFIAREQLKEKRAKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCX2	Uncharacterized protein	0.614	47-48	RK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCX2	Uncharacterized protein	0.604	732-733	KK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDM1	Ubiquitin carboxyl-terminal hydrolase	0.841	187-212	KYKKSVAVAKARETKRAKQAAKTQLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDM1	Ubiquitin carboxyl-terminal hydrolase	0.69	302-309	SGRARRPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKI8	Uncharacterized protein	0.735	73-77	KRKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMD1	Uncharacterized protein	0.7	247-251	GKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMD1	Uncharacterized protein	0.686	196-200	ARKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMJ9	AP_endonuc_2 domain-containing protein	0.999	328-366	RKGEPERRRIMGQVEKKREKDAKKAGKGGKKKEGKKGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN60	SAS4 domain-containing protein	0.936	545-560	AREKRRRKRESAVNAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN60	SAS4 domain-containing protein	0.693	316-324	HKRAERKEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN60	SAS4 domain-containing protein	0.621	163-165	PRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRJ5	GTP--RNA guanylyltransferase (Fragment)	0.734	378-394	RAWKAREQRQKDERRRH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRW3	Uncharacterized protein	0.965	705-730	KPKKVSKKKTSTRKMTTTKKQKAPRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRW3	Uncharacterized protein	0.716	441-447	PAPKKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSD2	Cytoplasmic tRNA 2-thiolation protein 1	0.825	378-395	RQEKKANRKPNRDAPPPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVJ9	DNA polymerase	0.668	34-50	KKRKLEDSKPAFRQPGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ45	Nucleolar protein 12	0.978	423-454	PMLPRKLRVSRAKAQKRNPKPGSDRPAARKAN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ45	Nucleolar protein 12	0.871	110-117	KSKRKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ45	Nucleolar protein 12	0.868	525-562	KQGKTGLKLGGKHNKSAGGKNTKVTSRSSAFKAKKKAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ45	Nucleolar protein 12	0.685	358-362	KRKRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZB3	Uncharacterized protein	0.993	190-220	RKREKRRRKAQNQKTHRAKRAEELRKQQRDQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZB3	Uncharacterized protein	0.68	154-160	RREKKER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIK8	Zn(2)-C6 fungal-type domain-containing protein	0.757	87-92	KKKRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJR9	Ribonuclease P protein subunit	0.72	62-76	KALRKTNKPRPLSAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKQ9	RXT2_N domain-containing protein	0.822	505-516	RRRPGRGRRVNR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGD8	Uncharacterized protein	0.999	471-564	LKAKKKKDDAQKKHDEHDIEKKAKHDAEKKKHEAEEKAKHDAKKAKDDAEKKKHDAEKKAEKKKHDAEKKAKHDAKKAEEKAKHDAKKVEEEAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGD8	Uncharacterized protein	0.962	580-613	KDKHDAEKKAKHDAEKAEKKAKDDADKAKHGTKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIY2	CMP/dCMP-type deaminase domain-containing protein	0.968	243-268	PAKSRPAEKEKPKEKLRPAGPRVEKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNV3	VASt domain-containing protein	0.964	554-569	PPVKGMPRKGRRRGRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNV3	VASt domain-containing protein	0.732	88-98	RSKLSGRRKHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSR0	Ubiquitin-like modifier HUB1	0.978	124-184	RKDKRYRDRSPRRSGDHGATNSYRPDKPRDEGKDKKELDEKGFPIFKDPKPKKDKKDKKLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSR0	Ubiquitin-like modifier HUB1	0.892	54-74	ARDAKPKKQKSSGGFKWKDKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT43	Uncharacterized protein	0.772	161-182	RVRRKMTAAEKIEYRKRRIVKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT43	Uncharacterized protein	0.664	187-191	AKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUW1	OTU domain-containing protein	0.756	22-32	KKKQASKKTRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUW1	OTU domain-containing protein	0.714	111-121	KKRNRQKDRLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1B3	Uncharacterized protein	0.728	43-50	RRPRRRMS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Z0	Uncharacterized protein (Fragment)	0.617	114-117	RAKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3I3	Uncharacterized protein	0.809	828-838	QGKEKKEKRPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLN3	Uncharacterized protein	0.991	149-168	PTKKPKAAPRKKATPKKAKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLN3	Uncharacterized protein	0.94	85-106	APAKPTAAPAKPAATPKKRGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLN3	Uncharacterized protein	0.691	127-137	KKVKSTPRKNK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLL8	Uncharacterized protein	0.67	246-254	RIEREKRER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFC5	Uncharacterized protein	0.677	70-74	KKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL75	Uncharacterized protein	0.673	379-386	KKLRRQRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLJ5	SET domain-containing protein	0.939	631-651	GRKPKPQRGPGRPPNKVVKRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLJ5	SET domain-containing protein	0.91	559-586	RKKLAKEEEIFKKQEEERAGKQAKKKRH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLJ5	SET domain-containing protein	0.899	125-139	LKRAPSKSHKKKVKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLJ5	SET domain-containing protein	0.761	481-487	LKGKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLJ5	SET domain-containing protein	0.614	170-172	AKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYB3	Uncharacterized protein	0.646	18-21	AKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZH4	Uncharacterized protein	0.68	245-254	KRKTKANKQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1R6	HTH La-type RNA-binding domain-containing protein	0.942	163-181	EEGKVRRGKKEPKEPKDSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1R6	HTH La-type RNA-binding domain-containing protein	0.809	390-413	PRGPNGERGGRGGNGARGRGGFRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1R6	HTH La-type RNA-binding domain-containing protein	0.793	585-596	SRGGKRGGRGRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2R3	40S ribosomal protein S6	0.881	154-203	RKFVIRREVQPKEGKEGAKPYTKAPRIQRLVTPQRLQHKRHRIALKRRHA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2R3	40S ribosomal protein S6	0.866	225-241	KAKQAEMRKRRASSMRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2R3	40S ribosomal protein S6	0.794	131-144	KRLGPKRATKIRRF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2R3	40S ribosomal protein S6	0.642	91-94	ERKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2X6	ANK_REP_REGION domain-containing protein	0.934	667-688	APRRKNGRKLMSKKELRAARGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2X6	ANK_REP_REGION domain-containing protein	0.932	211-240	PNPRKRKHRASSVSLPNKRPSLNAPKRRLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2X6	ANK_REP_REGION domain-containing protein	0.851	319-341	RPRRGIGRSTSTPGRPAGRKPKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2X6	ANK_REP_REGION domain-containing protein	0.816	42-63	KRLKSSPRRPASSGKSASPRMK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHP3	Uncharacterized protein (Fragment)	0.986	23-57	EKKGPSKNELKKMAKEKEKAEKAAKRAAEEEAKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI43	Flap endonuclease 1	0.993	356-391	EKASLKRKNEEKMANAKKQKKEADKAKKEAKAKPKM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK86	Zn(2)-C6 fungal-type domain-containing protein	0.73	87-95	KRKKTSGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK86	Zn(2)-C6 fungal-type domain-containing protein	0.675	668-674	RQHRKPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKW7	U6 snRNA phosphodiesterase	0.673	22-27	PPAKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMF2	AD domain-containing protein	0.941	206-236	KKIVEGEKRKLREKEDKERKAATPTGTRKGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN18	Chitin synthase	0.825	80-98	RGKSRSGSKRQPNKLSRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPF3	Uncharacterized protein	0.993	547-587	RRKKATPLKNTKKRRHAKGNTVRGASKPPARNATAASRSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPF3	Uncharacterized protein	0.737	504-514	KKRAPMRPRNR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPF3	Uncharacterized protein	0.702	116-124	SKRPARPGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPF3	Uncharacterized protein	0.657	326-330	AKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPF3	Uncharacterized protein	0.655	59-64	KRGRAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQQ3	Uncharacterized protein	0.833	1005-1014	AKKRSRRVAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQQ3	Uncharacterized protein	0.747	845-856	KPKAPSTKRKSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQQ3	Uncharacterized protein	0.701	63-71	SRKKLRFGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQQ3	Uncharacterized protein	0.695	809-817	PKLRRLKPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQQ3	Uncharacterized protein	0.623	656-660	RRSGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRE8	U3 small nucleolar RNA-associated protein 11	0.899	18-49	QPTERKKWGLLEKRKDYKLRAADHKTKQRKIK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRE8	U3 small nucleolar RNA-associated protein 11	0.787	199-205	RRKKRHA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRE8	U3 small nucleolar RNA-associated protein 11	0.627	256-258	RKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRN0	Zn(2)-C6 fungal-type domain-containing protein	0.774	315-323	ARPLKRKRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWN6	Uncharacterized protein	0.836	48-62	PRPKYRAPPKKEHKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0C9	POP1 domain-containing protein (Fragment)	0.948	49-87	KKALTKRAFQQVPKDMRRRTASHNAKRVPKRLQPRAKRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2D4	Uncharacterized protein	0.69	301-313	RPTRAYRSQRRRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4I1	Uncharacterized protein (Fragment)	0.824	338-348	PATPPKKKAKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4I1	Uncharacterized protein (Fragment)	0.692	435-449	GVKWVKKAMRVFRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4I1	Uncharacterized protein (Fragment)	0.677	16-21	PLKKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4I1	Uncharacterized protein (Fragment)	0.637	425-428	RRHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YII0	COP9 signalosome complex subunit 2	0.916	480-494	PHAAGKRKPNRAPGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNM2	Methyltranfer_dom domain-containing protein	0.72	238-247	RNKKAFRKGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YP74	Uncharacterized protein	0.763	1001-1013	RRKNEKAWRKGTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG24	Uncharacterized protein	0.672	28-34	KKPRARA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ18	Uncharacterized protein	0.687	411-415	SKKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUA3	Peptidyl-prolyl cis-trans isomerase	0.951	400-463	GPRRRSRSRSQERGTGRNARRYQSRSRSPKRHNQHDPAKGVERYREDRTRQRSRSGDRYRNGRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVZ8	Uncharacterized protein	0.91	302-313	PPKRRPKRSRAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXW9	Uncharacterized protein	0.776	297-305	KPKKRDGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0M1	PHD-type domain-containing protein	0.727	15-22	RLRSRKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0T4	Uncharacterized protein	0.858	805-819	DRWHRKVVRKSKKSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1C1	Uncharacterized protein	0.994	654-691	KRPKKPKAPKPATKKTERVHVPQKSKVAPVKAKAPKKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1C1	Uncharacterized protein	0.977	783-805	RGARRGGGGGGGAASKKKKHKPM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1C1	Uncharacterized protein	0.742	405-418	KKASPKPPAPAARR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1C1	Uncharacterized protein	0.604	478-479	PK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q527	Uncharacterized protein	0.874	24-37	RHRRRRKEEAKGER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5D7	Uncharacterized protein	0.797	139-146	NPHRKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMD8	Histone domain-containing protein	0.992	16-68	PGTPRTPLGAGRGGRGGKGGRGSRGGRKSTSSTRNDGTPRKKRRYKPGTKALK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC77	THUMP domain-containing protein	0.73	18-30	KRSKTKKEWRVPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGG0	Uncharacterized protein	0.667	128-132	LKRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGZ4	F-box domain-containing protein	0.785	130-143	KPKSDRSKVRPRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIT0	Usp domain-containing protein (Fragment)	0.92	189-197	SREKKKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKE7	Glycoside hydrolase family 16 protein	0.611	451-454	RHGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL72	Zn(2)-C6 fungal-type domain-containing protein	0.632	44-48	PKGHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNZ1	Uncharacterized protein	0.976	173-191	SRERRKRRRPNAPVKAARR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0C2	Uncharacterized protein	0.899	188-214	KSKSTKAAPTTKRKDKAESAKKAPAAH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q153	Uncharacterized protein	0.823	378-399	RRPSSSKGRPWSSRSLRKGRAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q153	Uncharacterized protein	0.614	1045-1046	KR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3C4	Uncharacterized protein	0.815	483-492	RRKLQKKRRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y027	Uncharacterized protein	0.932	3-14	KKRRRLRKNSKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YII5	Uncharacterized protein	0.759	1274-1280	KKAKKKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKK5	J domain-containing protein	0.95	245-271	RKQKREMERQRKKEGKNPVKSARAVAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKK5	J domain-containing protein	0.809	399-407	RKRKSKARL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKK5	J domain-containing protein	0.797	87-100	KPKVGKKGDKPKVH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEG3	WD_REPEATS_REGION domain-containing protein	0.969	147-187	KSARRKRHSRHGSKGQKAIEAAAEEPAGPPKLHKLRRERDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEG3	WD_REPEATS_REGION domain-containing protein	0.952	306-322	KPKESPSKPRRKKTSRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF96	Uncharacterized protein	0.771	111-127	RKRQRQKAADKTRKVQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF96	Uncharacterized protein	0.745	236-249	RRHRHMPKPEKVKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFH5	Uncharacterized protein	0.997	513-546	RKRKEEKEAQKDAKKRAKADKKEEKKAEKAVRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFH5	Uncharacterized protein	0.772	60-80	TKQEREARRMEKERLARLKER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL83	SWIRM domain-containing protein	0.962	152-165	KRKRGRPRKHPLPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL83	SWIRM domain-containing protein	0.918	491-506	KAHKPAARRGRRRNAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM49	Uncharacterized protein	0.971	724-738	RERKATRKKKNKPKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM49	Uncharacterized protein	0.602	712-712	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP74	UDP-N-acetylglucosamine transferase subunit ALG14	0.8	34-42	PHPRRRRRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUM9	LigD_N domain-containing protein	0.937	259-269	SKKPARKRRRQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0S7	Uncharacterized protein	0.995	190-227	TRHPPPRASTKRKAGGGGGGPPRKKSPNKSKSSPGDKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0S7	Uncharacterized protein	0.942	134-151	KKWKSSRLRQRVKRRRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q255	Uncharacterized protein	0.972	189-278	RKEREEDERKKNEKRAVDDYERKIREATQKREADERRWKEDIERKAREAKDKQAAEEQRIKDKIEKGAREKKEKDAAAYRAFKEKERLEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q255	Uncharacterized protein	0.816	293-304	KEREVKKKREAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q255	Uncharacterized protein	0.714	444-451	RRRSKSRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q255	Uncharacterized protein	0.601	176-176	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XZI8	Uncharacterized protein	0.976	193-213	ARKNKKKAIKAKESRATGRRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEP7	HRDC domain-containing protein	0.95	690-708	EREKIERKAAKRAAKKAAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEP7	HRDC domain-containing protein	0.908	740-779	ERGQSAKERKKQQKQKNPYAKALDAPKGMPRNQKEGPGRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHB4	Uncharacterized protein	0.998	691-715	QKAGGGNKPGRKGKKGDKVKKKRSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHB4	Uncharacterized protein	0.982	8-32	RRPTGRLASLKGGPPKRRGPPKKPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHB4	Uncharacterized protein	0.863	530-540	PPKRSRGRPRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHB4	Uncharacterized protein	0.633	350-354	RRRAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHD2	CoA carboxyltransferase C-terminal domain-containing protein	0.718	43-49	RRRRKDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLP0	Uncharacterized protein	0.682	179-185	KLKRRLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM74	Uncharacterized protein	0.736	192-198	RRRKRQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN70	Uncharacterized protein	0.793	19-30	KRSTKRRVKRAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPX7	Uncharacterized protein	0.998	56-81	RKSRGKGRPKKKCRLTKAKKPKKEKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQT6	Uncharacterized protein	0.8	389-397	SKKRQKRRQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUD2	Tryptophanyl-tRNA synthetase	0.858	478-497	KGQRKEQKLAEKKREKEEQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVT8	Uncharacterized protein	0.873	299-308	KLKKAKKSRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXJ9	RRM domain-containing protein	0.757	416-435	KKAAEEKKEKDAAARAARAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXJ9	RRM domain-containing protein	0.668	276-291	RLREAGPPGDRRPSAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXJ9	RRM domain-containing protein	0.646	299-306	AGSRPPRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXJ9	RRM domain-containing protein	0.604	296-296	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0H3	Uncharacterized protein	0.908	18-33	PRKRASRHRGKVKSFP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0H3	Uncharacterized protein	0.742	124-136	KSKKKAFTKYAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0H3	Uncharacterized protein	0.671	238-245	KLPRKTHK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMD4	Uncharacterized protein	0.705	181-186	SKRRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMT7	Uncharacterized protein	0.636	41-54	KASRQLSKIQRNRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBS0	Uncharacterized protein	0.784	188-196	RKRKQKKAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDT0	Ubiquitin carboxyl-terminal hydrolase	0.718	573-591	TKKELKQEEKEAKVAKKAQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDT0	Ubiquitin carboxyl-terminal hydrolase	0.609	605-605	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEC9	Uncharacterized protein	0.905	169-176	KKKKKRPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEC9	Uncharacterized protein	0.708	378-385	PKKSRGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFU6	N-acetyltransferase domain-containing protein	0.857	292-315	RKKNKKAWRGFIRAWTVKLKYRGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFU6	N-acetyltransferase domain-containing protein	0.748	379-385	RGHKKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM63	Uncharacterized protein	0.961	758-803	PKKRPGTSHSKTEKTEERESRKDDKPAGRQRSRSIWGRSKKEKPPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMA7	Cir_N domain-containing protein	0.996	306-338	RHRRRGHHHHRHRRHSRSRSGERDRHRSRHRPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMA7	Cir_N domain-containing protein	0.863	84-93	RRERKRRRLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMA7	Cir_N domain-containing protein	0.751	159-166	EKVKKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMA7	Cir_N domain-containing protein	0.738	266-278	RAGRCRKERHRHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN85	Uncharacterized protein	0.904	602-624	RTKPKGRGRPPASIGGPEKGQKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN85	Uncharacterized protein	0.792	452-459	ARKKRKIK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUS7	Uncharacterized protein	0.762	471-479	KRRGARRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUS7	Uncharacterized protein	0.683	255-259	KRRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUS7	Uncharacterized protein	0.653	227-235	SRSRSRSRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUS7	Uncharacterized protein	0.626	304-308	RLRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0I4	Uncharacterized protein	0.65	349-356	RRLRNRER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2Y0	Phosphodiesterase	0.88	899-917	RHSRSRSRLRLKFWKRRRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q319	Clustered mitochondria protein homolog	0.922	937-948	SKKKKKKQADKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCR7	Uncharacterized protein	0.98	971-980	AKKKRKRRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNJ6	Uncharacterized protein	0.982	375-392	AKRKGKGKDKKVNKGGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNJ6	Uncharacterized protein	0.94	16-28	KPSGPKGKKSKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNJ6	Uncharacterized protein	0.852	72-79	QKRRRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPB7	Uncharacterized protein (Fragment)	0.967	362-389	FREEIKAKRIAKIKSKSYRRVHRKERER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPX4	Uncharacterized protein	0.956	129-163	RDSRRRISVYREAPPRDERRRRGSSTGSRRRPSRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPX4	Uncharacterized protein	0.799	185-206	RSSRKRSISPTRRDVRRSRSRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPX4	Uncharacterized protein	0.605	99-100	KR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVY2	Uncharacterized protein	0.788	489-503	KMGRGAKKSARSIKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXI4	Uncharacterized protein	0.926	44-60	QSKKRKRDRQHERALKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYV5	DNA ligase	0.727	679-689	RKQRTNGKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYV5	DNA ligase	0.637	54-56	RKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4A5	Dolichol phosphate-mannose biosynthesis regulatory protein	0.742	80-89	RKKALKAKQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4P2	Uncharacterized protein	0.643	206-210	RQRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y8	Mitochondrial import inner membrane translocase subunit TIM54	0.952	109-123	RHKTAERIRKKRRRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y8	Mitochondrial import inner membrane translocase subunit TIM54	0.95	254-272	KKKQEDAKKKKEEDKPKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WHJ7	MYND-type zinc finger protein samB	0.622	68-71	RRLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI61	Uncharacterized protein	0.72	347-353	KRGKKHK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIS8	RING-type domain-containing protein	0.793	611-620	RIRRRRWRAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC99	Csm1 domain-containing protein	0.986	41-70	RSTKAKPTARRVSVGKPAAKRKTAPKRTRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC99	Csm1 domain-containing protein	0.917	133-147	KTKAPAKRGRPAKRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC99	Csm1 domain-containing protein	0.712	103-109	PKAKRAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDL2	SAP domain-containing protein (Fragment)	0.79	44-51	KRPGKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJS7	W2 domain-containing protein	0.763	429-437	VSKLKRKRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJS7	W2 domain-containing protein	0.731	4-15	KGKKGGGKDHSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLR7	Mtf2 domain-containing protein (Fragment)	0.644	48-52	KKHKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNG7	Uncharacterized protein	0.765	119-141	EKKKSSKSPDSNAKSPPGANRKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSA7	Uncharacterized protein	0.828	68-96	PPKLQRRRSQKDGRSQGSHFEKARRKSLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSA7	Uncharacterized protein	0.678	433-438	KKVRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSA7	Uncharacterized protein	0.662	315-321	KGRLKKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSB3	Signal recognition particle subunit SRP72	0.996	545-599	RKRPAEDIKPKKAKKIRPSRMPKDFDPNKKPDPERWLPLKDRSTYRPKGKKAKAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSB3	Signal recognition particle subunit SRP72	0.975	632-647	GGGGANKKKKGKGGKW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSZ3	Uncharacterized protein	0.966	664-694	SLRRGNDRKRKREEDNARREKERQEKAEAAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSZ3	Uncharacterized protein	0.881	934-950	KPKKEKAKAAARELKGL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVG2	FCP1 homology domain-containing protein	0.94	157-169	IAKKKAKKEAKKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVH4	DNA-directed RNA polymerase III subunit RPC6	0.899	194-224	EPSRKHKVKKEPSPPVLGAEDKGDGSKKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q069	Endopolyphosphatase	0.998	619-637	RYKHKHKKGKKRKQKYRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q069	Endopolyphosphatase	0.978	393-413	ALGRKRDRKDFKRKQKKYLKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q069	Endopolyphosphatase	0.937	540-559	EGKHKGKKPHDKDHTPRPKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q069	Endopolyphosphatase	0.643	477-481	KKHKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0A2	Zn(2)-C6 fungal-type domain-containing protein	0.667	64-74	KLRRLQKEKSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3J0	Uncharacterized protein	0.664	64-77	KGKQERRELQKQRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKP0	Uncharacterized protein	0.611	637-638	KK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WM25	E2 ubiquitin-conjugating enzyme	0.877	181-199	ENKRKLEDKEKKRVERQRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCK4	F-box domain-containing protein	0.814	74-90	SKKTERMQKRMQKKLRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEA8	Uncharacterized protein	0.932	987-1009	KLKPKEREQPKDEKKKGFKALKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNR3	ECM11 domain-containing protein	0.676	77-86	KAARQDKRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV99	SPRY domain-containing protein	0.858	42-57	PIERERREKKESLKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV99	SPRY domain-containing protein	0.726	272-285	KFFHSKKTKTKGAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWT7	Uncharacterized protein	0.947	219-229	EKKKKKKGQGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXD3	tRNA-dihydrouridine synthase 3	0.989	366-397	KKEKTENGRKSKKQKKAERLGQKQNGTKKTKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0N2	Uncharacterized protein	0.983	1337-1347	EQRKRKRKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0N2	Uncharacterized protein	0.974	1369-1391	PREKAKSKTKTSEGSGRRRKKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0N2	Uncharacterized protein	0.904	84-100	KRQTIRARKARREGRRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0N2	Uncharacterized protein	0.809	1276-1300	PRKRAEGSKRMGSALSKMAQKAKRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0N2	Uncharacterized protein	0.677	397-405	RRRIATKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4B5	Uncharacterized protein	0.75	660-673	GKHGRGAGRMKKQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4B5	Uncharacterized protein	0.698	118-130	KQESKSKTKSKPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4B5	Uncharacterized protein	0.625	21-25	RKAPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y3	Uncharacterized protein	0.918	17-36	KKTSKHRKPPATPAKGNKKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJU5	Rad60-SLD domain-containing protein	0.996	40-73	IEREARRKQKEKDKEERRKAKQEEKRRSSSEKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRG5	Btz domain-containing protein	0.972	36-54	KSAGKKARKSRKQSAKKTG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRL0	Uncharacterized protein	0.877	184-194	KVKKGRGKGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRR8	Non-specific serine/threonine protein kinase	0.772	874-885	GREKRHRFSKRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT92	Uncharacterized protein	0.676	331-340	KPLAELRKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWE0	Uncharacterized protein	0.998	718-756	KVRSKAEIKEREERKKRKAAEKAAQKAARARKREERRQL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q491	Uncharacterized protein	0.813	791-810	RPRWKAFRKRIFGHHSRNKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q491	Uncharacterized protein	0.688	45-51	KPKGKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4I8	Protein kinase domain-containing protein	0.96	560-580	SRKKGRDRSPKAKEKERGVLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLJ6	Uncharacterized protein	0.801	52-66	KRKDQPASQRKKKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJW7	Uncharacterized protein	0.983	161-177	KTGRPRGRPKGKRRERT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJW7	Uncharacterized protein	0.851	462-470	RPPKKKKPV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD76	Uncharacterized protein	0.823	184-199	KREARRDAQRRKRVER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE67	Uncharacterized protein	0.756	44-55	FRKTLKKQHKKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL57	SHNi-TPR domain-containing protein	0.961	48-58	GSGKPKRKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL57	SHNi-TPR domain-containing protein	0.957	375-397	KKKKPKPAAAAPVVEGKGKGKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPA1	Uncharacterized protein	0.788	62-87	PKKRKAENCAVKRESSKKSKNDPRHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQJ1	Uncharacterized protein	0.79	218-241	RFRRREDRPEPERDALGRRKWPEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQJ1	Uncharacterized protein	0.722	21-38	RKSRFDRRSRSPAADGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRH8	L-type lectin-like domain-containing protein	0.665	274-278	KKGRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVF2	Poly(A) polymerase	0.956	550-562	KKPTKKKSKKAKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYK6	Uncharacterized protein	0.959	80-100	KKTKSAASTPASKGKKRGKKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYL8	Uncharacterized protein	0.87	113-129	AKKRKPNGESLPKRLKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3W1	Uncharacterized protein	0.947	1527-1549	TSKRNRARGGRSGRGGKGTSGKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4C5	Uncharacterized protein	0.703	122-131	KERKRHVPPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJ18	Aspartate--tRNA ligase	0.986	23-57	EKKGPSKNELKKMAKEKEKAEKAAKRAAEEEAKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH73	Uncharacterized protein	0.995	50-63	REKAKKRKKNKKKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH73	Uncharacterized protein	0.745	458-490	RKEPHKRLGGAMPKDVKTLKAHRFFRKIDWKKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJM2	Uncharacterized protein	0.999	490-567	LKKALKRKEKQKGKSAEEWRERQDNVVKGKEIKQKKREANLQKRKDDKGSKGNKKKPSGGKGGGKRKGRPGFEGRFKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJM2	Uncharacterized protein	0.998	124-159	VAKRKAYVEKRKEKREKNKDKKLKKAEKAEAKRAAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJM2	Uncharacterized protein	0.989	324-374	RKRIDELRARRKADGGEGKPAKSRQELLEQRRKKEEQRKAHKKELRQKSKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJM2	Uncharacterized protein	0.93	52-72	RKKQTKEQKKAAKKAKLDPAN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJM2	Uncharacterized protein	0.828	80-89	MKDREKKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKZ3	Uncharacterized protein	0.842	108-135	NKRRKRPAGVTALSDSKRIERPVRRPRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL88	Uncharacterized protein	0.94	513-556	GKPKAKTLKLPKSKSHLSRDKSRDAFYPKFPRMKSSRKGQKKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPU2	Carboxypeptidase	0.683	543-547	RRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTV6	Uncharacterized protein	0.777	773-790	KGKKRASSADAKSAARGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTV6	Uncharacterized protein	0.626	159-168	KRLRASMGKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTZ9	Uncharacterized protein	0.996	111-154	KRSSSPGKRASPRKGTPAEPKKSVRKRKGTPIRDIRPARPPPQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTZ9	Uncharacterized protein	0.984	36-59	PVRRQSSKKRSPSPRKVGRPRKHA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTZ9	Uncharacterized protein	0.849	578-587	PKRRGRPPRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV44	Phospholipid-transporting ATPase	0.898	698-713	KRQPSKGKRPAWRPRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXU1	J domain-containing protein	0.886	476-493	KREKKDDKKKEQQHKKHG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXU1	J domain-containing protein	0.831	232-244	KKLREKEKRRGGL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYS3	Uncharacterized protein	0.907	130-141	PPKRKRGRPTKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYS3	Uncharacterized protein	0.629	225-227	RRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ96	Uncharacterized protein	0.726	1093-1100	RKARKTKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3P2	PX domain-containing protein	0.61	949-950	RR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG16	WD_REPEATS_REGION domain-containing protein	0.841	179-187	KKDRKAKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKD1	Uncharacterized protein	0.877	136-147	KWKRIRRKPRPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLD1	Uncharacterized protein	0.855	238-253	RRAKRKLRDAKAKDEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLD1	Uncharacterized protein	0.678	73-78	KRRRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLD1	Uncharacterized protein	0.64	150-155	KTPPRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ40	Uncharacterized protein	0.725	175-182	PAPRKPKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQW7	Protein kinase domain-containing protein	0.6	227-227	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRN7	Glycoside hydrolase family 17 protein	0.89	220-226	KRKKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS93	Phospholipase D	0.944	263-273	RPRRRRKSRRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS93	Phospholipase D	0.74	1805-1814	RKGRRRGTTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW94	IPT/TIG domain-containing protein	0.924	406-417	ERKRAGRKKTKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX31	Uncharacterized protein	0.809	217-233	KKSANSRTPKGKPASKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX31	Uncharacterized protein	0.723	77-101	RDAHKSGRPKPTTYSTKKPPVSRKQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZZ1	Uncharacterized protein	0.926	131-151	RVDKKKLEKAERKLRAKQDKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5C5	Uncharacterized protein	0.864	1256-1274	KAKKRYCEKVRKGKHRSGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM06	Uncharacterized protein	0.952	457-485	KSKKQPLAPKPANDGNIRRKHAGRPRKQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM06	Uncharacterized protein	0.893	554-564	VKKREKKSRKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM06	Uncharacterized protein	0.734	535-540	KRKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVC4	Uncharacterized protein	0.927	404-416	GKKPAPPRKRRMK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVC4	Uncharacterized protein	0.708	381-386	KKRRGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVC4	Uncharacterized protein	0.663	139-147	RQRRNREKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXN2	Uncharacterized protein	0.966	137-156	RPKKELPKRGRPAKNAKGGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXN2	Uncharacterized protein	0.838	534-544	NSGRGRKAKKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXN2	Uncharacterized protein	0.772	31-45	RRKQDEKRERKLAAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXN2	Uncharacterized protein	0.743	506-525	KRKAAKGAATPNKSAKTSRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXN2	Uncharacterized protein	0.669	97-103	KKRAQKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXQ1	Uncharacterized protein (Fragment)	0.962	162-195	REAKYKEDQKKRAKREAQEQKKKELEMLKKKQEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXQ1	Uncharacterized protein (Fragment)	0.959	206-256	EQKRRAEREAWKAAEKERDRERIRKINEDRELAKKKLEDEKKAEQEERERR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYK5	Cation_ATPase_N domain-containing protein	0.681	247-257	RKKGSRVRPVK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZJ2	MYND-type zinc finger protein samB	0.621	304-306	PRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZX6	Uncharacterized protein	0.994	1017-1041	KKAKKLTSAELRKKKKDRMARRKRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0J9	Uncharacterized protein	0.996	14-45	KAEKLAAAKKRFEQLKKEQAKKGKKGSKKKAD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1J2	MI domain-containing protein	0.99	682-817	RSRSRARSKSRSPPSRAVRGRSYSRSPTPRKSSGTTAASRSPSRSPVRRRRSASSESRSPPPRRNGRAPASVSRGPPTRRGRRDNSYSRSRTPPGQRRSLSDYSRSPPRRVRSDSRSVSRPRGKGSSGKARSPLER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1J2	MI domain-containing protein	0.982	831-869	RSRSRSPPRHAPAPKRRRNTSSPESVRPRSPTRRKPVEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1J2	MI domain-containing protein	0.97	31-84	RKRSSISRSPSPRRNAPALRRRSHSRSRSPPTQNGHGKGPHPRDVDRERARERA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3A9	Uncharacterized protein	0.609	310-312	KAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q422	Uncharacterized protein	0.857	97-111	KGAERKKERGRMEKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDF1	Uncharacterized protein	0.899	210-222	RRKERRKRSFFRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFH6	RRM domain-containing protein	0.997	171-212	PKNAAKENQKKNQKKDGPKPAVNGEKKAGAKKSGRAGRPKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFH6	RRM domain-containing protein	0.949	20-43	RGPRRGKNGRLPNRKAAQKSKAAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFH6	RRM domain-containing protein	0.789	49-64	PSGGIQKKSKAGKPAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGF9	60S ribosomal protein L13	0.973	190-217	DARSEARLVGKREKRAKAKADEESEKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGF9	60S ribosomal protein L13	0.965	29-51	PGRKQRRRSARHEKAAKLAPRPV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH71	Uncharacterized protein	0.952	205-231	PRKQLKSLAKNKTESTTKRGRGRPRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQH7	Zn(2)-C6 fungal-type domain-containing protein	0.829	78-84	PRKRKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX80	40S ribosomal protein S25	0.952	8-23	GKKQKKKWSKGKVKDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ15	Uncharacterized protein	0.721	153-161	GKHHKRIRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q160	Nucleolar protein 16	0.965	7-26	KKKNRSGINKVRQKPKSKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2G3	DUF1752 domain-containing protein	0.847	403-418	KRKKLPGQKQKKAGSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3I0	BZIP domain-containing protein	0.7	49-55	KRKGGRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCI8	Uncharacterized protein (Fragment)	0.877	348-387	RKAEVRAGKPLKDDLKKVAPPKLKASKESSTSERPPSRGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDD8	SF3b1 domain-containing protein	0.726	203-209	PKRVRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDN2	WLM domain-containing protein	0.994	172-206	RRRGKKRKRGRQGGGGEPEKLSYAERQQKRIARKF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDN2	WLM domain-containing protein	0.845	235-253	KRGAGKPRVANSKRGRELR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDS9	MFS domain-containing protein	0.909	498-518	KPKSRLLKRARRNTFLARKRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJL1	Uncharacterized protein	0.984	115-143	KPIKGGKKPKGINKASKVNKPPKSAKAAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q199	ENDO3c domain-containing protein	0.935	36-68	GKKVSKGSSKVKATKKQEPPATPASSKKRSRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q199	ENDO3c domain-containing protein	0.708	444-459	HGSKKGGVSVAARKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1U4	Zn(2)-C6 fungal-type domain-containing protein	0.927	62-74	KDPSRPRRKKARR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q225	Uncharacterized protein (Fragment)	0.982	650-695	KKAKAAMKKKAKADAEKAAVKAAAAEVKEAQKVEKGISKKKTKAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q225	Uncharacterized protein (Fragment)	0.962	592-614	RPKKREVKKKKETLAGKSLEEKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q225	Uncharacterized protein (Fragment)	0.795	96-103	RKKGRGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q225	Uncharacterized protein (Fragment)	0.674	141-148	KKPAPRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q225	Uncharacterized protein (Fragment)	0.618	733-736	KGGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJ95	EGF-like domain-containing protein	0.614	132-135	KPPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XZV8	Uncharacterized protein	0.8	166-175	KPKQKRAKRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XZV8	Uncharacterized protein	0.629	267-270	KKGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJS2	Uncharacterized protein	0.608	261-262	RR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF88	Uncharacterized protein	0.763	12-20	RGPPRKPKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHF9	Uncharacterized protein	0.637	474-478	RLRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN80	Uncharacterized protein	0.82	25-38	RRIAKHSKRRFRHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX52	Uncharacterized protein	0.849	583-607	GRRKHGRRAEEEEGWWKFWKRWGRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY97	Uncharacterized protein (Fragment)	0.949	108-127	PAKKKQKKTRDGEKGDKKLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY97	Uncharacterized protein (Fragment)	0.92	1469-1477	RKKRKRNKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY97	Uncharacterized protein (Fragment)	0.833	6-44	RKAVADERPSKKVKPADDKENVKEQKSRKSGDGEKREPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY97	Uncharacterized protein (Fragment)	0.776	1731-1738	KMKKRRAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1A2	Uncharacterized protein	0.917	451-476	LEQRERRREKRLDRDVRRVQRGREPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1A2	Uncharacterized protein	0.758	176-183	RRPRKKAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3B8	Uncharacterized protein	0.864	110-131	GGKGNRATARGRGRARGHSENR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3B8	Uncharacterized protein	0.705	258-268	EREKNRQRKLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3B8	Uncharacterized protein	0.615	249-250	RK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4J4	GN3L_Grn1 domain-containing protein (Fragment)	0.996	4-46	GKPKSKRVPVRLRHKIQKASANKQRKERKDAKKNPQWRSRLKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKX3	G-patch domain-containing protein	0.999	378-439	SEEGRRRRKEKERRRRKGRERDGRDDDHERERSRRHGDRDDRHRDGDRDRRRDRSRDLDRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKX3	G-patch domain-containing protein	0.898	78-91	RDWKKAANKRKRQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKX3	G-patch domain-containing protein	0.765	360-373	SRRRDKDRDHRRRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKX3	G-patch domain-containing protein	0.745	331-340	RKERDRRGKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKX3	G-patch domain-containing protein	0.682	346-353	SRDRRRER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJW1	Uncharacterized protein	0.996	69-172	PPAKRRKLTPSEKLEKQHAKEVAERERTAAKARKEEEKRVKDEEKRRKDEEKAEAKRAQDEEKRRKAEEKEAKKREKELDEQRKTQEKEAKKREQEEEKLKKER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJW1	Uncharacterized protein	0.625	381-385	RRKVR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLZ3	Uncharacterized protein	0.933	47-56	ARRRRPKRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLN7	Ubiquitin carboxyl-terminal hydrolase	0.722	74-80	RTRKRKQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNB1	Uncharacterized protein	0.998	490-522	KDRKEKKKAAEKRRLLEKAKMKGRKNKKGAKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNB1	Uncharacterized protein	0.601	430-430	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRC8	Uncharacterized protein	0.61	176-177	AK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRX0	Uncharacterized protein	0.799	32-42	RSSRTKRKAPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUU9	HTH APSES-type domain-containing protein	0.962	463-484	AMKKRKRSAAGKETHKANKVKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV88	Uncharacterized protein	0.726	354-362	KRRKIKTSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV88	Uncharacterized protein	0.67	1409-1413	KKKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXW8	SH3 domain-containing protein	0.996	404-435	KKKDGKEKKKEKEPKKGGMLSGLFKSKKKDKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXW8	SH3 domain-containing protein	0.75	577-584	PKKAKRSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXW8	SH3 domain-containing protein	0.637	218-223	KKAMRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3N9	BZIP domain-containing protein	0.699	411-418	AARKSRAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5C1	Uncharacterized protein	0.972	395-444	RSSRSKKSKKAKSEVSSASKMSSKTKAKVKKEPSILRSMFKGRSKMKARE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5C1	Uncharacterized protein	0.846	47-62	RKKESENKEKERKARK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJV4	Ribosome biogenesis regulatory protein	0.99	147-187	RKKADEEENKRRPGKPSFQKKNPNGGDVERRDRKLKARKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJV4	Ribosome biogenesis regulatory protein	0.986	78-107	REKPVPKEKEKTKWEKFAEKKGIKGKRKDG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLL4	Uncharacterized protein (Fragment)	0.674	5-9	RKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XM81	C6 zinc finger domain-containing protein	0.811	23-31	ERDRKRRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEV3	Uncharacterized protein	0.801	21-33	KRGRGRGPKMEKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIE9	Uncharacterized protein	0.972	394-415	KEKVGKRDGQKKEGSRKSKKAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIE9	Uncharacterized protein	0.778	365-380	RGAAGRAKMKKEAEER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMB8	N-acetyltransferase domain-containing protein	0.861	206-215	RKERKRKVKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMY4	Uncharacterized protein	0.964	96-118	PSPRRQRRNRSAPEKRRPAMRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPW0	Uncharacterized protein	0.814	67-75	QKKRRRHQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSX9	Uncharacterized protein	0.606	219-220	RK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU68	RRM domain-containing protein	0.976	121-147	SKNQAGPKGGRKGGRQRSRSPGERRGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q227	TAFII55_N domain-containing protein	0.973	73-159	EKKKRPYQRKQDGPGKSKKRSANDDALPPAKRIASGAAPTRKLSLKPPGPEPVAKPKFSLSGPPKRTAPVPKLVGLNTRGKAPPRPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2B1	RNB domain-containing protein	0.82	520-530	KREKEEKKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XH89	Uncharacterized protein	0.843	899-913	RKASSTKKPDPKRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XH89	Uncharacterized protein	0.771	854-869	DVPKPKKDTAKADKPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XH89	Uncharacterized protein	0.75	821-834	KNDPRAKRLAARAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XH89	Uncharacterized protein	0.643	464-469	KKLQKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3Y4	Uncharacterized protein	0.988	113-144	PRPPPLPTGPPRQPRPRPPPRPAPGPKRQRGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEP6	Zn(2)-C6 fungal-type domain-containing protein	0.853	24-44	RKDPPNPSSVKPAKKVKRVGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHE3	Uncharacterized protein	0.995	7-43	EKKKQKPPAKKSKKLLRSDTGPGRPRKVKAETARNRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHE3	Uncharacterized protein	0.631	1004-1007	KKGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL67	Uncharacterized protein	0.842	1424-1436	KRNALDKWRKKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL67	Uncharacterized protein	0.754	688-705	KKKHEKALKGESGAAGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM82	Vac14_Fig4_bd domain-containing protein	0.851	987-999	RFAPGGRAAKGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNC7	Uncharacterized protein	0.628	79-82	RKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS42	PH domain-containing protein	0.642	1563-1568	SPRRGH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU70	Protein kinase domain-containing protein	0.887	338-350	GRRPKKVPRRGGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVB5	Uncharacterized protein	0.946	101-118	GGSRRRSSRRNSRRGRRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVG8	Uncharacterized protein	0.774	357-367	AADRKAKEKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX13	Uncharacterized protein	0.972	920-941	KAKAAKAKKPKTTKSKTAKPSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q163	TLC domain-containing protein	0.908	71-86	IRGGGKRRKAKTLFNR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Y2	Uncharacterized protein	0.98	684-701	HKKRKRPSAGGANKRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q454	Zn(2)-C6 fungal-type domain-containing protein	0.805	18-26	RKPRKSRGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2V2	Uncharacterized protein (Fragment)	0.8	77-86	KKRTRRRARP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMJ3	Transcription elongation factor 1 homolog	0.82	18-29	KRKKSSRGPVKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ90	Uncharacterized protein	0.703	325-330	KRRKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK09	Rab-GAP TBC domain-containing protein	0.802	124-135	RRRGKRISSKKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSP7	tRNA(His) guanylyltransferase	0.785	258-266	KERKRKLKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTF4	Uncharacterized protein	0.969	1717-1734	RKLDKHGRDPSHRPKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTF4	Uncharacterized protein	0.922	92-104	DKPPNKKPKRGKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTF4	Uncharacterized protein	0.754	181-204	KRKSGRVNRELGDAPKRVSPRSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTF4	Uncharacterized protein	0.747	325-353	PSKPSPRIKLKFNPSRHNIPPPHPLAKPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVF9	Uncharacterized protein	0.901	422-435	RRLRRWRARRKSSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWW0	AAA domain-containing protein	0.999	141-164	RKKKAKAKQLRKAKEKKKSKKSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWW0	AAA domain-containing protein	0.997	82-109	KIVRKKSKCHKTKHKKKSKAVKKSHNRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWW0	AAA domain-containing protein	0.989	238-266	APTKASKSKRRRSSTKSAKSSRSKSKSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWW0	AAA domain-containing protein	0.986	188-199	ARRRKKSKKPKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWW0	AAA domain-containing protein	0.971	369-386	KTIKSKIKAEKKKKAVKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY27	Eukaryotic translation initiation factor 4C	0.935	3-16	KNKGKGGKNRRRGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZK9	Protoheme IX farnesyltransferase, mitochondrial	0.713	27-31	RRRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4X7	Transcription elongation factor SPT5	0.616	119-121	RRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBM1	Uncharacterized protein (Fragment)	0.86	33-41	NKKRRAKKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDV2	HTH La-type RNA-binding domain-containing protein	0.804	576-592	PGPPKAWMKRQQAKKKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHC8	Uncharacterized protein	0.885	94-107	KTRKGIRAKRKVRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHI1	Uncharacterized protein	0.624	48-54	REHRNRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHI1	Uncharacterized protein	0.606	39-40	PR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHI1	Uncharacterized protein	0.603	42-42	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHI1	Uncharacterized protein	0.601	44-44	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNB5	Uncharacterized protein	0.701	378-386	KSAKRSKTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRE7	Uncharacterized protein	0.893	293-307	RVEEMKKRRGRIRPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRE7	Uncharacterized protein	0.812	249-264	KAKEEELKKREKNRIK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRE7	Uncharacterized protein	0.658	274-277	EKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRY5	Uncharacterized protein	0.836	241-250	RGGRRRSRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTB4	Transcription elongation factor Spt6	0.989	77-90	KRERRRERKKRRRQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTB4	Transcription elongation factor Spt6	0.818	117-129	KESKFKRLKRGHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWZ1	Pre-mRNA-splicing factor 18	0.877	53-78	RIDKKRKRDDEEAERNAAREEKRKRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWZ1	Pre-mRNA-splicing factor 18	0.644	97-100	RRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX94	BHLH domain-containing protein	0.84	202-212	SKPRGRKRQRI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXT4	SAM_MT_RSMB_NOP domain-containing protein	0.73	354-359	SKKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYT1	mRNA-capping enzyme subunit beta	0.836	25-37	RPAKRGRSRKYPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ49	DUF4211 domain-containing protein (Fragment)	0.609	247-248	KR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZI8	DUF3591 domain-containing protein	0.946	535-556	MKEYKFSKPKHIKRKNVKGREA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZI8	DUF3591 domain-containing protein	0.817	1060-1078	RIQRNADRREARERLKKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0T6	Uncharacterized protein	0.997	45-96	PPPKKRKTVSRKPKPQTRSRVKSKPAGRPMKPIFKVGKPRKPNSKAAPEKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q296	Uncharacterized protein	0.878	541-554	AAEKRKREERKQKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2T5	Uncharacterized protein	0.99	37-56	KSPPKSTGKKKKGKKHAAAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2T5	Uncharacterized protein	0.88	732-742	RPNRKRKRTKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q313	Uncharacterized protein	0.829	148-163	KSKKQRRIAAKALKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4V3	Uncharacterized protein	0.999	736-752	GKKKQRKKRGKKKKSDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH26	Uncharacterized protein	0.824	247-257	GQKDGKPKKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHS4	Uncharacterized protein	0.905	19-28	KSKKRKRKDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIJ8	Uncharacterized protein	0.999	487-509	KSPDPPRKRKKHHKKKNRKHREK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIJ8	Uncharacterized protein	0.852	389-402	KKVKRMLKHRMRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRX6	Helicase-like protein	0.983	552-605	ARGEKPDLPKKSGGALADMRRRKESAWSNQKDAKAVKESRREKKEVRRKAETKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX73	Uncharacterized protein	0.993	175-213	REKAQAEERERRKAVEAKLEAKKARERERKKEQERKERG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX73	Uncharacterized protein	0.685	139-148	KKAKSLARRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ58	Developmental and secondary metabolism regulator veA	0.674	220-227	RMRRREPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4W9	F-box domain-containing protein	0.846	1043-1057	LSKKQKAQARKKGAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIF1	Uncharacterized protein	0.985	132-153	KSRKKREKKERTRREMAEREGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIF1	Uncharacterized protein	0.907	252-265	GEKAARKAAKRARR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2R0	Uncharacterized protein	0.989	378-390	VTKRKRKRKRPAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIG1	Uncharacterized protein	0.674	152-157	KMRRKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS85	40S ribosomal protein S24	0.993	101-134	IEKPSRQQRKQRKNRSKESRGTAKTKGAAKKDKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWE2	Phospholipid-transporting ATPase	0.942	76-94	LLKRKIKSVSEKNKGKRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWM9	Uncharacterized protein	0.646	122-126	RRKRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ33	TBP-associated factor 4	0.99	430-449	RDRKAEKERQKKREARKRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ88	Uncharacterized protein	0.937	409-432	KIARRASKKVKGFRKSITKAFKGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZT5	Uncharacterized protein	0.64	468-473	KRPRAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1F5	Uncharacterized protein	0.738	1148-1158	RKNPGKREKNA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3U3	Uncharacterized protein	0.99	711-724	GGKKKKRPARRRPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3U3	Uncharacterized protein	0.738	337-348	LEARKKVKGYAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q568	Uncharacterized protein	0.756	8-18	APAAKSKPKPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKG4	Uncharacterized protein	0.904	499-512	KRSRSKKSKKSGSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE97	60S ribosomal export protein NMD3	0.893	410-432	KHYERRKNKGPSNRNWKLKRMAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIF1	Uncharacterized protein	0.993	1102-1122	AKGKGGRGGKSGRGGKGSKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIF1	Uncharacterized protein	0.982	175-199	RKAEERQQAEARKPGKKIKKKSGDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIF1	Uncharacterized protein	0.98	870-904	RKMKNRLDQGKPIHNESKVKQSKGQRGKKGKSRKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLK6	Uncharacterized protein	0.875	939-950	RQKKERKRARDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUB6	Uncharacterized protein	0.911	716-743	RLRVREERRAKVANLRREVEKKKTAAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXN9	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.999	539-567	KGKPATKKRKRETKKEEPKKKKKIRIKIR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXN9	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.984	214-258	NSRPKRRPGRPRRNPAPEHESEDEAKDVKPARKKPGRPSKGGQAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXN9	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.779	180-202	KRGERRRNQEKVVRGGGTLRGRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2L4	Uncharacterized protein	0.999	674-739	KSSKRPGKNEKPGSRKRKRAPEGAQKTAESDKAKKEPKKPIDEKLAKRNQIIGRKRAMRAKRKGGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2L4	Uncharacterized protein	0.808	550-556	RKKKGKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2L4	Uncharacterized protein	0.686	126-140	PRKREGEGEHAKHGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Y9	Glycosyltransferase family 34 protein	0.694	628-633	KKKAKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4V2	AP-1 complex subunit gamma	0.854	609-620	KKRHSKLPAKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Z7	Aspartate--tRNA ligase	0.632	144-147	RKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHT8	Protein kinase domain-containing protein	0.957	192-214	RTARKIKEAEKAAKKARNKTQKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMP0	SANT domain-containing protein	0.995	722-752	IDREKEEKEKAAAEKEKRKTAKKAKRTRQKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMP0	SANT domain-containing protein	0.963	363-380	PKKATKPRKTRVPRKKVQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMP0	SANT domain-containing protein	0.887	13-26	GKKAAPKAPARRRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMP0	SANT domain-containing protein	0.769	304-322	RRSTTKKTKNTQRKVKSKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNC4	SH3 domain-containing protein	0.885	173-194	IPAPPPRGGEARRSRSPRPPPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBM6	Chromatin modification-related protein EAF6	0.769	156-164	APNKKKRPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC42	Methionyl-tRNA synthetase	0.997	577-605	KKVKEEEAKKKAARKAEKDRKKAKKAAER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCB8	Uncharacterized protein (Fragment)	0.723	458-467	GKAAQKRAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCB8	Uncharacterized protein (Fragment)	0.695	332-345	SKKHQKAVKELQKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJR5	Uncharacterized protein	0.906	161-173	REVKARQPKRKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKR6	Transcription initiation factor TFIID subunit 2	0.795	684-694	KRLKRSRRQRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM83	WD_REPEATS_REGION domain-containing protein	0.858	10-19	PRRSPKRKRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM83	WD_REPEATS_REGION domain-containing protein	0.834	63-74	KPKRRRVERPRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPJ0	Uncharacterized protein	0.815	5-28	GAGKRANVKRAQQKQALKKATKAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQG7	Cation_ATPase_N domain-containing protein	0.954	97-114	AKDEKPTKSRKKDKKDKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRM5	J domain-containing protein	0.925	192-226	SKEGRMKAARRRRQQESGEAAAFEKEIKLKKKGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRM5	J domain-containing protein	0.782	260-267	PKGKKGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRM5	J domain-containing protein	0.642	286-290	KRSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRX9	Uncharacterized protein	0.968	182-199	DHRKRDRRRSRGGKSPPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV19	Translation factor GUF1, mitochondrial	0.887	627-644	SRRRKLLEKQKEGRRKLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX95	Uncharacterized protein	0.732	253-267	KRKMQDRTPKKQRNS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Y0	Uncharacterized protein	0.858	172-195	RSRSRSRSRHRRHHYHDRPPTQRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0M4	Uncharacterized protein	0.733	3-12	KKRRERDRPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YHU3	Ribosome biogenesis protein SLX9 (Fragment)	0.992	27-60	KDKRTIKHNALLNKVHAAGISKEKKHKRRRPAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YHU3	Ribosome biogenesis protein SLX9 (Fragment)	0.759	104-124	HKPGAMKKKTAMEEKERERFR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI92	Uncharacterized protein	0.968	95-112	GGSPKKKKPTPRMKKATA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI92	Uncharacterized protein	0.815	72-84	PFKPKTPAKKRTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJP1	Uncharacterized protein	0.845	237-253	KKHHKKEDKHKPHDRRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJP1	Uncharacterized protein	0.63	269-272	KRRH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK42	Uncharacterized protein	0.997	224-237	QKAKKKKNKKKKKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK42	Uncharacterized protein	0.934	96-127	GKKAAQAKKKAQEAGKSRHAAPKSLEAQKPKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK42	Uncharacterized protein	0.743	208-214	RPKKRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZV8	Uncharacterized protein	0.749	589-597	RARPKPRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3G3	HECT domain-containing protein	0.925	153-184	SRRKSSRRKSKEDPAASTSTGASRKSRKGSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3G3	HECT domain-containing protein	0.674	87-93	ERKTKRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3G3	HECT domain-containing protein	0.662	1123-1129	KKPSRTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJX5	Uncharacterized protein	0.866	198-206	KKKERKRRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJX5	Uncharacterized protein	0.73	328-338	KGKGKEKAPSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKF7	Uncharacterized protein	0.813	51-56	KKKRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIE1	Ribosomal protein S9-like protein	0.924	165-177	GRPGRVRRKKAKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBP9	Type 1 phosphatases regulator	0.951	108-153	KAGGRGRKHNHGEGVGDRCEKGKGKERKPSPNAYERQPKYKGKKEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC19	Uncharacterized protein	0.857	29-43	KKEKRRRSGLFGSRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD32	Uncharacterized protein	0.759	34-45	KKRQIKGRKNEI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGH6	Uncharacterized protein	0.983	1440-1460	KKPSRPRGGRGRGRGGRSGRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGH6	Uncharacterized protein	0.83	610-649	KREEAIKRRKEEEQREEAAKQERLRAKLAALEGVGKSKKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT98	G-patch domain-containing protein	0.896	107-118	RKRKERQKKSRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVY0	Mitochondrial DNA polymerase catalytic subunit	0.986	1044-1062	ASKPKRASKTGGRKPKKKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVY0	Mitochondrial DNA polymerase catalytic subunit	0.942	441-458	KGKKKGDPPRPAARQKKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVY0	Mitochondrial DNA polymerase catalytic subunit	0.806	110-125	KYARASPPPKPRRWVR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXG6	Uncharacterized protein	0.966	513-523	TRKRPRKRKRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1L2	Uncharacterized protein	0.986	1151-1168	AIKKANKKKRGRRQHWSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1L2	Uncharacterized protein	0.888	230-241	LKRKPGRPPRRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1V2	Uncharacterized protein	0.903	23-36	PFPATKKGRGRPRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1V2	Uncharacterized protein	0.877	55-81	RPRAGGSRSSSKGPVSRKTRSRSPEKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1V2	Uncharacterized protein	0.673	334-338	SPKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1V2	Uncharacterized protein	0.649	10-16	KSGAKRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q378	Uncharacterized protein	0.703	395-402	RKTKAKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q572	Zn(2)-C6 fungal-type domain-containing protein	0.704	132-140	RHKKEIKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2K8	Uncharacterized protein	0.626	79-82	RPRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIA4	Thioesterase domain-containing protein	0.606	47-47	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCI5	Ribosome assembly protein 3	0.965	6-17	EEKRKRRNKRKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD36	Uncharacterized protein	0.908	301-323	ARLGQHERKRSKDGKRISGDKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH23	Mitochondrial genome maintenance protein MGM101	0.69	243-248	KKRRKH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPN1	Uncharacterized protein	0.961	508-518	KKDKRKKKRAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQB6	Uncharacterized protein	0.97	165-183	RPTYKHLFKKMKERRRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQB6	Uncharacterized protein	0.953	226-237	PAKRRRRKRDPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQB6	Uncharacterized protein	0.734	270-276	KRPRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSI3	Uncharacterized protein	0.851	739-748	KRRKKAPLKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q044	C6 transcription factor-like protein	0.618	48-52	KSVKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1H0	Uncharacterized protein	0.798	320-333	RRSRLQKPGRRSRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1M1	Amidohydro_3 domain-containing protein	0.792	24-32	RRRGRSKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q440	Uncharacterized protein	0.893	126-149	RKPGKQEQPLKPAQKKTRRRLPTT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XZK7	Uncharacterized protein	0.974	231-263	AKERQGRRHGGQEAKTKRKEEREKRFGLSRGRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y1W8	Uncharacterized protein	0.947	599-627	KGDKQMKLKAKQAKKDAKAEAKEDKRRLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y1W8	Uncharacterized protein	0.827	888-896	ANKKKGKKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y1W8	Uncharacterized protein	0.684	333-339	KKKLGRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2K2	PINc domain-containing protein	0.63	49-53	ARLKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM51	Protein kinase domain-containing protein	0.99	269-339	RHRDEAHPRGSRRSPRRARGGDRGSRRATRSPIDSAARATSRESLRKDQSSHRRRDQSRERSVSPDSRRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM51	Protein kinase domain-containing protein	0.975	950-984	ALRKEKERQERETRRREREGEKRKAEEAAGGEVKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM51	Protein kinase domain-containing protein	0.943	600-620	RQPSPPRTQKKMVRKKRIKTR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM51	Protein kinase domain-containing protein	0.912	204-254	PRRRRSWSEESRRETDSRRNRQPASPERYWRGESPDRNRRRSRDRRYSRSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM51	Protein kinase domain-containing protein	0.87	78-96	HHHHHRRHRAKSATRRSSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM51	Protein kinase domain-containing protein	0.723	149-159	HRYHKRHRSRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCP8	Uncharacterized protein	0.676	32-39	LAQRKHRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDG3	Uncharacterized protein	0.758	44-51	KKPRRARK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL47	Uncharacterized protein	0.997	505-519	KGDGKKKRKPKKRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ19	Uncharacterized protein	0.865	73-87	PKKKTSHMKKRHRQM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU50	C2H2-type domain-containing protein	0.967	179-196	REREEKRQKRNAKRRKTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4N2	BZIP domain-containing protein	0.912	107-126	SKIRKRRRNTEAARRYRQRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5C2	Lysine--tRNA ligase	0.972	52-81	FKKRQKAREKEAKKAEAAATRQAPPAAKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WN78	Uncharacterized protein	0.935	151-176	RSRSPRKRRRTPPSENASPSPTPRPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0L4	BZIP domain-containing protein	0.98	37-67	QRKKKPGPKRDSKPAPNEKLERNRQAQRTHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCN3	Structural maintenance of chromosomes protein	0.873	535-548	EKKKHLKNKEKKLE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCN3	Structural maintenance of chromosomes protein	0.866	50-66	KKAAPKRRSVKDARAAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD81	Uncharacterized protein	0.874	99-119	LHKRLHRPTKPRPSSVRKHSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFN0	Uncharacterized protein	0.999	82-107	RRRPRNRRRHRQRHRPRSRRRRRQSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKF3	Uncharacterized protein	0.647	227-233	RKMHKHK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLU1	Ribosomal_L18e/L15P domain-containing protein	0.985	163-189	NKKPFVESKGRKFERARGRRRSRGFKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR02	SCA7 domain-containing protein	0.997	163-206	KKTSKGGMTASKKRKAEEGVDDGGPSKKKKKKDESKGKAARPKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR02	SCA7 domain-containing protein	0.954	127-149	KKQEKQRKKKEAKDARDAAARKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTG9	Uncharacterized protein	0.759	328-335	DKSRKRRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTG9	Uncharacterized protein	0.644	352-356	KRRRM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTR9	Uncharacterized protein	0.997	433-472	KRRRISLADESTRAPARRRASPGPRTAEKPKKAKAPKKKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTR9	Uncharacterized protein	0.992	208-253	KKARRSAAKKIEMNGEEVAKKPRKRIAKTPETEKGAKKRSPQPLKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTR9	Uncharacterized protein	0.906	879-906	KRPRGRPKKIASVDKEATTSPRKRGGLP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTR9	Uncharacterized protein	0.89	1062-1073	KAHPKTKSRKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTR9	Uncharacterized protein	0.876	107-124	KINTKRDNAGKLPKRRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTR9	Uncharacterized protein	0.801	524-532	QPRKPRAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTR9	Uncharacterized protein	0.748	548-555	KSKKAKKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUU3	DNA topoisomerase 2	0.995	1286-1314	KREKKVKAKGRRASAKLGIGAKAGAKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUU3	DNA topoisomerase 2	0.969	23-64	PAKAAVKKAAAASKPKAAKQTTLKTTTKTAPKAAPKPKKRAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUU3	DNA topoisomerase 2	0.885	1585-1640	QLKAKPSTKPAAKPVSKKASAAPAPAPSTHALSPAAKAYARKKSGAIQAKPGASKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUU3	DNA topoisomerase 2	0.87	1403-1411	AKKRGRPKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUU3	DNA topoisomerase 2	0.716	95-106	KKAEKAPAPKKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUU3	DNA topoisomerase 2	0.694	1428-1435	KKPSRPKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXM5	Uncharacterized protein (Fragment)	0.989	15-55	SSSGSGASKPKSKSGPRPPPTQHKPKPTGISKKKKPPHLRY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY19	Uncharacterized protein	0.999	201-226	AEREKRTRRNREKKAKKKQREKAKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY19	Uncharacterized protein	0.821	167-176	KRPGKKARVK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2P8	Uncharacterized protein	0.802	296-306	RSPPRRHRSRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2P8	Uncharacterized protein	0.76	115-122	PRRRRSRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2P8	Uncharacterized protein	0.699	322-330	RRRARSERR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2P8	Uncharacterized protein	0.635	61-65	KRRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3S8	BHLH domain-containing protein	0.81	309-317	KRRRRRESH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4N1	Uncharacterized protein	0.978	9-63	KKAVAAAPVKAAKASKPEKVSAGRVTKPSKEAKSSSKETAKKTVKAVEKKSKKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4N1	Uncharacterized protein	0.975	448-496	FGGGRGGGRGGRGGFDRGGRGGGFGRGGGRGGFGDRGGRGRGGARGGRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4N1	Uncharacterized protein	0.757	224-233	KPAESKKRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5A2	Uncharacterized protein	0.849	202-219	AEQRRAKKEAKDQRRLGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y1V3	Uncharacterized protein (Fragment)	0.712	30-41	KVRLRWRGKLRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI45	Peptidase_M24 domain-containing protein	0.999	380-402	KEAKSKPKNKKKKKKPAKKAAPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKI1	Uncharacterized protein (Fragment)	0.977	3-32	RGKRHKRRASKDLNALPKKAQRAKKTPVKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLZ6	DRIM domain-containing protein	0.996	2473-2524	AKNRRDERRQKRRIEAVSAPEKWASGKKRKYEAKKVKMKAKGQEARGLRRGW
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLZ6	DRIM domain-containing protein	0.769	8-27	KAGKTGKDYKVVKPKKSTKH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP61	PWWP domain-containing protein	0.974	295-307	KPKKKKAPRKSKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP61	PWWP domain-containing protein	0.971	320-371	PKSSKKRKKDAESDADAPKPKKTPKVTKINAPKTPGSEASAKKSTVKPKKKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP61	PWWP domain-containing protein	0.969	101-126	KDKKRKSTGGVPEHKSKKANKNKKPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS54	RING-type domain-containing protein	0.862	321-354	RRRKRRATQSPASPRERDQSAAHPQLKRPRLRRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ09	Uncharacterized protein	0.984	952-967	RGRHRERPPKKRRKEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZV1	Uncharacterized protein	0.993	347-371	RLKAKAEKKAQDKIKKAEKKRKRES
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZV1	Uncharacterized protein	0.866	267-287	IKQRQKRQIRRTKVKTNRAKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZV1	Uncharacterized protein	0.829	395-406	DKPVKPAKKKSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZV1	Uncharacterized protein	0.702	432-441	KAPRKIQKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1K1	Uncharacterized protein	0.958	58-71	NEIAKKKGSKKKRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1K1	Uncharacterized protein	0.912	195-205	RAKPAKKRKRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q469	Uncharacterized protein	0.991	90-123	KNSSKPTKKRKNAAEPKKPAKVPREGSRSSARGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q469	Uncharacterized protein	0.793	4-13	KKKKTAAKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q474	HMG box domain-containing protein	0.975	97-121	KSRVSKSPAPKSRREKKSKLDRSKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF86	DUF2013 domain-containing protein	0.825	433-446	PSVPAPRRGRKGSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGC5	CUE domain-containing protein	0.882	111-169	KKPKDRARSKAKEESSPAGAADKVGFAVRGGRGRGGFDSTRGSRGRGADRGRGGFRGAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGC5	CUE domain-containing protein	0.674	18-33	RGGRGGFSRGGPRSGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJH9	Uncharacterized protein	0.906	17-34	KRPRLNPARRKSAKAKEH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ09	AIP3 domain-containing protein	0.698	962-969	RRREGRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ09	AIP3 domain-containing protein	0.625	944-950	RKQREEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRT6	ENTH domain-containing protein	0.981	328-349	ARRKTAAPPKAKAKKAEPPKPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT57	Uncharacterized protein	0.939	381-414	KIREARRKFEEKEAEKDRKIESKRRNSEAKQRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW85	Importin subunit alpha	0.754	36-51	IRKQKREENLAKRRGI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW85	Importin subunit alpha	0.64	26-29	RRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWY0	WD40-repeat-containing protein	0.659	444-449	RRHRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWZ3	Uncharacterized protein	0.852	2644-2658	RANSHEKKRKVKDKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3C5	BZIP domain-containing protein	0.837	65-76	AQRNYRKKLKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XM07	ULP_PROTEASE domain-containing protein	0.735	1035-1041	KKSRKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XM07	ULP_PROTEASE domain-containing protein	0.61	116-117	KK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y494	Splicing factor YJU2	0.737	249-253	KKKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YK44	Uncharacterized protein	0.654	39-42	RKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PET7	XPG_I_2 domain-containing protein	0.983	551-564	PKKRRKKLKKSPQG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV72	HMG box domain-containing protein	0.916	304-316	GSPLKKKPGRKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVC9	Helicase C-terminal domain-containing protein	0.88	250-294	KKAKQDLKRRGVESRTTRGAQKDPEAARKSRISTKPGFLRKKDNN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ74	Zn(2)-C6 fungal-type domain-containing protein	0.996	32-66	PRKGPGDGKKHTKHARRPSRESKRKDAAPRKAAAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q110	Uncharacterized protein	0.922	139-169	HRSRGTGPYKKKKSATQAKEAGLGPASKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1F0	Uncharacterized protein	0.989	402-418	RGRARAGKARPKPRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3F6	Uncharacterized protein	0.994	419-432	KSRRHKKKRKRGKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3F6	Uncharacterized protein	0.643	64-67	GRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WK55	Uncharacterized protein	0.675	511-519	SKSRSRSRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WK55	Uncharacterized protein	0.646	358-366	RRAAKSPSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIW9	Uncharacterized protein	0.776	7-17	KKARKQKVKAQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y208	RING-type E3 ubiquitin transferase	0.941	17-74	RGGHRGRGRGRGGPRGDGRFSDGATFKGGDSARADGGGRSRARGRGRGVNGGRERGNR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y208	RING-type E3 ubiquitin transferase	0.845	768-776	KGKGKKGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y208	RING-type E3 ubiquitin transferase	0.743	393-402	RRGGRRPGRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIE5	Cir_N domain-containing protein	0.991	179-334	KKDSHRKHRHRHRSHRHRDDGAGHRSKRRRYSDDRDEERRSHRYRSHTHRRRSPSESRSRSRSRRSPRGNDGDRDERSSRSDQRREHSASRSRSPARRRDRGDCRDRRTSYPSPRRSGSSDSRSRSRSPYKQRRDDDRSSHRSHRWRSSPAHSRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBY5	Uncharacterized protein (Fragment)	0.63	16-20	KNKSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCS8	1,3-beta-D-glucan-UDP glucosyltransferase	0.968	289-305	GKANRATRKARKAAKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDY2	DUF4110 domain-containing protein	0.997	3-38	KAKDAKKKAEKKARVEAKTAKKEKQKEKKTSKKPGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDY2	DUF4110 domain-containing protein	0.791	383-404	RRPRASAKKANTTERSRRGRGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFL5	Zn(2)-C6 fungal-type domain-containing protein	0.709	23-37	KSSLPGAGAPAPRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG76	tRNA 4-demethylwyosine synthase (AdoMet-dependent)	0.674	92-102	PRRIQGKRISR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGN1	BTB domain-containing protein	0.826	10-23	GDRAGKARKISKRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIN5	MIT domain-containing protein	0.782	304-318	HRRPRNRERSEKDKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR38	DUF155 domain-containing protein	0.866	137-150	KRRRKAGKSEAERL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT73	Clr5 domain-containing protein (Fragment)	0.858	198-205	RKRRRRIR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUI8	Lysophospholipase	0.855	752-766	WQRKRAARLRREKEQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1H3	Uncharacterized protein	0.971	81-103	RAKKRRKTLGSSTKAGGKKAKKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1H3	Uncharacterized protein	0.709	24-40	RRRTLVHPRASPPKLKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1H3	Uncharacterized protein	0.641	152-158	RPLPRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2S1	NUC173 domain-containing protein	0.974	1201-1261	RKKLDAGKSPRGGGKQKPQRRSLSGDKTREGGFSGGKVHKAGRSGTFKHGLQRSRGRGGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2S1	NUC173 domain-containing protein	0.955	1004-1015	RKTRERRKKKRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMA6	Uncharacterized protein	0.717	40-47	KRRHWRKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBJ8	Protein kinase domain-containing protein	0.894	64-74	KPVKKKKIKRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBN4	Uncharacterized protein	0.749	18-62	HSKPSQPKSQLTKNPAAKPPAAVKQVAKAPSGPSRPIGGGARPAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBV7	Uncharacterized protein	0.895	11-24	AHFKRPKKGPRGHS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD57	Uncharacterized protein	0.908	52-82	SKRDEALRKKLETDLSKKRGAAGRARQTRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG04	Fatty acid hydroxylase domain-containing protein	0.982	304-319	AKRRREKKMAKAKKAQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH34	Uncharacterized protein	0.977	664-680	KPPAKKGRGRPPKAKPT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH34	Uncharacterized protein	0.879	312-320	KPKRGRKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH34	Uncharacterized protein	0.876	702-715	KKARGRPAKAKSKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH34	Uncharacterized protein	0.688	744-751	EKRPGRPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH34	Uncharacterized protein	0.604	640-642	KAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHW1	Uncharacterized protein	0.739	49-56	KPARKRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ21	Uncharacterized protein (Fragment)	0.997	106-130	AHMAARAKEEKRRKRRAKTAARKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ21	Uncharacterized protein (Fragment)	0.976	26-56	KNARKWRHERSRMDSNNVAPKRPSKKRRKSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ21	Uncharacterized protein (Fragment)	0.949	382-407	KRSARAAPPANVTENEKRPRKKSKRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ21	Uncharacterized protein (Fragment)	0.916	356-367	KSKKRKIRRSGL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ21	Uncharacterized protein (Fragment)	0.834	491-498	KPRRKRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ21	Uncharacterized protein (Fragment)	0.713	931-937	RRAKKPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJB3	Ribonuclease H2 subunit B	0.924	386-402	GEAKKRKKEEEEARKKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNN4	Uncharacterized protein	0.635	411-419	KAKQEKLRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPE4	Uncharacterized protein	0.91	148-166	TRHREPERPSKRGRKLAQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSL4	Autophagy-related protein 2	0.847	1754-1768	RQRQRRRLKLGRSKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTG8	TruB_N domain-containing protein	0.904	52-66	EKHNQKNKRKWRGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY03	DNA helicase	0.951	675-684	KRRRKRAKRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4M6	Uncharacterized protein (Fragment)	0.942	218-267	KRRQGAKRAEEREMVRRAARRVIVFGAEVPRREHAVQKPSKSKAKAKRGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMU3	tRNA-splicing endonuclease subunit Sen2	0.752	35-40	KPRKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMU3	tRNA-splicing endonuclease subunit Sen2	0.709	156-165	KRRAERRMFK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YPK0	Uncharacterized protein	0.854	98-107	RNKAKRGKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YPK0	Uncharacterized protein	0.795	295-309	ITRKPRAYKGKVKPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDG8	Uncharacterized protein (Fragment)	0.901	59-104	QRPGSHRRKQDLPLQRARPSSELQRPRNPPIRRLPDQLRPRRKWRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE29	Uncharacterized protein	0.747	247-257	KNKDDKRKGPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE29	Uncharacterized protein	0.647	97-106	REPPGRGGPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFG5	CRAL-TRIO domain-containing protein	0.897	61-75	KKKKKGLMGRFKKDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV53	Histone deacetylase	0.679	531-541	RRWKERNPAGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1A9	Phosphoinositide phospholipase C	0.645	791-795	GKKPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1T5	Uncharacterized protein (Fragment)	0.762	96-123	HDRPERREPRSAREEQQQRRQHLGKRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1T5	Uncharacterized protein (Fragment)	0.729	15-40	KAEKQREISKNKKNLQHQRNEKLARR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5I0	Uncharacterized protein	0.637	426-429	PKKH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLI3	Uncharacterized protein	0.819	75-81	KKKRKRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBU1	Mediator of RNA polymerase II transcription subunit 14	0.605	426-427	RR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHT6	DDB1- and CUL4-associated factor 13	0.991	400-459	ERWKHMPEIRRIARHRHVPKVVKKAGEIKGVELKSIKRREENERKHTRKGQKARRSEREK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIR0	Uncharacterized protein	0.932	55-86	KKTPTKGPPANKPPAKKPAPPSTNKPAQADKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN96	Uncharacterized protein	0.91	308-369	EQRKLRKIDEDEKAEERRTQSDKLKKEERDRKLSRMSADEQKKFLEKEKEKQQRKGMKKQTQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPW5	Histone acetyltransferase	0.934	962-996	PPAAKRRPGRPFGRRSGTRNSYNSTPRRSRPGNSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPW5	Histone acetyltransferase	0.892	346-360	KKQKRRERDRQRRLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPW5	Histone acetyltransferase	0.765	256-265	PRPANRKRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY90	Smr domain-containing protein	0.95	199-211	KRGRKKKTKANKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0N5	Uncharacterized protein	0.826	156-169	RRRRQRLLAKRGRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3H6	Probable lysosomal cobalamin transporter	0.831	291-301	RKLKRARHRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Z2	Uncharacterized protein	0.738	409-414	GKRKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Z2	Uncharacterized protein	0.666	118-123	PPKRPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMR7	Uncharacterized protein	0.775	329-346	KSRKRQSDVGPVSKKQKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5X0	Uncharacterized protein	0.812	62-83	GGWPGKAVKRQRHHVRDWRRER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKZ7	Uncharacterized protein	0.865	27-58	RRRRKHDDRDRESKSSSLRDSHKHRSSKKSAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKZ7	Uncharacterized protein	0.716	888-896	RHRHRRERK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG65	MFS domain-containing protein	0.701	87-92	RRRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKD2	Uncharacterized protein	0.824	276-288	RPAKRRRLTPRRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKD2	Uncharacterized protein	0.653	389-396	RQRHKERR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKD2	Uncharacterized protein	0.651	1133-1142	RRGSMRGGRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKD2	Uncharacterized protein	0.638	346-349	RKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL61	Uncharacterized protein	0.821	459-473	RRTSERTPRRRERRQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLW6	AMP-binding domain-containing protein	0.814	76-96	AKALGKRKLIKIHVENKKIKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPS2	Mitochondrial distribution and morphology protein 34	0.899	355-366	RTRPKKRKNRIV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUN3	SNRNP27 domain-containing protein	0.988	11-95	RRGPRDDTRNHRPRYEQDRSRSPRGRDRRDDRRRDRSPPRNNPNSRAGPPPRDNRDRNDYQRNGPPRGPGGRPDIKREPLDSKVA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUN3	SNRNP27 domain-containing protein	0.603	97-97	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXI1	Uncharacterized protein	0.973	39-67	RPSIAKKRTAPTPKMEVKKRKTGKKTMAS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZW9	Uncharacterized protein	0.793	190-200	RRERRGRTRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3R6	Uncharacterized protein	0.942	437-483	KPMRPRAKKESPIATTPPPPPPTPPYELRQKPKERVGKNAPRKGARR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3R6	Uncharacterized protein	0.746	566-578	PGEKKKMQRGQRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3R6	Uncharacterized protein	0.704	548-552	NKKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4C3	Uncharacterized protein	0.963	710-720	KQRKKKGKKHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4C3	Uncharacterized protein	0.602	416-416	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKZ1	Uncharacterized protein	0.968	1034-1049	KKKREEKKRFKWGKKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJH0	zf-LYAR domain-containing protein	0.977	287-305	PKEHKREKKDKRTGEKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJH0	zf-LYAR domain-containing protein	0.826	368-393	SKRSKREKDAKEGATETESKKERRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJH0	zf-LYAR domain-containing protein	0.705	406-418	APSSRRERSRSPV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJH0	zf-LYAR domain-containing protein	0.611	423-424	RR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJH0	zf-LYAR domain-containing protein	0.602	421-421	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD60	SH3 domain-containing protein	0.9	305-320	RAEGGPKEKKKAPFKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD60	SH3 domain-containing protein	0.669	493-498	KKRSTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKV7	Zn(2)-C6 fungal-type domain-containing protein	0.637	625-629	KREKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN57	Thioredoxin domain-containing protein	0.984	5-29	RKRPAALPPLPPAKKRAPAKPKAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN83	Uncharacterized protein	0.654	23-28	RDPKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSD1	Ribosomal protein L15	0.965	40-78	SRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPAPKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSD1	Ribosomal protein L15	0.741	168-188	GKKSRGMNKGHRYNNTKAGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXN5	Uncharacterized protein	0.999	412-436	NKKHRKKKRKRESEPTGRGKRKQRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY98	Uncharacterized protein	0.99	157-209	RPKGDRRRDERPRSRDRGSGRDRGGRDDRDRRGGGGRGERGGRDSRRSPQGGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY98	Uncharacterized protein	0.964	115-136	VRSKRRSRSPRPDSRRGHRERR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1W8	Origin recognition complex subunit 1	0.708	246-250	KKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3I1	Ribosome biogenesis protein NSA2 homolog	0.915	22-65	ERVRKRAAREAHHASKDAQNLRGLRAKLHQQKRHKEKIQMKKAI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3I1	Ribosome biogenesis protein NSA2 homolog	0.768	137-149	KTGKKTAKKSWKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q478	Ribosomal_L2_C domain-containing protein	0.887	347-377	KGGYKTRKKRNPNKYVVQERVRNQGKRRSKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q478	Ribosomal_L2_C domain-containing protein	0.821	103-129	IGHGKGGRNNSGRVTVRHRGGGHRRRI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.992	1765-1869	REARRRERRERRDREAADEEARAARRREKENSRRERAREEEDQREAERRRARRAEKEARRAEDDRLAREEEQAREERRERRREKERQRAEDEAAAAARPKTDRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.986	317-346	KKKKKKGKDSEPEPEPEIGNKKDKKKKEGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.979	1071-1096	SSKSKSSKKENPKEQKEREKKEKKER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.955	273-283	GKKGKKGKKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.917	1137-1164	PPKKSSKDSKKKGTDKLSKVDSKSSKKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.912	216-226	KKGKKDKKTKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.868	616-624	DKKKAKKKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.864	573-581	DKKKAKKKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.863	490-497	KKDKKKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.853	660-669	KKDAKKKKKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.818	796-803	KSKKKGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.812	994-1005	KKKGKTDKKGPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.806	710-718	DKKKAKKVG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.802	1880-1893	ARRMRREERRVRRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.766	838-847	KKADKKAKKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.747	1381-1400	KSSSKDKKVSGKSTKDSKSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.745	1623-1633	KQRKKSSRSKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.733	749-755	KKDKKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.719	892-900	KKKASKKDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.719	1434-1444	KSRSSKKERPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.693	1326-1332	KKAKKSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.677	153-158	KKAKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.626	441-447	AKDKDKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q571	Uncharacterized protein	0.625	1902-1907	RPRPSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLK7	Diadenosine tetraphosphate synthetase	0.924	137-148	DPKKKKKASKVK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBF8	Uncharacterized protein (Fragment)	0.991	131-159	TKKRRKKHESREDHKFKSKSMPRKSHRRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBF8	Uncharacterized protein (Fragment)	0.936	45-72	KRKRASSESVLARRRPSRGRHGGHGRER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG97	Uncharacterized protein	0.644	194-197	KKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI20	Uncharacterized protein	0.831	481-489	KPKSKRKKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI20	Uncharacterized protein	0.613	1198-1199	KK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI20	Uncharacterized protein	0.608	453-455	RTR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI98	Pre-mRNA-splicing factor	0.886	754-763	PAKKSKKRKH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIH4	RNA polymerase II transcription factor B subunit 2	0.658	481-486	KKKERR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKM3	Uncharacterized protein	0.971	573-597	TLGKRKFGTPSKKRHKVNPKESKKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRC1	Uncharacterized protein	0.746	282-297	KKPKDNGKGATKNGKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRC1	Uncharacterized protein	0.691	143-152	KARQKLHRRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVS7	Uncharacterized protein	0.993	15-80	SPKKRAPKKKDILLQGSLPRIGPSKTPRVPRPVRQMAEKKAAQNKALNEAKTRRFKRNDRKRKRKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVS7	Uncharacterized protein	0.959	208-218	KKPKRKPRKPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVS7	Uncharacterized protein	0.941	332-374	RSIKAHARANAEPVDRRTGGRRRRSKDEQQEKSPAKIPNSKQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q063	Uncharacterized protein	0.68	468-475	RRKQLRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q170	Uncharacterized protein	0.903	486-505	KPRSIKRKPVPSHFRKIRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q170	Uncharacterized protein	0.721	82-89	RRRTGKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Q0	Uncharacterized protein	0.829	59-70	RSSSRRDRRKRI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3T2	Uncharacterized protein	0.896	111-124	KQGGPRSKKPRRLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJG0	Uncharacterized protein	0.945	29-47	KDELRKGKPKKAAAPKTPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJG0	Uncharacterized protein	0.62	119-123	KKTKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH25	Ribosome biogenesis protein NOP53 (Fragment)	0.995	276-326	QKSRKTPAERNKVKARKEREAREKWERKQKEKDAQEKRINEIAKEVSAKDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH25	Ribosome biogenesis protein NOP53 (Fragment)	0.67	160-166	KPKREPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHE0	Uncharacterized protein	0.962	42-80	RKRSRSPYQDRRQDEVKRHRSRSPHRKHHHHHHRHLHRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHE0	Uncharacterized protein	0.939	314-341	KKRRQEMERKKGEREIRKEEALRARAAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNB0	Calcium uniporter protein	0.926	466-484	ALRKERKKNDAKKEKEDEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSL2	Uncharacterized protein	0.918	201-224	RFKPRHKVEKAEKVRAKISRKELE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSL2	Uncharacterized protein	0.761	236-244	VKKLKKARR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU32	Uncharacterized protein	0.937	198-214	RSRQRDRSRDRERRRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU32	Uncharacterized protein	0.88	342-381	RERDRRARRRSQSFVSSVKDRVRSLSRRKAPSRPQASRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q196	Uncharacterized protein	0.902	44-61	KHRVAKMEKARPSKKSRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q398	Uncharacterized protein	0.665	47-52	NKRKSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q460	Uncharacterized protein	0.995	716-730	PKKKAKANRKKKPKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q460	Uncharacterized protein	0.97	1229-1241	KSKKKKIKSRGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q460	Uncharacterized protein	0.969	1039-1060	KAKKDKRKVSKSTKAKGSIKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q460	Uncharacterized protein	0.767	425-449	KRRDSVASRGGKRAYGGSIRGRGSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q460	Uncharacterized protein	0.7	254-261	HKKPRGGH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4I2	Zds_C domain-containing protein	0.953	749-794	RKKDGKKLAEPKKEKEKDGLLSAIFGGKKKTSDGDLKDKKRKADRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Z5	Uncharacterized protein	0.712	86-93	SKPKSRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5H8	Uncharacterized protein	0.84	265-274	HARRKKARGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIS1	PCI domain-containing protein	0.791	210-229	RKPKKTAEELEKARKEKEER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKU2	Protein kinase domain-containing protein	0.993	353-375	QRKERRRERKRKEREAEAKSIRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKU2	Protein kinase domain-containing protein	0.637	455-461	SRSRSRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XG31	Uncharacterized protein	0.647	21-26	KRVRRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDZ4	Sister chromatid cohesion protein	0.993	1810-1841	AGPFRGKKRKSVDGGANGPPKKRARPRKSSMA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE47	PH domain-containing protein	0.709	97-115	KKSSVRRTTSLKRSGSKRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHA9	Mechanosensitive ion channel protein	0.803	354-361	GKKKGHKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMR0	Uncharacterized protein	0.993	103-143	APKKEEKIRTRDSERRSTHRSDRERRRSRSGERHSKKIRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMR0	Uncharacterized protein	0.774	78-88	RREKPKESKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMR0	Uncharacterized protein	0.706	199-233	RRERKAFEERLKNKDAGATKKVVEDRSSKREEKDA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN74	Uncharacterized protein	0.984	69-98	FRFKHGEEMPRKRKHRSGDGDGRRHRKSRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN74	Uncharacterized protein	0.97	201-240	EQKAKARKEEEEERARRREEFIRRKERAAWERAQKAGAKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRJ4	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit	0.94	174-197	KFKGRTKEKKPKENPWQKASRGKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRJ6	Nuclear cap-binding protein subunit 2	0.659	25-30	KKQKRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRZ6	Uncharacterized protein	0.924	565-588	PSGKILRRLMRDKEREKMKKGSKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSX6	Uncharacterized protein (Fragment)	0.963	675-715	AKPKEEKPAPKKETKVVPNETSEERAKRIRKEQRRKLRVEF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT46	Uncharacterized protein	0.997	602-644	RKDRENRLRKARAFNKGRGKGRLAKGKGLDPLKSLNAKGRGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT46	Uncharacterized protein	0.664	355-359	RKRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT46	Uncharacterized protein	0.612	406-409	KERK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTX4	Uncharacterized protein	0.925	45-54	NKIRKRRRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXB9	Uncharacterized protein	0.988	34-57	PERREKSKKHSRKQRERDNKRKDH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY53	Histone deacetylase	0.659	716-720	KPKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XMA0	Uncharacterized protein	0.994	83-107	KSRGKGAPKKKKTAEQSSKNRKKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL33	Uncharacterized protein	0.999	114-139	KGRERKAEEVGGASEKKKKKKKKKGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN98	LysM domain-containing protein	0.773	428-440	RRPTPPRRTRGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN98	LysM domain-containing protein	0.638	621-627	RGKSGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTR6	Uncharacterized protein	0.972	72-86	SKPKKRKSKKAAASE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWS7	Uncharacterized protein	0.965	32-54	KSEKHAPKGQKAPESGRKRKRTG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWS7	Uncharacterized protein	0.883	87-96	ESRKTKKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWS7	Uncharacterized protein	0.719	215-220	RKAKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZH2	Uncharacterized protein	0.626	143-151	RDRPLMRRQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZH2	Uncharacterized protein	0.602	122-122	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2C7	Uncharacterized protein	0.853	62-78	QKHEGASDRRRERRKSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q365	Uncharacterized protein	0.8	312-325	RRQRKLMRRAERRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3T7	LisH domain-containing protein	0.664	146-151	KRKGRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XM03	Uncharacterized protein	0.971	93-135	ARKSPRAQKARSATPQTKKRGRPPKQVAESSSVPSKKPVRPKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFZ5	DUF2235 domain-containing protein	0.736	12-39	ARSRSRGPSRSQSRALSIREPPRQRPGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGH2	tRNA-splicing endonuclease subunit Sen34	0.924	151-162	RVRKPKKAEKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHX8	TFIIIC_sub6 domain-containing protein	0.906	303-314	HPRKRRRKLTHA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ57	Uncharacterized protein	0.851	56-66	NGKGRKPKSKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJE6	J domain-containing protein	0.99	293-366	IKKFRQEGNKEKNKKRHEKEAAEKAAKEEAERQKAEEAKQAAEKEAAEKAARDDAKKGKEAAKNAAKKNKRVIR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJE6	J domain-containing protein	0.82	259-272	HMERKNNNNRKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJE6	J domain-containing protein	0.67	50-55	RRRRHK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMI2	rRNA adenine N(6)-methyltransferase	0.916	319-343	KKARKMMDNPNRKRKGKVAELVRSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQS0	Uncharacterized protein	0.662	509-516	KQREKERK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVU3	DNA-directed RNA polymerase subunit	0.858	331-350	TGRPLKAIRARLKSKEGRLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYN1	Uncharacterized protein	0.735	100-105	IKKRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q281	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	0.692	105-116	PPPPKAGASKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4T9	Uncharacterized protein	0.976	522-558	EKKREEKRRREKAMADRERQVEEGKRRAEKDEVRAKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Z2	Methyltransf_11 domain-containing protein	0.953	18-31	GRKSRGKKRSRRVR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKR4	T5orf172 domain-containing protein	0.642	185-188	KRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4E8	Uncharacterized protein	0.995	70-101	AAAKTHPKKKTPAKKAAGEKRGTDKRKAVKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJN8	MFS domain-containing protein	0.742	475-482	KKRRAGKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNR5	Histone acetyltransferase	0.976	371-392	PKKRRRKPLTGRIIPRQPRLKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBZ5	Uncharacterized protein	0.814	91-106	RSHGRGNRRERRLSRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEA4	Small nuclear ribonucleoprotein Sm D1	0.997	86-131	KPKNKARKEQDKSAGVGGPGGMRGGRGGPRGGGRGRGRGRGRGRGF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFB5	F-box domain-containing protein	0.812	1082-1089	HARPKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ20	JmjC domain-containing histone demethylation protein 1	0.992	333-367	KRSVPKGKARSAAARRPAGEKRNGTKRAANRKKTP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRY6	PseudoU_synth_1 domain-containing protein	0.83	74-87	RRGGRNDNKRHKKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRY6	PseudoU_synth_1 domain-containing protein	0.697	351-357	KREKKTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT74	Uncharacterized protein	0.902	1323-1339	QPKPPKARLPKKSEKGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWP8	Protein transport protein sec16	0.785	992-1000	PARAKGKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ51	NET domain-containing protein	0.76	149-156	KPEKKRPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZF8	N-acetyltransferase domain-containing protein	0.627	173-178	KRDKNR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZK7	Zn(2)-C6 fungal-type domain-containing protein	0.937	734-754	REMRGRGKRKQAEREREKALK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0S2	Translocation protein SEC62	0.999	330-362	KAMKKRKKEERERKKERRALKANEEKKGKKGEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q501	SAGA-associated factor 11	0.997	262-297	NGGVRKKLLKKGLKDKAKKEKPNGKLPKSLAAKRPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q501	SAGA-associated factor 11	0.761	165-178	KGKLEKGEKKASKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YHZ9	Uncharacterized protein	0.899	236-259	RHKAPKHGRSEKKYQESREKLRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCV8	Uncharacterized protein	0.795	95-103	RSKRKKLAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEJ8	Uncharacterized protein	0.956	1179-1205	NDKSKAQRSPRKAVRPNSKKGKENDRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFY6	Uncharacterized protein	0.993	263-371	SKKQHKKMNKNRTKGYEDYLKKLKEADKKWAEGTKDVEKVERKLGKERAKAERKMARNPEKALKEFEKEERKLLKELDKEMEKRDKESGKERREAQKERGKVEKKEEKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGA5	Uncharacterized protein	0.918	682-700	DPEKKEKKKHHFGFGKSHK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHT8	18S rRNA factor 2	0.936	108-131	RKKPTKAKKDPALKKVEAAAKAVR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHT8	18S rRNA factor 2	0.718	37-43	RRHKRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHT8	18S rRNA factor 2	0.709	285-292	KKKAKGGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLM0	Uncharacterized protein	0.742	6-12	KKKKTKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLQ4	SPX domain-containing protein	0.965	578-590	KSFRKKRKRRSHP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZP6	Uncharacterized protein	0.994	627-661	KIKHGARGRFRRMAGEKKKVQKEERRRRVRQSRER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0C6	Pre-rRNA-processing protein IPI1	0.956	5-28	AKKKKEKKQDFQKPKLKVGKTRPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIW3	Zn(2)-C6 fungal-type domain-containing protein	0.768	40-51	RGAKKPRAPHTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJ90	Uncharacterized protein	0.884	360-404	GPPPRGYGPPRGGRGAYGPPRGGRGGYGGPPPPGFYRGRGGPPPG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJ90	Uncharacterized protein	0.708	181-187	RKARKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBY3	Uncharacterized protein	0.964	194-219	SRRPAKKSKKAPTRMTAREPGKPLHI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBY3	Uncharacterized protein	0.846	238-265	KASRASEKKPPKDAPASRALAIAKGKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC84	Uncharacterized protein	0.993	467-487	ERARRKEQKRLRKEAKKRAKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC84	Uncharacterized protein	0.988	403-414	KSKKRDKKKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC84	Uncharacterized protein	0.804	436-441	KKKKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC84	Uncharacterized protein	0.755	15-27	KDASAKKARPTKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD11	Uncharacterized protein	0.836	219-240	KKKNTIKQWLEKRKDKKDADRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDK1	Uncharacterized protein	0.797	132-152	PHQRPMPIGPAPGRRRTSKER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEU3	Brr6_like_C_C domain-containing protein	0.939	146-166	KEMRVKKPRDLARQRSKRRRH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHD4	Uncharacterized protein	0.609	59-60	RR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPK4	Uncharacterized protein	0.844	538-563	SASGKILRRLLKDKVKKEGTSGKAKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRV0	Uncharacterized protein	0.907	448-468	KAKWEDIKKSAKEKERAKREK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSZ0	CAP10 domain-containing protein	0.957	417-429	VKKKEVKKRKPRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q316	UDENN domain-containing protein	0.991	38-48	KRKRRRRRRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3I2	Uncharacterized protein	0.999	167-217	RRPRIERDRADRPSRTASEERRRRERRKEREERHRREKEKIRAGDKKTRKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3I2	Uncharacterized protein	0.669	141-153	SPSKRDLRPPPPL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3I2	Uncharacterized protein	0.602	155-155	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q587	Uncharacterized protein (Fragment)	0.741	73-81	KRKPGRPRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q587	Uncharacterized protein (Fragment)	0.72	107-113	KRGRKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEK5	Uncharacterized protein	0.852	124-141	PRRNGNTLSRKGRKRSAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEK5	Uncharacterized protein	0.749	92-107	RIERRRRVPDRISIKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHD0	Uncharacterized protein	0.848	609-620	KKGGKGSKKTKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ04	Non-specific serine/threonine protein kinase	0.95	325-335	RRRKPAKRRRI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMD7	Uncharacterized protein	0.953	107-118	TTPKKKGRKSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMD7	Uncharacterized protein	0.816	90-98	GKKRKSKAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN66	RING-type domain-containing protein (Fragment)	0.977	60-86	ARKEGKRWIRGRVRVRKGSEGKGERKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRN9	Uncharacterized protein	0.994	99-127	DRVREKRRQFEKAKAKRRREEDRREKERE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRN9	Uncharacterized protein	0.888	22-31	KSRRRRRARS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTH0	Uncharacterized protein	0.63	104-107	KRPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUJ9	Uncharacterized protein	0.88	24-44	GKKRGRPRVEKPDASAADRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUJ9	Uncharacterized protein	0.609	7-8	RK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVR5	Uncharacterized protein (Fragment)	0.939	103-124	RAEKERAKMKREQDEKRRREKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q053	CBF domain-containing protein	0.964	682-694	KKRKPSKKEKKAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q053	CBF domain-containing protein	0.931	813-825	RNKKKRQEKKKLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q081	Uncharacterized protein	0.698	372-382	KHREAREKRPD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q081	Uncharacterized protein	0.677	385-392	PERSSRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q081	Uncharacterized protein	0.6	484-484	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4B1	Uncharacterized protein	0.994	1083-1107	KFRSRKKKKMTKKDKKEQEVRRRLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIN2	Uncharacterized protein	0.998	21-51	KPQKSKSTKRKREADDESKKAARKKKRTKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIN2	Uncharacterized protein	0.617	136-138	RKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YP53	Uncharacterized protein	0.948	126-139	KAAPKKRGRKPKQE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBY8	Uncharacterized protein	0.848	133-157	RRPERRKEDARAYNRRGRPGGSIPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJL6	Uncharacterized protein	0.96	233-259	KITRSRKQGRPRRRLLKSMTMRRREDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJL6	Uncharacterized protein	0.835	172-195	RRGIEPHRRADRIKDGRIVKPRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS36	Uncharacterized protein	0.69	605-609	KRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTT4	Uncharacterized protein	0.651	152-159	SARRHHNK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUQ9	Enhancer of mRNA-decapping protein 3	0.897	260-272	GKKKIRRGQKSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW59	Uncharacterized protein	0.996	280-306	PRRGRSTRPTRGKGTGRGRGRGRGRGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW59	Uncharacterized protein	0.956	212-230	KRGKKGKARGGAAPAQPRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXE0	RNB domain-containing protein	0.895	193-218	PRRKPVREPIADANGRRRPNGRERRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1V8	40S ribosomal protein S8	0.977	8-56	RHKRSATGAKRAYYRKKRAFEKGRQPANTRIGAKRVHLVRTRGGNRKFR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2U2	Kinesin motor domain-containing protein	0.721	1043-1055	SPRKRSPTKLSPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3B4	Uncharacterized protein	0.732	60-72	MKRGLPEKKPIRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4W0	DUF1713 domain-containing protein	0.999	342-391	HRFIRRAPSARRAKMLLISVKRQRKLKMKKHKYKKLMKRTRNLRRRQDRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5A9	Uncharacterized protein	0.908	230-250	VGKRHRIHKSRDQKAKPARQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WHR0	Uncharacterized protein	0.829	120-136	IKRATHGIRAPAAKKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4K7	Uncharacterized protein	0.887	433-441	PKPRAGRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4K7	Uncharacterized protein	0.752	8-13	KKRKRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEJ0	Uncharacterized protein	0.938	384-396	GRRRGRRRVMKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEJ0	Uncharacterized protein	0.807	424-448	KKAKMSASAPSKTMAKKGGAGKPAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEJ0	Uncharacterized protein	0.631	182-186	RTRKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEJ0	Uncharacterized protein	0.609	456-457	KK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF46	Histone H2B	0.974	14-47	GKAPAGKAPAEKKEAGKKTAAATGDKKKRTKTRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM19	Uncharacterized protein	0.996	134-153	KKKGRGRGRRKRKADGNAEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM19	Uncharacterized protein	0.649	158-162	TKKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQC3	Uncharacterized protein	0.946	49-83	KPRPKQRKEHDRRDVLKPAGIKKSPSRGIFKPFRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQX7	Aa_trans domain-containing protein	0.887	180-194	RPLLGRKKSSKRMRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVW5	SWR1-complex protein 5	0.977	87-97	KERKRKRRRKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVW5	SWR1-complex protein 5	0.835	118-131	RVAEKEERKNRKRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVW5	SWR1-complex protein 5	0.658	64-69	KKSGKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVY3	Protection of telomeres protein 1	0.993	389-406	KKERREAKKERIKRKKRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXM0	EH domain-containing protein	0.985	470-494	KHKKKRLVRKHPNKHHEGDRKRWRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYY2	Uncharacterized protein	0.761	232-242	KKAKEKARADK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3U0	Uncharacterized protein	0.647	433-437	KKVKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q405	Uncharacterized protein	0.875	7-20	KQFTRPPPKKKPPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2X8	ULP_PROTEASE domain-containing protein	0.885	244-260	ARRKEGERRRSRSHSPN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN51	SMI1_KNR4 domain-containing protein	0.781	371-379	GRRIPKKKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI36	Uncharacterized protein	0.728	3-30	RRKRDVLKRFFRRLTFHRSSKSSTKSKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI36	Uncharacterized protein	0.702	78-87	ERLERRERRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIY4	MFS domain-containing protein	0.925	497-513	RVKRAAKKSERKGQSKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN51	Protein kinase domain-containing protein	0.895	26-45	PKRRPSLLRKPKEWLRRHRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN51	Protein kinase domain-containing protein	0.648	676-687	SRGRSPVSSRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPY6	Uncharacterized protein	0.851	91-112	RPPGIEPGTTRISRHKRRVPKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR86	Uncharacterized protein	1	1008-1061	STSKGKQPKKDRKGKGKAKKKGKKQKSAVTLAELKKQGTRNKAQKKKYLRRLRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRU4	Histone-lysine N-methyltransferase SET9	0.955	532-545	PKKRGRGRPRKYPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRU4	Histone-lysine N-methyltransferase SET9	0.901	316-330	PPVKRGRGRPRKYPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRU4	Histone-lysine N-methyltransferase SET9	0.835	801-818	RASRLRGSPRRSESRRKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU30	Palmitoyltransferase	0.975	403-429	EKPHKKDRRPSSSHNGKRKRRLDVGWK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU30	Palmitoyltransferase	0.634	443-447	ARRIR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY80	CENP-C_C domain-containing protein	0.995	285-305	AKKRKGRPPKGKKNAAPKERD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY80	CENP-C_C domain-containing protein	0.978	398-410	HRRKRRGRKRTGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ55	Uncharacterized protein	0.934	191-204	QPAKPSKKRGRPPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ55	Uncharacterized protein	0.928	294-317	KELSKVKDARRGHNDKGPGRRPRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ55	Uncharacterized protein	0.902	147-171	EKPKLEVPEGQARIVKKRGRPKQAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ55	Uncharacterized protein	0.859	128-141	TARKGRPKRDHPAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ55	Uncharacterized protein	0.853	258-276	PSIKKRGWPRKAQPEHNKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ55	Uncharacterized protein	0.674	648-656	EKKPVSKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ86	Mediator of RNA polymerase II transcription subunit 6	0.967	295-316	EKSNGDRKGSKSSKKDRRKSRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0H0	AAA domain-containing protein	0.841	62-73	RKPGLGRPRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0H0	AAA domain-containing protein	0.633	1051-1054	GRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1J5	MFS domain-containing protein	0.689	526-536	WRKAKASPPPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2F3	Non-specific serine/threonine protein kinase	0.602	1045-1045	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5F4	Uncharacterized protein	0.998	173-192	EPKRRRNRGKKSKRRNKREE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKY3	Uncharacterized protein	0.989	1192-1230	PKKRGRKPPRDSGKRKQEEAALDSAPEPPKKRGRNPKPV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKY3	Uncharacterized protein	0.665	1158-1166	RIARRSEKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4Z0	Uncharacterized protein	0.991	35-50	KKKKTKIIKRKRRPAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCH5	Uncharacterized protein	0.67	207-211	RRKKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG42	Uncharacterized protein	0.992	1115-1178	AKKSPRGRKRYAAKEKISGAGRGRGSWGKGGGYRKTSAGSASGAGVTKKKAAARSNTRGGSAKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG42	Uncharacterized protein	0.879	826-847	RKSPSKSKASKVSKTAPKARKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ56	Acetolactate synthase	0.756	688-700	KERRQRTKERSGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK55	Uncharacterized protein	0.999	116-141	KKRDRSKRKKDKKGKKKEPSAGEKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLB5	Uncharacterized protein	0.895	226-242	REKKKRYRRSDREKERG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLE7	PWI domain-containing protein	0.637	475-479	RERKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM46	CULLIN_2 domain-containing protein	0.649	9-16	RAKIRPPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMZ7	DUF2431 domain-containing protein	0.801	4-29	NKKRKLHNKSQASSRSHSQPLKAKPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN81	Uncharacterized protein (Fragment)	0.981	336-359	FKKPKFKKEFRTKREKKVMRERKQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN81	Uncharacterized protein (Fragment)	0.925	91-104	KPKPKKPRLPPKEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSK2	HMG box domain-containing protein	0.996	371-386	KPKKEKKEKKKRKSEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSK2	HMG box domain-containing protein	0.979	327-349	RKRKAEATPGESEKKKKGKKSNA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSK2	HMG box domain-containing protein	0.834	279-291	PVVKKTPKPKKAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSK2	HMG box domain-containing protein	0.682	121-129	KKKRQYKPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSZ4	Uncharacterized protein	0.851	73-80	RKRRRKHK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTL3	Uncharacterized protein	0.679	29-34	LRHRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWK4	Uncharacterized protein	0.908	44-69	KRRKLEAELKAQQPESKISGKKRKRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWK4	Uncharacterized protein	0.885	187-197	PVIKKRRRQKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWK4	Uncharacterized protein	0.698	8-14	ERKHRKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY61	Uncharacterized protein	0.779	116-125	KKWKQRKEKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYN8	Uncharacterized protein	0.866	863-879	EPKKKEHRLKKLMFWKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1X5	MICOS complex subunit MIC60	0.852	128-137	PPPPPKKKKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2G4	WD_REPEATS_REGION domain-containing protein	0.945	496-562	LKNRGRGKNSSLRKYLRKKGNKNVIDEHKMRVMEMREKQRQRAKEIKEGKQAKELGPALSRFARKGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2J4	Protein kinase domain-containing protein	0.887	477-496	RRTAKLPPPKRATRKPLSRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJD6	RNA-dependent RNA polymerase (Fragment)	0.603	969-969	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCF4	Uncharacterized protein	0.993	382-400	KPSKSSKRRNKRGRKKDNR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCF4	Uncharacterized protein	0.89	679-705	RGKKAAKKAEREELRREGLLGSGGRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCF4	Uncharacterized protein	0.885	3-23	KKKAQNGRAKQKQKAKAGNTP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCF4	Uncharacterized protein	0.834	645-652	RPRKKGRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCF4	Uncharacterized protein	0.751	301-314	KKSKGRPRPDLGPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCF4	Uncharacterized protein	0.696	810-825	AKRNARGSTRGARGGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCF4	Uncharacterized protein	0.622	318-320	IKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCF4	Uncharacterized protein	0.614	201-205	KRPIK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDS0	Uncharacterized protein	0.854	126-138	KKKRRSSTEKPKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIG7	Tyrosine--tRNA ligase	0.878	364-378	PPEKKAKKAKNLGSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK78	Uncharacterized protein	0.75	215-220	RRRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK78	Uncharacterized protein	0.686	385-392	RQRRRAEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK78	Uncharacterized protein	0.663	162-169	RNKHARRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLE0	Uncharacterized protein	0.811	117-143	RRRSRSRGTRRSHARTEMTSRSPRRER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLE0	Uncharacterized protein	0.623	203-206	RKNR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVJ5	Uncharacterized protein	0.882	241-252	KKRRKRGQAPAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVZ7	Uncharacterized protein	0.743	435-441	NSKKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0D3	V-type proton ATPase subunit C	0.651	333-338	RAKKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4D8	Uncharacterized protein	0.807	208-239	RQKAEKPSKQQEVETKKQRQNRKKTEEARLAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNT4	BRCT domain-containing protein	0.766	999-1016	KRIKKTTYGRASRRKSSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNT4	BRCT domain-containing protein	0.705	1585-1590	SKKGKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3U3	Uncharacterized protein	0.778	131-154	EKASIKKLGKVAIFKAAKGPRQEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3U3	Uncharacterized protein	0.68	251-261	KKVEKRPNGPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3U3	Uncharacterized protein	0.652	119-123	RKRQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4Z8	XPA_C domain-containing protein	0.98	291-324	KRQKDAKDRKEKKFKNKLQELKKRTRVDAYKRAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLP0	Vacuolar protein sorting-associated protein 54	0.775	356-365	KRRRRENVKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI03	Uncharacterized protein	0.754	533-540	PKTKKRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR81	MFS domain-containing protein	0.714	504-512	AKKKAAAAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX22	Uncharacterized protein	0.888	289-305	PKPPKKQKEEPTAKRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZT3	Uncharacterized protein	0.667	6-10	KGKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0E7	Uncharacterized protein	0.789	624-631	RRVKKRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2E8	Uncharacterized protein	0.897	569-607	RLKEREEHERDRARRDRDDRNGSRRDDRDRSRDRRHRTR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2E8	Uncharacterized protein	0.83	371-380	KRLKRRRERQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2E8	Uncharacterized protein	0.737	224-233	KGKEKERKEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2E8	Uncharacterized protein	0.613	722-723	KR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2E8	Uncharacterized protein	0.606	710-711	KR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2K3	40S ribosomal protein S7	0.766	104-116	ILPRPKRSNRSRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIW6	RING-type domain-containing protein	0.934	713-725	PSGGGKKGKKNKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIW6	RING-type domain-containing protein	0.846	557-584	RRRKRNEEKETREEKDRIRIEKASEREL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIW6	RING-type domain-containing protein	0.789	67-76	AKAKHKPGKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIW6	RING-type domain-containing protein	0.613	587-589	IRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKZ5	Uncharacterized protein	0.656	14-20	KRKASSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNR1	BHLH domain-containing protein	0.667	32-36	KKRAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBG1	Eukaryotic translation initiation factor 3 subunit G	0.933	54-90	KKVKRTQRVRRTVVKKRENPRVAERRAWDKMGPEAGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE61	Double-strand break repair protein	0.994	597-651	KAPARGNGSRAGRAGRAGKAAAGTARKAPASKKTAGRPAGKPAVKSATGRGKNKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE61	Double-strand break repair protein	0.954	538-553	RGELKRRRRKGTIKPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE61	Double-strand break repair protein	0.631	695-701	KRAAPKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE63	J domain-containing protein	0.969	205-225	WRDFQKKQGGEAKGKKKKMKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE63	J domain-containing protein	0.723	184-189	RKRKRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEN0	Uncharacterized protein	0.731	268-274	RRTKKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ18	Uncharacterized protein	0.786	652-665	RKHGGAPEEKKKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL00	Uncharacterized protein	0.958	583-628	RVTKRKKSGKAATTGRRQRKAAAVVATIAVEKNGRARRSGRARRKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL00	Uncharacterized protein	0.63	565-568	PRRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL00	Uncharacterized protein	0.612	184-187	AKVR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL00	Uncharacterized protein	0.602	550-550	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQI8	Uncharacterized protein	0.873	40-52	QRPPAPKRRRHNK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQS4	Tafazzin family protein	0.736	294-302	MKERARRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT71	Nucleolar protein 58	0.999	519-581	KEEKHKRKAEKAARKAEKAARKAEKEAKKAKKAEKEAKDSGKKRKADDDEEPKKEKKKHKSKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTR4	Uncharacterized protein	0.866	102-115	PVPDKRPRRHIKKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU20	Uncharacterized protein	0.634	175-182	TKQERRER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU20	Uncharacterized protein	0.628	169-173	RRHSH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXZ3	Ribosomal_S17_N domain-containing protein	0.794	26-39	KSRKTPKVGKGGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0I9	Uncharacterized protein	0.766	102-112	RRRQSRGRGRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WM54	CP-type G domain-containing protein	0.688	678-689	KHNKANKRQQKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJ20	Uncharacterized protein	0.973	596-616	RSKRARRRSRSKYRAGASRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJ20	Uncharacterized protein	0.97	216-239	RSRRKLLREKPERKERPPSKVKLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJ20	Uncharacterized protein	0.924	428-449	QTRLRRAVADGRARRKNRRTPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJ20	Uncharacterized protein	0.853	721-737	PPPPKKRDPKEFMPKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJ20	Uncharacterized protein	0.792	99-119	PPKPVRKPATTKGEPAFKRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJ12	Ubiquinone biosynthesis protein coq4, mitochondrial	0.743	259-272	KALRDERRREKEPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKA8	Uncharacterized protein	0.959	137-264	KPGSKPPTEAPAPSKAPSKAPSKAPSAAPDPPPSKPGSKPPTEAPAPSKVPSKAPSKAPSAAPDPPPASKPASKAPSAAPGPPPASKAPSGSKPSTEAPPPSKAPSGSKSGSKPATVAPPPSKPGSKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHF2	Uncharacterized protein	0.712	383-392	KAAREARKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMH8	Elongator complex protein 1	0.986	1163-1180	KTSKNRRREERKRARGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPM2	Uncharacterized protein (Fragment)	0.623	38-44	SRVRHGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPY3	Ubiquitinyl hydrolase 1	0.999	1079-1098	WKRKKNKKRRKGGKKGTWKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPY3	Ubiquitinyl hydrolase 1	0.693	1193-1201	KQRRSERKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRF9	HET domain-containing protein (Fragment)	0.76	48-54	KERRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVA9	Uncharacterized protein	0.996	427-452	RANKKRERLRKEMQNKHPVKKKKRKF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0K3	MMtag domain-containing protein	0.994	142-176	KEKERRSRRERERSRDRRRRTQGRGGKPFTIAQRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2A5	Tr-type G domain-containing protein	0.776	88-98	KKEAKKDKPKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJ18	Uncharacterized protein	0.632	229-234	RKGSKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YK84	Uncharacterized protein	0.989	220-264	RRKDRKRGKEFEKKGSKAWIMRKKAQMEAKGKVVKSSSKYTGRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDR4	Uncharacterized protein (Fragment)	0.897	306-318	GSPTRRRKRQPKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK06	tRNA (guanine(26)-N(2))-dimethyltransferase	0.979	98-120	RKRLRNERNKDRHNKKQNKKRKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN43	RING-type domain-containing protein	0.74	162-171	SKAKSRSKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPG0	Uncharacterized protein	0.672	357-363	AEQKRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRF3	Uncharacterized protein	0.773	1275-1283	KRTKLKKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW97	AAA domain-containing protein	0.989	552-564	AAERPKKKRKKKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW97	AAA domain-containing protein	0.98	205-228	PPIKKTKNSGEPKPEAPKRRGRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW97	AAA domain-containing protein	0.963	707-738	KPKAQRKPKPAEPRKVVKEKTVKAVQDAIKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW97	AAA domain-containing protein	0.644	279-282	KKRI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXF2	Uncharacterized protein	0.637	447-450	KKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXF2	Uncharacterized protein	0.614	133-136	RRER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZF3	Uncharacterized protein	0.846	299-314	RPSSGKRSRGRPPERK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZF3	Uncharacterized protein	0.744	260-268	KRPRGRPRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZF3	Uncharacterized protein	0.697	701-712	RQRAEEGKLRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1G7	Kri1_C domain-containing protein (Fragment)	0.996	564-585	EDRKKKDKKKLSKKARLKQWRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1G7	Kri1_C domain-containing protein (Fragment)	0.986	470-495	KKKTTKKDRGKEKADAKRAARIEKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1G7	Kri1_C domain-containing protein (Fragment)	0.979	303-355	RREEKNSRARAREREREVREAEKREREEDKARLRKLKIEEAEEKVKRIKEAAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1G7	Kri1_C domain-containing protein (Fragment)	0.957	622-630	EGARKRKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1G7	Kri1_C domain-containing protein (Fragment)	0.724	409-415	KRKPKKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1T1	Uncharacterized protein	0.788	63-70	GKRRRRGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1T1	Uncharacterized protein	0.753	38-45	AGGRKRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Z7	Uncharacterized protein	0.816	447-457	KRFRRERKRIK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Z7	Uncharacterized protein	0.695	327-332	PPKRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Z7	Uncharacterized protein	0.604	793-794	RR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q312	Uncharacterized protein	0.978	598-610	PRKAKESRKRKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q312	Uncharacterized protein	0.736	29-49	KRKLKRSEFGQKKYLLKQKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3W9	1-alkyl-2-acetylglycerophosphocholine esterase	0.806	21-30	AKKPKARPPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YP91	Uncharacterized protein	0.984	49-76	VEAKLKSKRAKRRSRVAVRMKAEGLSRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YP91	Uncharacterized protein	0.606	28-30	RTR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD53	Uncharacterized protein	0.672	84-95	VIKRTPTSKRGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTF9	Uncharacterized protein	0.972	645-667	TKRSYRKGRAKWSRRLHLGKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU62	Uncharacterized protein	0.819	713-723	PARRPRAKSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUJ7	Uncharacterized protein	0.763	364-373	IEKRNKPRKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUJ7	Uncharacterized protein	0.683	342-347	KRPRKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Y3	Zn(2)-C6 fungal-type domain-containing protein	0.767	230-241	RQRRHHRPSARR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2V0	BHLH domain-containing protein	0.963	198-209	APPKKKGGRKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Q6	Uncharacterized protein	0.875	37-52	EKRRKETAKLQKKSRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIC1	Uncharacterized protein	0.999	75-100	KRGKKGKATAKSKPKPKPKPRKITKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y1B2	Mating type locus 1-2	0.894	139-153	RKPSEKKKRMTKNKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN59	Uncharacterized protein	0.829	252-272	GRGKKGGRSTSRSAPGPSPPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN59	Uncharacterized protein	0.783	947-957	VSPSKRRKSPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN59	Uncharacterized protein	0.765	962-974	GLTKSGKRRPAFG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN59	Uncharacterized protein	0.747	278-309	PPGQPRGSGAGSGANGRPFAPRTSPKPGPPKQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN59	Uncharacterized protein	0.732	932-937	GKKRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN59	Uncharacterized protein	0.699	897-906	KGKAKSPPPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN59	Uncharacterized protein	0.634	759-763	PKRTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCD5	Uncharacterized protein	0.829	702-715	KWKSRKRTPGRARR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI65	Uncharacterized protein	0.999	4-82	RRNKSRAAKTAGEEKRRVEPPKKAPAAASAVKPKPKSKAKARIMTKAKPSPKAAGKSKKKETEAKDTSRKSLAKTGGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI65	Uncharacterized protein	0.981	94-123	KDSKSTRGAPKKRNLPPPTPGKPTGRKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIQ9	acidPPc domain-containing protein	0.656	39-48	RRRFRSTRSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQQ0	Pre-mRNA-splicing factor CWC24	0.671	47-51	KRRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQQ0	Pre-mRNA-splicing factor CWC24	0.656	11-22	KRANKGSNVRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS66	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	0.751	277-285	KKKKWPAPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Q9	Uncharacterized protein	0.99	151-198	RGGEGGRRSQGREAGKVKSRRPNEKLKQQAVRRSRKGGKFVKEEKAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIS0	Uncharacterized protein	0.977	71-94	VENRAKGEVKPKNKEKRLRRWRDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIS0	Uncharacterized protein	0.909	55-67	PKKRRAKRQAPSD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIS0	Uncharacterized protein	0.758	37-43	KRRGKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCZ7	SET domain-containing protein	0.965	327-343	QRKPKKGTGKKNHKRSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGF2	Uncharacterized protein	0.617	82-83	RR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGH9	Uncharacterized protein	0.965	297-320	KINVRRAEIEKRREEIRRKSAKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGV5	Hva1_TUDOR domain-containing protein	0.999	106-185	KRKAEETAEEKKDGEEGKAAAKKQKKDEPKENGDAPKKKGRPAKKDANGNAAPKKDVKKKEPKKAATASGEPRRSGRNKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJG7	Uncharacterized protein	0.834	534-558	SKGKGPVGQPGKPRPVAVGRPPKSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJG7	Uncharacterized protein	0.625	240-242	KKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN27	Uncharacterized protein	0.971	86-107	KRKHTGPKKSAPDKRRKTSAKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN27	Uncharacterized protein	0.792	455-469	PPAKRTRSARLKSGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNW4	WD_REPEATS_REGION domain-containing protein	0.88	364-374	RPKRSRGRKSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPB5	G-patch domain-containing protein	0.956	85-100	PRHGQSGKNKKKKKSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPB5	G-patch domain-containing protein	0.835	145-153	RRRERRRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPB5	G-patch domain-containing protein	0.73	425-429	KRKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPB5	G-patch domain-containing protein	0.688	9-19	KKNAKPAPKPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPY0	MHYT domain-containing protein	0.834	691-701	RKLPKRHRKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWF7	Uncharacterized protein	0.954	547-592	APRRAARRPRNPFPANPRAAGAAPAVRNHERGARRRPPAANAGPGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXD8	Exocyst complex component SEC5	0.811	1037-1053	RERRGRREAGSREGASK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXU3	Uncharacterized protein	0.774	1575-1583	DRRRRARLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXU3	Uncharacterized protein	0.765	1671-1689	RRRRESANDERAQRRARRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXU3	Uncharacterized protein	0.734	1115-1122	PRPKKKLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q518	Pex24p domain-containing protein	0.921	456-506	KGKKVGIGRVKSAPKSGWEESNGFSGHKRGEWRRRRWMRLVEKRASDDGGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q518	Pex24p domain-containing protein	0.897	103-117	PRKKDRRSKKYVKRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q518	Pex24p domain-containing protein	0.719	45-58	RKRDRLKGHANKIK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WHL9	Uncharacterized protein	0.894	15-37	ARLKKQIDEERRARWKARGPKGD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJ24	Uncharacterized protein	0.909	89-127	KKRQLAKARGQKKESWNIRKKPLTTQQKIKAAIAIRKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJ24	Uncharacterized protein	0.889	34-48	RAPAIKEKKKKNQPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJ24	Uncharacterized protein	0.642	188-192	RREKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNH6	USP domain-containing protein	0.96	842-858	RKEREILKREKRKSKKH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNH6	USP domain-containing protein	0.687	11-18	REKKNPRH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEW1	Uncharacterized protein	0.977	690-707	LAKEKRRSKKEKARERER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEW1	Uncharacterized protein	0.871	617-630	KRREKLLKSKKKLL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEW1	Uncharacterized protein	0.609	755-756	KK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGB6	Uncharacterized protein	0.946	352-386	AKRKEQRQKERQEKLERKLRSRDGRNRGDSDARTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGB6	Uncharacterized protein	0.856	303-330	RKEKDKGKQKEPDKERTFASRDRDRKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGB6	Uncharacterized protein	0.633	224-229	RRDSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI84	Uncharacterized protein	0.733	115-127	KGSPKPKQIARKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJR1	Uncharacterized protein	0.949	192-210	RIERRQRRLEKARQKRKEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK46	Protein kinase domain-containing protein	0.97	17-36	RRKAEKEEKKRLKAEKQRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMD8	Uncharacterized protein	0.994	36-46	SKKKKKKKKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPM8	Peptidase_M14 domain-containing protein	0.803	581-586	KRRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQN1	PPM-type phosphatase domain-containing protein	0.663	541-548	RRDFRKRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV27	Uncharacterized protein	0.699	50-63	EIKKLQRSRDKIKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVH9	RHOMBOID-like protein	0.812	107-117	RKKKHRTDRGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWD4	Uncharacterized protein	0.929	253-270	RRRRWLRMRKRKDLKQHT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWD4	Uncharacterized protein	0.666	540-547	KKSKEKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX09	MPN domain-containing protein (Fragment)	0.68	43-60	EKKQKWLRQQRQRFAEKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKX8	40S ribosomal protein S1	0.959	5-20	KNKRLSKGKKGLKKRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y599	Uncharacterized protein	0.797	536-543	KRRKKGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJX8	Uncharacterized protein	0.996	1407-1450	AKKEELKRKKKDIKKDLKKAQRSLTERLEQRKKEKEERRVKRAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJX8	Uncharacterized protein	0.954	528-560	KLPAKTLSKDTKKAKAASKNKAAPMRKTPRPTR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJX8	Uncharacterized protein	0.84	772-790	TPAAPPSPRPKRDLKGKVG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTS7	Septin-type G domain-containing protein	0.71	10-16	RRKKNVK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU12	Uncharacterized protein	0.649	69-76	RRHIRPRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUP8	Uncharacterized protein	0.668	172-190	RSAGTRRLPTHRDTPRKSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ01	Uncharacterized protein	0.87	484-506	IFHRKSKDAKLAEKPKRQSLKGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ01	Uncharacterized protein	0.605	324-324	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0F9	Uncharacterized protein	0.745	145-153	GKKRPKIVI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0F9	Uncharacterized protein	0.607	155-155	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2S6	ATP-dependent DNA helicase II subunit 2	0.912	552-577	VIKAAEVKKVPPKAAGKRYSRKEAPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4G5	RNA polymerase II transcription factor B 38 kDa subunit	0.626	176-182	RREAARR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4J7	Uncharacterized protein	0.997	81-114	AKTKKRKRNEKEAIDNIKKAKASASKKGKKKAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4J7	Uncharacterized protein	0.958	180-196	KAEKKAAVKAAGKKRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIU6	Uncharacterized protein	0.966	77-93	RRKRRGRSSSRKRNNAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y271	DNA mismatch repair protein	0.93	328-341	PAKKGKKTPARGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMS4	Uncharacterized protein	0.994	556-591	PRRKASPKRRAANPRKRSVKERVRVLDGNSKRKSRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC25	C2H2-type domain-containing protein (Fragment)	0.781	71-79	KGKPHKRRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCH2	Uncharacterized protein	0.868	412-428	HPPASKQRESSSKKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK6	Transcription initiation factor IIF subunit alpha	0.899	560-600	KGRTKLKLKNSPPGSPSTGTPAGSRAGSPTPGGKPKAKKPV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK6	Transcription initiation factor IIF subunit alpha	0.863	194-203	KAGKKKPSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK6	Transcription initiation factor IIF subunit alpha	0.837	419-431	AKKQKRARRLLRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK6	Transcription initiation factor IIF subunit alpha	0.767	39-48	KRKPPVRKAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK6	Transcription initiation factor IIF subunit alpha	0.746	493-502	GRPEKRTKRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKK1	RING-type domain-containing protein	0.671	88-92	RRRRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM64	Uncharacterized protein	0.89	770-785	AETNKKPKRPSHGHKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM64	Uncharacterized protein	0.722	748-766	RSRAKPPAAPRHVEIKEDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM64	Uncharacterized protein	0.698	141-148	SRRRLEKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT66	Drf_GBD domain-containing protein	0.867	181-217	SKRSRARSRTFTFSRGDKKNTKSESPSKKARAQSKGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT66	Drf_GBD domain-containing protein	0.694	599-606	PKKSPNKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWH4	Uncharacterized protein	0.715	1362-1369	RRAKQRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWH4	Uncharacterized protein	0.696	1401-1411	KEERAAEKRRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX57	Serine/threonine-protein kinase Tel1	0.776	428-434	PRKRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZY2	SEC7 domain-containing protein	0.741	318-326	AKKHGKRPS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKK6	Uncharacterized protein	0.938	28-42	PAPKRRKTKSASKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKK6	Uncharacterized protein	0.649	61-68	KPKASAKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4D7	ABC transporter-like protein	0.686	863-871	AKKQARRGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJC3	Uncharacterized protein	0.885	260-303	KRAAKQAKVEKEQQAAREKRAAKQAKVEKEQQAALEKRAAKQAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKA6	Peptidylprolyl isomerase	0.917	287-301	KADKKAEKKGKNKRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKA6	Peptidylprolyl isomerase	0.703	331-337	KKQKKQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNZ9	Uncharacterized protein	0.878	305-317	SKREAKRRAHKAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUA0	Uncharacterized protein	0.856	674-700	RKVAEEAAAKKRAEEEAAKKAAEEKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUA0	Uncharacterized protein	0.745	533-544	PVKTRKVKKQVR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUL8	Uncharacterized protein	0.991	159-210	KVAGSRIARRKRKGREPKIEASGKQTLIEARKQRALLNARGSVQPVKKRRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUN2	RF_PROK_I domain-containing protein	0.988	110-136	QSRTALKADKASKKKASAAKKSRRKYR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWT2	Uncharacterized protein	0.707	378-383	RRRRRH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWT2	Uncharacterized protein	0.639	251-255	KRGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZS9	Uncharacterized protein	0.989	454-488	HGHGHGHGPPHGHGRGRGGRGWRGRGRGSRGGRGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZZ9	Uncharacterized protein	0.989	117-199	RRTDREPRRRKPKPMPFKKEHEEALQRKAEAEGRREAREAAQQERQQKIEEREKFRKAMSKARTGGWNGQRKLGRESKPLLEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZZ9	Uncharacterized protein	0.87	5-26	RKRDRDDGDAKDERKKQRKGFR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0X7	Uncharacterized protein	0.853	723-753	PRNRKRSLDHQRNSRDSRSSKMRKSNSRRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q150	Uncharacterized protein (Fragment)	0.86	386-406	KQKPKRPRKDGVEQPEKEEPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q150	Uncharacterized protein (Fragment)	0.767	34-50	RKRLGRATAKREKFSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q382	NUC153 domain-containing protein	0.781	29-36	RKRKRSLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q382	NUC153 domain-containing protein	0.667	483-491	SRIRGTKKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q382	NUC153 domain-containing protein	0.634	733-737	RGKER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Y1	Uncharacterized protein	0.777	107-115	PRRNRRRPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4X5	Uncharacterized protein	0.63	172-175	KKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q553	Uncharacterized protein	0.946	77-91	RREWRKHGKKRKMYG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJ61	Uncharacterized protein (Fragment)	0.713	610-620	GSKRLLRRARK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBX5	Uncharacterized protein	0.923	31-45	KIKRKRAQKRAPPPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD56	RING-type domain-containing protein	0.978	372-423	PKPVKVSKRGKKAVGEPTGPKQPKQISPETKANREKQAVRREKRKGLEQKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD56	RING-type domain-containing protein	0.621	339-341	KKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDJ7	Uncharacterized protein	0.847	131-143	SKKERKAAKKVAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH35	Uncharacterized protein	0.83	166-175	SKKGKKNKAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHC0	Uncharacterized protein	0.819	323-339	GAKRKWHDRFRPHKKTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ35	Uncharacterized protein	0.983	155-180	REVEEKERDTARKKQKKQKKMERKIR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKA8	Topoisomerase 1-associated factor 1	0.999	1043-1076	GAKGKKKGAVKGKAAKAKAALKSAKKPARKKRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKA8	Topoisomerase 1-associated factor 1	0.987	940-961	KEKRKKRAEGDQDRPRKRRRRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKA8	Topoisomerase 1-associated factor 1	0.961	565-577	RSKRRARKKQKPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKA8	Topoisomerase 1-associated factor 1	0.951	974-990	AKRKAKEKKDREKNSKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKC9	Protein kinase domain-containing protein	0.631	929-933	RKPRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMB2	U3 small nucleolar ribonucleoprotein protein MPP10	0.997	619-660	PKAREEMDRDERKRRRRREKERIRKAGTNEGPEMQSKKTKEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMB2	U3 small nucleolar ribonucleoprotein protein MPP10	0.969	53-63	KEARKKRKRRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMB2	U3 small nucleolar ribonucleoprotein protein MPP10	0.816	325-334	KSKKNKKGRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRC6	Zn(2)-C6 fungal-type domain-containing protein	0.766	72-78	PRRRKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRC6	Zn(2)-C6 fungal-type domain-containing protein	0.736	670-683	RREESLRRRAEKER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU34	Uncharacterized protein	0.996	1917-1996	VEGAKAKIARRKAKAAEAKAKAKATAKKNDGASRSTLKDKAAPKDKAAPKDRAVPKAGAAPKVGAAPKDRAVPKAGATPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU34	Uncharacterized protein	0.619	2054-2057	KTRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV40	Zn(2)-C6 fungal-type domain-containing protein	0.94	460-494	RKAVKHKVKSGKINGPNGLKPAKPRALSMSKHKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV40	Zn(2)-C6 fungal-type domain-containing protein	0.895	627-633	KSKKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WLV8	H/ACA ribonucleoprotein complex subunit CBF5	0.999	452-487	KKEKKEKKRKHEGETAEEKAERKAKKKAKKEKKAKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFE0	C2H2-type domain-containing protein	0.828	261-271	IRKEWKAKKKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG14	Uncharacterized protein	0.868	564-578	GKKQLPGSRKRKPPG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG14	Uncharacterized protein	0.691	48-54	DKKWRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKY1	Uncharacterized protein	0.603	771-771	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNA3	Nucleolar GTP-binding protein 1	0.768	508-526	ENKMRKSLKNRAVIPRSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPC8	Uncharacterized protein	0.918	286-297	DVRRGKKRGSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPC8	Uncharacterized protein	0.664	317-322	KRRGLP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPC8	Uncharacterized protein	0.606	325-325	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS74	PH domain-containing protein	0.662	452-459	KKRRSEPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS74	PH domain-containing protein	0.605	462-462	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTC7	Uncharacterized protein	0.68	361-365	RPKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0V3	Sas10 domain-containing protein	0.999	559-599	KNKGLTPHRKKDVRNPRVKKKKKYEEKKKKLASIKPVYKGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0V3	Sas10 domain-containing protein	0.629	58-61	KRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q144	Uncharacterized protein	0.854	123-132	GPRRRKAKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4A0	AB hydrolase-1 domain-containing protein	0.915	624-638	QPKPAKKPKRSPEHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4A0	AB hydrolase-1 domain-containing protein	0.824	390-403	PASGRRRSKNSKRH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4A0	AB hydrolase-1 domain-containing protein	0.795	502-521	RPKLPRMRSSKHESKQPRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4A0	AB hydrolase-1 domain-containing protein	0.788	651-658	RRKSRRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WN90	Uncharacterized protein	0.949	192-228	KSSAFKGKSKKLVLSSKKATPPRKASTNARKSLGKKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WN90	Uncharacterized protein	0.682	324-329	ERERKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5H6	Uncharacterized protein	0.86	223-231	GSYKKKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5H6	Uncharacterized protein	0.687	210-217	PKSTKKRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDG4	Uncharacterized protein	0.985	243-252	RKRKRKRKPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDG4	Uncharacterized protein	0.979	169-201	EPVKKKTKVKGPKGPNPMSVKKAQKDKPKSVGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDG4	Uncharacterized protein	0.818	129-153	KAKIRAGLKTRRGATLAGAGEKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PK04	Uncharacterized protein	0.672	123-127	EKRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLX2	DNA-directed RNA polymerase subunit	0.753	266-276	LKRAENNRKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLX2	DNA-directed RNA polymerase subunit	0.607	1359-1360	KK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN17	RRM domain-containing protein	0.962	239-285	KGPKGVKGGKVRPRNRIEGTRFRKGAERGVWEGRVTREQERRDAKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN17	RRM domain-containing protein	0.85	37-68	RPAPGKSALKKSKVETTITSKANGKKTKTKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN17	RRM domain-containing protein	0.688	385-390	KKRKVK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN17	RRM domain-containing protein	0.667	340-344	KKKKQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN17	RRM domain-containing protein	0.616	9-11	KRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV26	RNA-dependent RNA polymerase	0.655	687-691	MKRKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV26	RNA-dependent RNA polymerase	0.618	789-791	RKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV33	Uncharacterized protein	0.655	1289-1301	RGGGNRGGIGGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWA4	PseudoU_synth_1 domain-containing protein	0.886	46-55	PRRKPKKPSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYH6	Uncharacterized protein	0.912	179-200	KAAAEEASAKEKKKAGKDKDPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYX7	Uncharacterized protein	0.834	252-267	KPKEKPKPEQPAKKPD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q120	Uncharacterized protein	0.985	106-119	ARHARRKAKRRKRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q120	Uncharacterized protein	0.661	318-325	KPRQRPRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2Q8	Uncharacterized protein	0.758	193-200	RRRDRRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4P8	Uncharacterized protein	0.996	857-896	ASGRGSRGGRRGRGSRGGRGGRGAGGGRVKKALSKPATKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4P8	Uncharacterized protein	0.842	43-64	GPAGRPRQTARKASPAPRRHAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4P8	Uncharacterized protein	0.635	777-780	KRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Z0	Uncharacterized protein	0.929	51-75	KQTKDGQPPKRRGPKPDSKPALTRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIV4	Uncharacterized protein	0.743	12-29	SRGRSKSPSGRDGRDRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMG9	Uncharacterized protein	0.6	52-52	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHU1	EH domain-containing protein	0.928	21-42	RSRPTNGAGRRKLHRHAKHPRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI40	HMG box domain-containing protein	0.951	8-32	TRGSKKAVDKSAGGKKKKDPNMPKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNH0	Uncharacterized protein	0.755	326-355	VRRPRTPPPREYEKEEIIIRRKERSPSPEP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNH0	Uncharacterized protein	0.646	166-172	RSRPPRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNH0	Uncharacterized protein	0.638	370-374	RRKAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNH0	Uncharacterized protein	0.63	718-721	RRPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNH0	Uncharacterized protein	0.616	260-264	PPPPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ97	Transcription initiation factor IIE subunit beta	0.869	252-270	RKGNTQKKERKRINRIGTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXF4	Uncharacterized protein	0.881	121-142	KYRNRAGSHQPRKRSRSPIRAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYH3	Uncharacterized protein	0.708	552-563	RELRDRAKKEIR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZS7	Spc7 domain-containing protein	0.92	25-41	LSPKKNGRKGRSKSVGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZS7	Spc7 domain-containing protein	0.764	1185-1195	LIARGAKGARK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZS7	Spc7 domain-containing protein	0.66	161-165	TKPKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZS7	Spc7 domain-containing protein	0.641	54-59	TKDRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZS7	Spc7 domain-containing protein	0.602	51-51	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZW2	Ubiquitin carboxyl-terminal hydrolase	0.755	397-404	RAKKRQKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Z4	Spindle pole body component	0.792	11-25	RPRKRSLRSLKAPKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1H9	G-patch domain-containing protein	0.891	243-255	RAKAKPKPKPLKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q433	Uncharacterized protein (Fragment)	0.99	39-69	RARRRFNRGLKRKPMGLIKKLRKAKQEAKPN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5A4	AAA domain-containing protein	0.985	10-24	SLKRKRRSRRRREDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5A4	AAA domain-containing protein	0.811	1415-1423	KKGKGKGKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKS6	G-patch domain-containing protein	0.999	201-284	KQKRRKDKKNSPEEDPSASESSKEDKAKEVKRPKKEAKKADKAAKAQPIMTEEDRKAHLKEEKRAMKLERRKRKEDKRAKRAAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK1	RING-type domain-containing protein	0.963	11-22	PKKKQKKKLRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGY2	Uncharacterized protein	0.893	203-250	RRGQTRHVRLRPPLRRRDWQRVIKNRRSMWRHEASAVSVRRLHAKPRI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGY2	Uncharacterized protein	0.748	299-307	KPKRAKVKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHN0	OTU domain-containing protein	0.612	406-409	KAAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLC9	Uncharacterized protein	0.841	430-445	RDGLKKRIGSLRKKHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLC9	Uncharacterized protein	0.742	213-226	KDSKKAHRSPHLKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PML9	Uncharacterized protein	0.776	1039-1048	KIRSRRRSRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PML9	Uncharacterized protein	0.753	327-332	PRKRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PML9	Uncharacterized protein	0.707	260-265	KKKKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS69	Uncharacterized protein	0.993	31-47	PSKKAKRKEKKAKTKKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS69	Uncharacterized protein	0.985	276-289	GKKKPKRKTHKPRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS69	Uncharacterized protein	0.963	313-376	KKRYGKGSAKEQRSTVPGARQAASARENAPRKERDDKYKKMGKDERQEVRRKKFDARTKAPGKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTD9	Glycosyltransferase family 1 protein	0.976	819-846	AKHMKKRAEHERKKAEVQRRKDNREAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTD9	Glycosyltransferase family 1 protein	0.668	156-165	GKRTRQPKPQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUZ6	Uncharacterized protein	0.98	76-93	KNKAKITKRKPMSRKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWY7	MPN domain-containing protein	0.932	355-368	AKEEPKKDDKGKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2B0	Transcription factor BYE1	0.945	7-50	RSGRATKGQHKNASSSPAPQPKPAKGAGSGAGAGAAKGKPGKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2B0	Transcription factor BYE1	0.883	147-166	KKMSKNRKSKNRGGDDGKPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2B0	Transcription factor BYE1	0.734	196-202	SGKKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2B0	Transcription factor BYE1	0.624	235-237	KRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3M9	Transcription initiation factor IIF subunit beta	0.918	242-255	KPGKGHKKKPLKEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q401	Uncharacterized protein	0.973	168-190	KRPPPSSRRSGRSERSRRETRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q401	Uncharacterized protein	0.774	36-45	KTVPKKKRTR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q401	Uncharacterized protein	0.766	84-109	RRSQPERPSRRSGERIPDDHRRSSRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q516	Uncharacterized protein	0.917	75-85	KRKKTRQRRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIK5	Uncharacterized protein	0.7	970-976	KRPRPRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJK5	Actin cytoskeleton-regulatory complex protein PAN1	0.97	1423-1442	KAGKVKKAEEKKRREAAKKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WJK5	Actin cytoskeleton-regulatory complex protein PAN1	0.756	1322-1334	AGKSKPPPPAPRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGJ5	Uncharacterized protein	0.999	73-155	EESRARARARKLKDERNGGDERSRSPRKERRRKDERREREVYSARRVHERRSRGHDGTRKGERKVSRERDSKRVDDRKRLRRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF23	Uncharacterized protein	0.944	449-471	RREGSVARRARNKTKKRLFGRGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF23	Uncharacterized protein	0.605	179-179	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIB5	Uncharacterized protein	0.989	5-18	RSKSKKKRARKPRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNV0	PHD-type domain-containing protein	0.976	410-427	PAKKAPKARPGPPKGKKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNV0	PHD-type domain-containing protein	0.884	826-838	VGRKGKAGRGRGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNV0	PHD-type domain-containing protein	0.876	338-349	KPRKAPKAGKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNV0	PHD-type domain-containing protein	0.837	539-570	EERAKHEVRGERRPPASRSGSDKDVSRKASGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNV0	PHD-type domain-containing protein	0.783	590-598	RSRSKRKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNV0	PHD-type domain-containing protein	0.765	314-326	GREARGEKNRGKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PT22	Ysc84 domain-containing protein	0.854	527-542	PKRPPPKLPPRNPGRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUB4	Uncharacterized protein	0.995	295-328	ALRRAGVVSRDPRRVERKKPGKLKARKMPAWVKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV82	CULLIN_2 domain-containing protein	0.737	18-25	RKRKRPSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYR8	MFS domain-containing protein	0.837	400-421	KGEKRDPGKLLREEKMRKRITK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYR8	MFS domain-containing protein	0.746	926-941	EKEQRRRGGHAGVVKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYR8	MFS domain-containing protein	0.648	908-917	GRSGQSKRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYT6	Uncharacterized protein	0.939	46-77	SQRVRQKGGRSSRQERQPKATKAAKKAAPVRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYT6	Uncharacterized protein	0.647	16-23	RDRRSSRH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0P8	Uncharacterized protein	0.978	468-492	RIKAKKKVITAEGRKLKAARSKKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0P8	Uncharacterized protein	0.636	683-686	KRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Y7	Uncharacterized protein	0.853	205-216	VKKIEKNHKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3W5	Uncharacterized protein	0.92	957-974	SRREHRVHRKEGGRSGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q538	Uncharacterized protein	0.849	173-188	PARRSRRSGFRHRRIR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y343	Eukaryotic translation initiation factor 3 subunit J	0.881	60-94	EKAKKAAEAKAKADALAKANQKPKSQRIEEKRNER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y343	Eukaryotic translation initiation factor 3 subunit J	0.835	237-251	EKAAEKGGKKTKAAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDF5	Cytochrome c oxidase assembly protein COX20, mitochondrial	0.667	166-173	KKAREQRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PG80	Uncharacterized protein	0.996	90-123	ARNHQPAAGRRRPRNSRGTKQAKKRRDARRNERK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIE0	Uncharacterized protein	0.641	116-119	RRKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJB6	Uncharacterized protein	0.899	147-159	KRRRSAKWKAKGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTI2	Uncharacterized protein	0.931	200-222	RKLAALRRARKEKEKEKEGMEAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWL9	IF3_N domain-containing protein (Fragment)	0.805	149-160	EKAKKKQAKEQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWL9	IF3_N domain-containing protein (Fragment)	0.661	210-217	KQGRKASK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZL6	Uncharacterized protein	0.903	688-742	DRIRGVKKPVNGKSCTKGRRSPKKTDKALCSHGLEKRKFKKALEERHQELKKRNG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZL6	Uncharacterized protein	0.65	662-675	RLRGIKHALERRQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZV2	Uncharacterized protein	0.966	564-638	RPRTKSNAHSSPLPPARRRSPAPGMLKHQSTARSPPPPVRRNTARSPPPPARRGTARSPAPAKLFTHSPKRSRSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZV2	Uncharacterized protein	0.953	723-760	GLEKKRQRRKEKLYQKACAKAAAKGEKAYKVKPGKGAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZV2	Uncharacterized protein	0.699	453-459	KIHRKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3J3	Uncharacterized protein	0.885	4-29	PKNRQPRPPRDQSRGGRGGRGGVRGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3S4	Alpha-1,3-glucosyltransferase	0.668	7-11	PRKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WHQ6	Uncharacterized protein	0.983	194-220	KRKMSNTGRVPGRRRSLKRQKKKNFPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLQ0	Uncharacterized protein	0.896	59-78	RHRVRRKKSDGQAKFRAKRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEM1	Uncharacterized protein	0.997	67-93	RRRARRYRGDRRRRSQIRRRRRRPDRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEW4	Tr-type G domain-containing protein (Fragment)	0.912	31-55	RKAKRQAEEEAEARKREKASREKRQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK4	Uncharacterized protein	0.978	68-95	GSARKKALSKRKAAGEEGTPSKKKKTKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFR4	Uncharacterized protein	0.72	786-806	RRPTPSGGAAPKPPAKDSAAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGE3	PARP-type domain-containing protein	0.991	145-229	PKKPAPKKRGRKAAHEDDGAADEAPAPKKARGKKVKAEDDETAEPPATKKPRGKKAKAEDAADAKGAAPAPVKKKGRQPKASKPT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGE3	PARP-type domain-containing protein	0.917	242-261	EPKAALKKGRGKKTVASAPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGE3	PARP-type domain-containing protein	0.889	265-283	DEPAPKAVTKRPGRSKKAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLQ0	Uncharacterized protein	0.883	323-342	KRAEPEKRKSWLGRRFSKKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM31	Uncharacterized protein	0.718	303-309	KPKPKKH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQG0	Uncharacterized protein	0.625	371-374	KRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY28	AAA_16 domain-containing protein	0.977	340-363	ERKRRKKGGGTARSGGRPSQTRKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1L5	Patatin-like phospholipase domain-containing protein	0.992	83-106	QRQIRRHGDNRKSKVGKRKPRRGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4M7	Uncharacterized protein	0.702	1850-1858	RSPKRHVKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKV3	Uncharacterized protein	0.777	30-42	RMRQRGRKISRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL44	WD_REPEATS_REGION domain-containing protein	0.638	13-16	KRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHW6	RING-type domain-containing protein	0.932	45-65	KYARKQDEKKEKREAKKIEKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLG6	Uncharacterized protein	0.943	264-275	EEKRGRKRRREP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLH0	Uncharacterized protein	0.933	1030-1041	ARKPRRPRTHRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLH0	Uncharacterized protein	0.762	389-406	RPRKRSLALREPPLHKPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRD6	Uncharacterized protein	0.93	112-125	KRRLRDGKGKGKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTV1	Kinesin motor domain-containing protein	0.975	719-753	SPRKRGIRVGGMARKPFSGGTPRKKMSPSKKRVVK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVE2	PHD domain-containing protein	0.783	432-450	GPGRPRKEQPLVLTRRKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVE2	PHD domain-containing protein	0.722	294-305	RKARNKPRQLPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXC3	Uncharacterized protein	0.805	385-394	GRRRGGPKRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZJ0	FHA domain-containing protein	0.94	535-587	KRRKTEALRQGGARSKRKTPTPEPEVDMKAEKPAKRGAKTKISDAAIKAKVKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q010	Uncharacterized protein	0.89	62-73	KPKKSKLRPRKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q010	Uncharacterized protein	0.672	256-263	KSAKAKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0S6	Uncharacterized protein	0.735	60-73	IGRRSQRRNTRPHK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1C9	Uncharacterized protein	0.987	310-348	KKENQGGKKNKKKDKGGGDVNKKAEKTGKEQENKVKSKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1L3	Nop domain-containing protein	0.956	413-427	KPSRKRGGRRVRKMK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2D6	Uncharacterized protein	0.753	841-849	PPKPRRKSH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2S3	DUF2293 domain-containing protein	0.613	27-28	RR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2Y8	Uncharacterized protein	0.897	14-40	IRGKRNAIPAEKWHDAKRRKPQLQRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD78	DUF155 domain-containing protein	0.75	73-86	TKRKAASKHANKNS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD83	TBPIP domain-containing protein	0.923	152-188	RLKKLKSGDVKPVSKAEKKKVQERWTKIKKSCEARKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLU4	Uncharacterized protein	0.868	800-822	KHLEKVEERLREEKESGKGSRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLU4	Uncharacterized protein	0.789	493-504	KTRRGGRGGRRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLU4	Uncharacterized protein	0.741	201-209	PPKGRKSRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSY5	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	0.755	123-135	RAPRKVRKVGEGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUM1	AdoMet-dependent rRNA methyltransferase SPB1	0.995	775-844	REKAGAIQKLMAKAAKGGKKRQPVKVVKAGGQNKGSGRPRGVKGKYKMVDARLKKDTRGLKRAAKRNGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUM1	AdoMet-dependent rRNA methyltransferase SPB1	0.994	721-765	EAAAAIKEKLRALNARPIKKVREAKARKTMRTARRLEKLKKKSEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUM1	AdoMet-dependent rRNA methyltransferase SPB1	0.914	383-397	KEKRKERRKENERKQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUM1	AdoMet-dependent rRNA methyltransferase SPB1	0.773	236-241	KKKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUM1	AdoMet-dependent rRNA methyltransferase SPB1	0.74	489-497	KAKARAKRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUM1	AdoMet-dependent rRNA methyltransferase SPB1	0.621	335-338	KKEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PUM1	AdoMet-dependent rRNA methyltransferase SPB1	0.604	341-341	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0M3	Uncharacterized protein	0.791	127-148	RRAARRRVRPQDVTKARRENAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q427	Uncharacterized protein	0.628	54-57	RRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q439	Uncharacterized protein	0.955	16-91	RDPRGSKEHRSSRHRDDTDGRHRHRHRHHDHRSHRHGNEDERELRHRHKRQRDRDDDSERTQRKRHRSESRRREKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4J6	Uncharacterized protein	0.625	427-431	KSGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJ14	Uncharacterized protein	0.655	71-74	KRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2Y9	Uncharacterized protein	0.654	96-103	KGRRHHIP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIR5	WD_REPEATS_REGION domain-containing protein	0.753	217-225	RKRKKLARR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE76	Histone acetyltransferase	0.854	481-493	RRKEKERQKGKRI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQW1	Cell division control protein 42 homolog	0.785	185-192	KKPKRKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXM7	Uncharacterized protein	0.807	140-148	RRRKKARTP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXM7	Uncharacterized protein	0.794	970-993	RKGGKPNKFNWRRGGEKVAGKVTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYH1	S5A_REDUCTASE domain-containing protein	0.727	280-296	KKERRYRKELGGKYQKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q240	Uncharacterized protein	0.744	27-36	RERREKRQKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q585	Uncharacterized protein	0.91	229-245	LKRRRKEELKRDNKKFK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q585	Uncharacterized protein	0.86	716-725	SKKRRKSDKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLZ5	Uncharacterized protein	0.987	37-52	KEAKKRGKKKKVEKSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YL68	RING-type domain-containing protein	0.667	430-437	RNRGRRAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMH2	Abhydrolase_3 domain-containing protein	0.978	78-92	IHRTRRRRRHRRRLP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN63	Uncharacterized protein	0.987	78-95	AKKPTPKKKATPKKRKIK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YPQ6	Uncharacterized protein	0.627	215-219	KPGRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBP2	Protein kinase domain-containing protein	0.661	326-331	KRRKLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFD2	HIT-type domain-containing protein	0.97	178-201	RKQRRADKRSRDGDAKAAKSKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHI2	Homeobox domain-containing protein	0.624	163-166	KRKM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIC4	Brix domain-containing protein	0.98	373-406	KKMDKKKEQERQIKEKRRAEQKANVEKKRAERKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIC4	Brix domain-containing protein	0.873	3-37	KRRVKKRTHVGSKPGLGAGSAKVGSHAPPKAGTRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIC4	Brix domain-containing protein	0.807	308-332	KVQKRKAGKDTSERRAAAGANVEKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIJ0	PHD-type domain-containing protein	0.998	155-183	GRGRPRGRPPGRPRGSRGRGGGRGGKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIK3	DNA replication licensing factor MCM2	0.64	13-17	GGRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP50	Uncharacterized protein	0.948	72-92	RPGMKRKRLKSVRWRRNFKAN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVW6	Uncharacterized protein	0.893	230-246	IAPLKKKRTPRPAPSPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYQ9	Uncharacterized protein	0.796	11-28	EKRGPGRPPKTATPAAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYQ9	Uncharacterized protein	0.625	506-514	PKAAAATKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2Z6	Phosphatidylserine decarboxylase proenzyme 2	0.993	273-292	KQKNRRRRKLKRLRHKTKLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2Z6	Phosphatidylserine decarboxylase proenzyme 2	0.841	837-851	KSREMEKKRARKLLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2Z6	Phosphatidylserine decarboxylase proenzyme 2	0.835	175-184	RRSGRRKAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q343	Uncharacterized protein	0.998	16-35	LKGAGGVDKKKKKKKKAKEG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q343	Uncharacterized protein	0.767	92-98	ERRKKRL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3S3	Uncharacterized protein	0.649	71-75	IRKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIG3	Uncharacterized protein	0.94	99-126	GKNSRKARLRKFFRRCRNRMGKKQQKSS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGW3	Uncharacterized protein	0.793	118-138	QKRKLERTASKRQKLEEKMKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI80	Uncharacterized protein	0.663	357-362	GKPAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL13	R3H-assoc domain-containing protein (Fragment)	0.938	103-131	KRREPIRRDSQKRREALLKGKEGSRRRQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL13	R3H-assoc domain-containing protein (Fragment)	0.72	207-215	RAKLKKSRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNS9	Methionine aminopeptidase 2	1	60-82	AAKKKKKRKPRKKKKAGTGASGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSF3	Plus3 domain-containing protein	0.932	67-80	VAQKVKSRGRRKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSF3	Plus3 domain-containing protein	0.817	510-540	ERKKEIRAREAMKEKQAQAAKLKAQSEAKSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSF3	Plus3 domain-containing protein	0.666	432-440	KRKDIAKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSZ7	E3 ubiquitin-protein ligase	0.919	371-398	KRLFSKDPKKQQQQRAKDEAKEKKRREK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVH2	Glycosyltransferase family 4 protein	0.715	508-515	KQGRRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVR9	Developmental regulatory protein wetA	0.707	547-559	KARREKEADDKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3H1	Ribosome biogenesis protein RLP24	0.742	41-56	KMKRNPRKLAWTKAFR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3H1	Ribosome biogenesis protein RLP24	0.626	179-183	KQKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XG88	Uncharacterized protein	0.995	139-194	RGKKREQAGSATRKHRLPAPGFSRKEWGEMEGSERHRAWKAEGEKKKKRKHAWRLG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XLU3	Uncharacterized protein	0.995	101-134	VAKAVAKKRKAKVDDEGAEGEKPKKKGRPARGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YI65	Uncharacterized protein	0.625	28-31	RSRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDP8	Serine/threonine-protein phosphatase	0.725	140-146	KRKMKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHK1	Uncharacterized protein	0.792	59-67	AKKRKREDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHY9	Uncharacterized protein	0.989	74-114	RRRLQGERIEKDRVRREERQKRERARRKQQEEQRREQARRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMV7	Uncharacterized protein	0.651	232-237	KHRQKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNL4	L-ornithine N(5)-monooxygenase	0.929	157-168	HQMKKKKKRSSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPE2	Uncharacterized protein	0.835	756-770	EKKKGRFSIGFGKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPE2	Uncharacterized protein	0.64	6-10	RKGKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR41	Uncharacterized protein	0.764	35-47	DKAKSSKKANSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVF3	Uncharacterized protein	0.887	654-676	ERRGKTPEPEAPSRSPKKSPRRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVF3	Uncharacterized protein	0.79	568-580	KANASKPPKPKPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVF3	Uncharacterized protein	0.75	243-251	EPGRKKMRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVF3	Uncharacterized protein	0.666	715-719	KRKHR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVF3	Uncharacterized protein	0.638	225-232	KRPVDKRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXH0	Zn(2)-C6 fungal-type domain-containing protein	0.794	67-77	PKKKGPKGLRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYK0	Uncharacterized protein	0.987	696-743	RQKARNKAKKGLKIGSKSTGKKIELPLPSPPPPPRPKPAPELQIKRQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1K2	Uncharacterized protein	0.955	520-546	KVKQGRPLQRRPPPRDGPLRPPKRRLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Z1	Uncharacterized protein	0.605	132-132	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2Y7	SET domain-containing protein	0.815	101-130	RAPGSPKRAFRPRLPAPSLSGNESRPAKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q436	Uncharacterized protein	0.997	438-461	RKREKKKKSEDERKERKEKRRRRA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q436	Uncharacterized protein	0.902	609-634	KRPEPSKRKSTSPNHRGKPRVVPHRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q436	Uncharacterized protein	0.735	54-68	PPPPPRPRAPPQPAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q436	Uncharacterized protein	0.642	361-364	RKKD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y6	Zn(2)-C6 fungal-type domain-containing protein	0.688	166-171	RPKKRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5B2	Uncharacterized protein	0.777	194-204	HTAVKKRKHAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XL25	Uncharacterized protein	0.877	211-222	APPTRKKRKIPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YM85	Uncharacterized protein	0.854	124-142	RQSASAKPSTHRAKRRQRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMZ4	Telo_bind domain-containing protein	0.702	1530-1547	KNSLSPKTKTTARRSPRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHB6	Cleavage and polyadenylation specificity factor subunit 2	0.734	635-647	GRGRKDRKQEQNK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ36	Uncharacterized protein	0.848	377-389	RPRKERRKDTRTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJR9	Stress response protein NST1	0.998	493-650	EAKKQRDAQKKKDKKKQQAQAKAEEKAKRDAEKAEEERQVREAEEKKQEEQRRRKEEQRKKREEEKKKQEEEKTRKEAERSRRQQEEQQRREEAEYKAREQKAAEKARKEEARKKEREDREAREKETRERKAQEEKDRRDREAKAKSEKEAKEREKSA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJR9	Stress response protein NST1	0.94	23-36	GNRKKQKRRAKQAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJR9	Stress response protein NST1	0.903	103-114	MKKTKKKRAPAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PM25	Zn(2)-C6 fungal-type domain-containing protein	0.809	169-186	SRRRGPPNRHAEAIKRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNQ0	37S ribosomal protein S25, mitochondrial	0.759	54-63	PGAKPPRKRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPE8	Uncharacterized protein	0.61	180-181	KK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQB1	Uncharacterized protein	0.976	1371-1403	KAQKPSQKKTSAKKPAPPTKRLPSRGRSARTAN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQB1	Uncharacterized protein	0.974	1247-1318	PRKKRKATDSASHRPAKKAKASDGDTTKQETARKAPKVAKVSKVAKSSKTARKRPSDEIPASERRKSARVSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU83	ANK_REP_REGION domain-containing protein	0.659	251-254	KKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1F6	Uncharacterized protein	0.928	125-153	GDGRRPRRGGGGGGGGGSDAGRPRREDRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1F6	Uncharacterized protein	0.813	286-301	RRDRDRRGGRDKPPRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1F6	Uncharacterized protein	0.729	263-271	RRRRDRSRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1F6	Uncharacterized protein	0.727	210-220	ARRRSERRPDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1F6	Uncharacterized protein	0.692	236-249	RRRRSVEDHRRPPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1F6	Uncharacterized protein	0.673	169-172	RRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1F6	Uncharacterized protein	0.646	10-14	RPRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1K8	PHD-type domain-containing protein	0.997	195-229	PPPKPKPKAKPKPMSKSKVSKAAKSRGTRASKRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1K8	PHD-type domain-containing protein	0.65	343-354	KRSSRLAGKAEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2R4	Uncharacterized protein	0.76	748-756	RRRRGVKRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y1U2	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.693	83-89	GRKKQKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2V7	Uncharacterized protein	0.65	21-24	KKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIC9	Uncharacterized protein	0.868	223-235	LRKEKERKEKAKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGZ1	Uncharacterized protein	0.767	566-571	GKGKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ82	Zn(2)-C6 fungal-type domain-containing protein	0.978	103-127	APRKRGRPRKHPIVEQKKASHARSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ82	Zn(2)-C6 fungal-type domain-containing protein	0.656	135-138	KRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJU3	Uncharacterized protein	0.842	1302-1312	AKKESKRKRPA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJU3	Uncharacterized protein	0.836	53-61	GKKPRRSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJU3	Uncharacterized protein	0.77	16-22	RKPKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMG3	DNA_mis_repair domain-containing protein	0.82	819-831	RRKSSRRLGRAKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMR5	ABC transporter-like protein	0.955	1504-1515	PKKKGSKKEKKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR31	Response regulatory domain-containing protein	0.891	835-864	EKQKKKMEKMAMLQEKQRLRKEEEERKKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR31	Response regulatory domain-containing protein	0.619	597-600	KKTR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR31	Response regulatory domain-containing protein	0.6	496-496	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRW2	Uncharacterized protein	0.973	618-638	AMKKKKPAVRPLASKKTKRRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXJ0	Uncharacterized protein	0.939	866-911	PRHKAKATHKTSKTDRNGLSRKAFKQHAERRRSHAEPPEGKPRIMR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXJ0	Uncharacterized protein	0.694	284-292	RRRVAGRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYT3	SCD domain-containing protein	0.995	25-74	REKAKRVRKPKSSAPKKPSQKRPKANGTTTLPLRTAAKMPARKRAPKKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYT3	SCD domain-containing protein	0.885	1050-1063	KKQTKAKPKPKAKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYT3	SCD domain-containing protein	0.846	258-273	ERKKGKGVNKERVKNI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3U1	Dolichyl-diphosphooligosaccharide--protein glycotransferase	0.986	743-758	KGNKRKKAGKRRGPRV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLN3	Cut12 domain-containing protein	0.681	379-390	PDKLRSRPRDIK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBH7	PWI domain-containing protein	0.998	139-261	KEERERERETARIRDRERGSRGRGGRGARRGRDRDSRSPPPRRRDAPRVDSYVPRGGRGRGRDEPQRRRRSPSYGGRSPSRSRSPPRRRRRRNSSSDISDKADNAGRRTRSPSPRRQRRSPSY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBH7	PWI domain-containing protein	0.996	264-290	DDRSPPPRRRRRSPSRSRSPPRKRQSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCL5	40S ribosomal protein S26	0.897	85-109	RVRSREGRRNRAPPPRVRYNKDGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCL5	40S ribosomal protein S26	0.837	3-18	KKRASNGRNKKGRGHV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCT0	Nucleolar protein 58	0.987	516-552	EKKLKKEKKEKRKSGTLAAGEVPDEQIKKKKKKSKSE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCT0	Nucleolar protein 58	0.899	491-503	AARKAAKKAKKLQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEF7	Uncharacterized protein	0.718	11-19	RRRSKREFK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHL8	Uncharacterized protein	0.985	81-107	MRRRKGRPGAERGTGRGRGGFRGRRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHL8	Uncharacterized protein	0.961	44-60	PRRKGRGGRARPRQSKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHR0	TFCD_C domain-containing protein	0.701	42-50	KRVHKRVKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMK9	GRIP domain-containing protein	0.989	13-26	SASKKKKKSKKKTS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVB8	Uncharacterized protein	0.918	18-43	ARIAAAKKRERSISPPPSRSPRKAPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVK4	WD_REPEATS_REGION domain-containing protein	0.84	371-389	RKQKKKDMRQGIRARDRGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVK4	WD_REPEATS_REGION domain-containing protein	0.604	409-410	RK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXR6	WD_REPEATS_REGION domain-containing protein	0.677	64-68	KKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXV4	Uncharacterized protein	0.851	656-666	KEKASARKRKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0D2	Glutamate decarboxylase	0.656	163-170	KRWANKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3J6	Uncharacterized protein	0.959	63-89	APKVKKATPAEPPTPKAKFRKRQKNKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3J6	Uncharacterized protein	0.748	495-508	KRKNQWLRRPKSKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3J6	Uncharacterized protein	0.608	651-652	RR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y7	Uncharacterized protein	0.972	329-355	RHKREKLERKKKLEALSKSAAAAKKKY
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y7	Uncharacterized protein	0.858	147-201	ERAKAAQEAAKAAGSSTIKHKPVEKLTKRDRMRQEEAAKQQKAAGGKVGKRAVAV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4Y7	Uncharacterized protein	0.664	137-143	KPKKGFA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3L7	GYF domain-containing protein (Fragment)	0.877	295-311	RGKPQEKKVPKWKQKKQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3L7	GYF domain-containing protein (Fragment)	0.77	241-260	KDMKKAKEAQEKREDERRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y3L7	GYF domain-containing protein (Fragment)	0.718	78-85	KAKRKDKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIJ4	Peptidase A1 domain-containing protein	0.834	440-450	NRKGRRSRKSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE32	KRR1 small subunit processome component	0.998	284-341	RATKEKREDAMKEKMEERKKKREEAFKAPKEDADTTKKKKKRKSEGNDGEKKNSKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE32	KRR1 small subunit processome component	0.714	233-243	KKRNLSKRRVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFZ2	Uncharacterized protein	0.893	143-161	KTRKRKGSLRKTALLGGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMA9	DNA damage-binding protein CMR1	0.947	42-73	PKSRPKPSSTAGQKRKKLAEPKVKVEEGPRRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNZ2	Uncharacterized protein	0.65	18-25	KRSKQARA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ24	Uncharacterized protein	0.887	218-240	HSGTRRGGGVEKRGTPRSKRPSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2W7	UBA domain-containing protein	0.887	500-518	IPKRSRKRDWKDPRQTRKI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2Y2	40S ribosomal protein S30	0.975	14-37	VKSQTPKVEPQEKKKTPKGRAKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC95	Uncharacterized protein	0.734	281-298	RSRSRDRSHDQQRQRKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFZ6	Uncharacterized protein	0.794	31-42	KPRKRIRRSPED
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFZ6	Uncharacterized protein	0.759	530-553	KKAKEKEEAAVAAGRGGRGGRGQQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFZ6	Uncharacterized protein	0.602	44-44	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNQ7	Uncharacterized protein	0.985	177-204	SRARPEERERHQRTRRKRHRRDDDRRGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRX5	Uncharacterized protein	0.981	330-362	AKKRKAKDEDGAYRVKGGKSGGGNAKGKRKRAT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRX5	Uncharacterized protein	0.924	21-40	SIGGPRPKYKSWRKKYRKMR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRX5	Uncharacterized protein	0.718	279-287	ARGAKGKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTA2	Transcription initiation factor TFIID subunit 8	0.606	253-256	REAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWD8	Uncharacterized protein	0.811	92-105	KEPPRDRKKEKNIK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWD9	Uncharacterized protein	0.927	640-651	QKPKKKRKSTGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q190	Uncharacterized protein	0.664	699-703	RGKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2E9	Bromo domain-containing protein	0.948	590-603	KKRSKKRRSHARDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2E9	Bromo domain-containing protein	0.69	879-883	GKRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q311	RRN9 domain-containing protein	0.867	281-297	RSRQGRRKERKTSGSRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q311	RRN9 domain-containing protein	0.795	550-565	RAKKLRSRSASRARAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q311	RRN9 domain-containing protein	0.698	317-322	AKKRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5E2	Uncharacterized protein	0.958	99-151	AAAKKEQAAAAKAAAKAAAKERLVKQKAVQQKRKENAKLEATKSKVKELKKAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5E2	Uncharacterized protein	0.957	45-91	RPKRVVGEPSRPVKRAVKKKAAEPADGSSAAEKQVAAKKRNAAKKTH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WMM6	WAPL domain-containing protein	0.68	68-80	KSNAPKPVKQRAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN84	Structure-specific endonuclease subunit SLX1	0.882	308-322	EFKALFKPKRGKKNA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YN84	Structure-specific endonuclease subunit SLX1	0.744	109-119	KTGRVRKRSAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK2	CMP/dCMP-type deaminase domain-containing protein	0.962	227-238	SGKEKKKGKKKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK2	CMP/dCMP-type deaminase domain-containing protein	0.77	309-319	KRKKDYKRSGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFK2	CMP/dCMP-type deaminase domain-containing protein	0.73	372-380	KPASKPKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH37	Uncharacterized protein	0.911	183-200	RKSKPKSKAKTSTKSKRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH37	Uncharacterized protein	0.777	326-332	KRKRKVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHK4	Ubiquitin-like domain-containing protein	0.994	74-100	RGGMAKKRKKKVYTTPKKIKHKRKKTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIN6	Zn(2)-C6 fungal-type domain-containing protein	0.746	28-34	RKKRKAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLD6	TRP_N domain-containing protein	0.688	621-625	RKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS64	Uncharacterized protein	0.922	180-192	RRLRKRKKNQRSR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYM2	Phospholipid-transporting ATPase	0.806	38-49	RKTGKKGAQKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYM2	Phospholipid-transporting ATPase	0.712	240-252	KSKKEEAAAKKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q036	Uncharacterized protein	0.945	521-533	GRGERAKKKRRLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4J3	PUM-HD domain-containing protein	0.983	627-664	IKKEVKAALQKAEKQLKKAGEGEKGVKQEKGKKAKKLQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4J3	PUM-HD domain-containing protein	0.879	91-125	QRRVAKERKAAKPHADIIQRAKQLWERLRRKSHVP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4J3	PUM-HD domain-containing protein	0.754	8-24	KRKEAPSEARKSDKKQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XM41	SUN domain-containing protein	0.986	917-931	ERKRRKRPKKPQNWP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y076	Uncharacterized protein	0.661	165-173	GGGGGKPRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YPL4	Uncharacterized protein	0.733	71-76	RKRKRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCU6	Uncharacterized protein	0.687	32-40	KRTEGRRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCU8	Valyl-tRNA synthetase	0.934	64-119	RELAKERAKADKLAKLAAKQEKQKAMSAASQPKQKEKKKQEILPPYKEETKKGDKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD59	Uncharacterized protein	0.955	47-74	SHRIGPRKAKANKKSRVEDPAQPARRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEK1	Uncharacterized protein	0.994	112-125	KKEAKRRRPKRKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJ42	Uncharacterized protein	0.616	62-64	RRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKJ6	Uncharacterized protein	0.912	263-307	RRKPPGPPPAGRGAQNAAPPTGPKLGGSRSQREKMKAIEEAKGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKJ6	Uncharacterized protein	0.654	17-21	KRRKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR72	Serine/threonine-protein kinase RIO1 (Fragment)	0.999	504-554	EKAPRGKRFEDKGIKKAHKQAVKEEKRERRKEKMPKHLKKKLISSSSRGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW34	Uncharacterized protein	0.638	274-277	KKSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PXA6	Uncharacterized protein	0.98	280-300	DRKDRKKLGLPRRRGGAKKNL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZK0	Uncharacterized protein	0.816	13-19	PRKRRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0R7	BZIP domain-containing protein	0.957	140-177	KDGEKGAKKPGRKPLTSEPTTKRKAQNRAAQRAFRERK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1P9	1-phosphatidylinositol-3-phosphate 5-kinase	0.851	575-593	RRPRSSSHRRRHSRHQPGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3D7	C2H2-type domain-containing protein	0.962	43-63	GRRRSPDRRRGADRERRRSRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3D7	C2H2-type domain-containing protein	0.876	143-165	KEEKERTKSGRPPRLRGERESRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q552	Ribosomal_L18_c domain-containing protein	0.637	271-277	KAESKKF
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNN6	Uncharacterized protein	0.685	270-283	RNRRLSLARFGRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YJ08	Uncharacterized protein	0.799	64-73	SPKRRRRLVG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLY8	Uncharacterized protein	0.666	514-522	KKWFTKKRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDQ3	Uncharacterized protein	0.96	193-209	RKKKRRGARGGTSIAKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDQ3	Uncharacterized protein	0.778	287-294	KRKVKRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDQ3	Uncharacterized protein	0.737	222-230	KRARGRPPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHI0	C2H2-type domain-containing protein	0.862	465-496	IKKKGRPVGWRKSLHSREAQGLDPKKSLGHGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHI0	C2H2-type domain-containing protein	0.769	401-411	ARPRGRPPKNR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHI0	C2H2-type domain-containing protein	0.739	352-367	VQRHKEKYGSKRPTKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIZ7	Carbohydrate-binding module family 14 protein	0.996	133-157	NKPVAKPVKRPVKKPVKKKGGKKQG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKF7	Uncharacterized protein	0.945	465-479	PKARAPKKLRKGKTP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKQ3	BZIP domain-containing protein	0.967	59-113	KPAKKRKSWGQELPEPKTALPPRKRAKTDDEKEQRRIERIKRNRAAAHNSRERKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSL9	Uncharacterized protein	0.944	471-508	GPKSAAKAAQPVKKAAPAGKPLGKTTGPPPSKPPPAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSL9	Uncharacterized protein	0.814	411-428	KRAVPKKKAPVSRNAPAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSL9	Uncharacterized protein	0.808	526-533	IKKKPKKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWN5	Uncharacterized protein	0.878	20-34	RVGGKFKLRGRKHRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY95	Uncharacterized protein	0.888	111-121	KRRRRRNGHRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYW0	BZIP domain-containing protein	0.918	104-124	KRRRNAGASARFRQRRKEKEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZF7	Phosphatidylinositol 4-kinase	0.89	57-74	SGSHSPARPGRRRRANSG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZF7	Phosphatidylinositol 4-kinase	0.85	91-103	IKDRFKRRRVKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZF7	Phosphatidylinositol 4-kinase	0.824	316-322	KRRRRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q582	MAGE domain-containing protein	0.819	304-314	RSRKASKRKAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLW6	PPIase cyclophilin-type domain-containing protein (Fragment)	0.953	185-204	EAPRSKEEKTGVKKRKKPMG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLW6	PPIase cyclophilin-type domain-containing protein (Fragment)	0.824	345-353	RGRKRGKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFN6	Uncharacterized protein	0.827	413-427	RRDSVRRRRGRQGGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PID7	UDENN domain-containing protein	0.927	810-820	KRESKKKRGKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP94	Uncharacterized protein (Fragment)	0.837	489-506	KKRYNKGASGKKEGKLAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP94	Uncharacterized protein (Fragment)	0.814	852-881	PKKKSKTDKAAQQAPIAAPKPEKPPPPPKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP94	Uncharacterized protein (Fragment)	0.776	695-701	GGRKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP94	Uncharacterized protein (Fragment)	0.647	981-988	KKKTDRER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTY9	Uncharacterized protein	0.831	114-122	DPKRKPKRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PU77	Uncharacterized protein	0.602	207-207	K
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PV25	Uncharacterized protein	0.705	735-746	KRKAAKETAKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWU6	Uncharacterized protein	0.861	23-36	KKRAKAEKQARRAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY81	Uncharacterized protein	0.65	213-217	ERRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY81	Uncharacterized protein	0.62	67-69	RPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PYP2	Uncharacterized protein	0.879	590-600	RARPKKRKTPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0H1	Ribosomal RNA-processing protein 36	0.999	238-322	KLKAKGAQQREQEIIRKHRREERNKVQEGKTPYYLKKKDVKERAIVEKFKDMKSKDREKLIEKRRKKEGQKEKKRMPQARRIVGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0P0	ERF-3	0.683	648-653	RKSKKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Q7	Uncharacterized protein	0.684	100-112	RHPPRANRSQKRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKP2	Uncharacterized protein	0.938	126-137	RNQRKRDRKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2C7	SRP40_C domain-containing protein (Fragment)	0.802	33-41	KEKNKKKRG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2M4	Aa_trans domain-containing protein	0.969	368-378	GKRRRKRKHRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PBG6	Vps8 domain-containing protein	0.653	1468-1475	RRLSRGKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE15	tRNA-binding domain-containing protein	0.965	228-246	EKREKSKKEKQPKPPKNAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE15	tRNA-binding domain-containing protein	0.9	161-173	KAEKERKKKEKAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE15	tRNA-binding domain-containing protein	0.685	204-209	KPKKEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGW4	Uncharacterized protein	0.955	176-202	GKKAKRKARERQLEESRRMAVLQKRRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PMM5	Uncharacterized protein	0.977	497-523	LKKKKEVKPEPADKRFRPPSPKRKAQP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVH5	Uncharacterized protein (Fragment)	0.776	41-51	RRPGKLKKVKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PVL0	Uncharacterized protein	0.683	64-69	RPRRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWQ9	J domain-containing protein	0.656	68-72	QKRKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0Y7	Exonuclease domain-containing protein	0.906	68-77	TKKRKKLPKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q537	PHD-type domain-containing protein	0.987	238-279	REKKDKRGTTPRPRSHTPRPPRSEEERERDRKNPKPRGPRAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q537	PHD-type domain-containing protein	0.974	605-616	SKRKAAPKKKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q537	PHD-type domain-containing protein	0.919	466-498	KKKRKREGSPIAGPSTETGGENKRPALKKIKIA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIE6	RRM domain-containing protein	0.993	234-286	GGNTGARKEKIKVKNQRLQEQRERRAEAERKEKEKEEKKIAGGGGKDRKPKDN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIE6	RRM domain-containing protein	0.985	10-30	RKEKKALRDAERAKSKGKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIE6	RRM domain-containing protein	0.923	211-225	GRRGQRKKKETARRI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WIE6	RRM domain-containing protein	0.807	88-93	KKRKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKI2	Uncharacterized protein	0.978	825-852	RRAENKRIKDEKKRQKEEEKARKAEEKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XHH3	Uncharacterized protein	0.647	4-7	KKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y4B1	THO complex subunit 2	0.893	2327-2365	ERRDASGRGARDDGGGQDRKRRHEDAGGFDPTKRRRSGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCV4	Eukaryotic translation initiation factor 2A	0.95	537-549	LKNKKKREAKKAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PD25	SprT-like domain-containing protein	0.666	253-266	PPASPSKLKSPSKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQZ6	Uncharacterized protein (Fragment)	0.982	55-108	GKPKRKSPPVLANARQKSPSPQDPHRFRPPARVPLPPRPKPVFKPSKPLRRRPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR56	Protein kinase domain-containing protein	0.921	99-121	RLPKARRRWRSRLTGNSRRGGHK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR56	Protein kinase domain-containing protein	0.828	718-744	RKRQKKALHDHHPPKTKSPGKTPTKTK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR56	Protein kinase domain-containing protein	0.694	200-214	KKPGFFKRLGHSRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRE1	YL1_C domain-containing protein	0.992	99-154	ALKRAERVEAKKKRKMEEAKMRVPAFARAKKRVKLADDVKAEDGSAPKKPKKKSER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1B7	Uncharacterized protein	0.949	294-334	GRGPPPAPPPSRRKAGGAPAVQRPPSPSPSPPREPSPPRPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q505	Uncharacterized protein	0.8	650-658	RRKRAPRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5A8	HECT domain-containing protein	0.681	49-56	PVRRPKPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDN1	Uncharacterized protein	0.605	251-252	RR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDW2	Uncharacterized protein	0.661	24-29	RRRPRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEE4	Uncharacterized protein	0.856	186-198	KKKQEAKKLPRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PPG6	Uncharacterized protein	0.969	139-162	RGGFRGRGRGRGRGRGGRYDERGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ78	Uncharacterized protein	0.853	729-743	PGKRKWLERNKRSRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ78	Uncharacterized protein	0.765	395-413	RSRRVRRMAKIHNRNAAKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQE1	Uncharacterized protein	0.668	37-42	RRRNKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSR2	Uncharacterized protein	0.945	529-547	VAKKGKGRPRGSKHSTARS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSR2	Uncharacterized protein	0.874	466-479	AKAKTKGNRGRPKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSR2	Uncharacterized protein	0.771	220-231	KMKKSKVKAKAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSR2	Uncharacterized protein	0.756	295-314	GRKKTTRTKAAASDAKSRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY43	Cyclin N-terminal domain-containing protein	0.933	407-466	RARSRSRDRDRRRDAPIDRPERDRAGGRPPRDYDDRRGTRDSPRGHGIDRAIERDRDRTR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY43	Cyclin N-terminal domain-containing protein	0.7	494-514	RRDRDRYRDRRDYEDRRRPRD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY43	Cyclin N-terminal domain-containing protein	0.613	487-490	RDRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY43	Cyclin N-terminal domain-containing protein	0.608	472-474	RDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY43	Cyclin N-terminal domain-containing protein	0.604	476-476	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PY43	Cyclin N-terminal domain-containing protein	0.603	470-470	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0N4	F-box domain-containing protein	0.824	705-712	RRRRRRAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2J6	MutS protein homolog 3	0.846	23-32	PSKPKKRSKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJM5	AP-3 complex subunit delta	0.995	976-986	VKKKKKKKRKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJM5	AP-3 complex subunit delta	0.91	947-953	KRKKKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XJM5	AP-3 complex subunit delta	0.857	1012-1019	KVKKKKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNQ0	Pre-mRNA-processing protein 45	0.865	224-240	PKHKIKKVPRGPPSPPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNQ0	Pre-mRNA-processing protein 45	0.824	342-365	QKARADREAAKAPRRDSDRGRSRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNQ0	Pre-mRNA-processing protein 45	0.686	395-408	DRREREQKRADQRN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YNQ0	Pre-mRNA-processing protein 45	0.609	411-412	RR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEW0	Uncharacterized protein	0.926	583-613	KRRRKHHSSRRSQTGSEKTVKPARREKDGGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEW0	Uncharacterized protein	0.677	629-640	RGKEREREREGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PL46	Uncharacterized protein	0.689	489-499	QAGRNRGWRKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ95	JmjC domain-containing protein	0.818	937-951	EKERKALEKAKKEGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ95	JmjC domain-containing protein	0.814	895-903	KGKRAKKPR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ95	JmjC domain-containing protein	0.77	1087-1095	ASKKEKRKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ95	JmjC domain-containing protein	0.73	873-877	KKRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQ95	JmjC domain-containing protein	0.632	960-963	KGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTR2	Ras-GAP domain-containing protein	0.87	1459-1485	ARVKEKDKEKKKTSTVHHLVPKLKKRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZN6	TFIIS N-terminal domain-containing protein	0.999	138-169	KRKRTAEEEEEHQRKKKKKEKKREKPKRRRAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZN6	TFIIS N-terminal domain-containing protein	0.888	183-206	GKRSRKNKLDADGKPIKRAGKAPE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZN6	TFIIS N-terminal domain-containing protein	0.755	218-240	ERRRRALDRKMDEALKSHRVSRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q162	Poly [ADP-ribose] polymerase (Fragment)	0.633	85-91	KAASKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XKW5	Uncharacterized protein	0.936	253-278	QSKKLSKEEVKAFNQARKEKKMKKRM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XML2	Cysteinyl-tRNA synthetase	0.887	769-785	AKSKSKKLKKDWERQKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y489	Uncharacterized protein	0.989	216-247	NDRFAAWRKSALRKARNVERRAMGRGGKKVKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YIF9	Uncharacterized protein	0.965	235-250	RRIKRKREERRRGKEE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PF05	Uncharacterized protein	0.663	199-202	RKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIP1	DNA repair protein REV1	0.969	932-957	PRKLRTLPPMRQAPPKRGRGRPRGSK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIP1	DNA repair protein REV1	0.663	1044-1048	ARRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS73	Uncharacterized protein	0.997	481-500	PKEKSREKKKKKSKGKSKEV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS73	Uncharacterized protein	0.991	1211-1268	LRRIRHEARRAARKAAAEEATRLAKEEAEAIARKEAERRRRHREVREIDRPRPRRESK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS73	Uncharacterized protein	0.986	307-325	PKPTSRKKKMGKGAKNKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS73	Uncharacterized protein	0.961	1125-1160	RHKADHWKRDHRKRGSSDSKKSSDKSRSSKPARLPD
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS73	Uncharacterized protein	0.957	1344-1389	HHRRHRHYRTESDRPEPRRRDSERPESGRSDEKRHRRPAAPEQKPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS73	Uncharacterized protein	0.922	435-447	SKSKKKKGPSKQP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PS73	Uncharacterized protein	0.645	1185-1191	KRREERK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PX85	Uncharacterized protein	0.627	184-186	KRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE64	Uncharacterized protein	0.933	49-61	PKRRPKKRINRGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PE64	Uncharacterized protein	0.797	14-30	KKESSRKAKSGQPNRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEA6	Histone H1	0.995	92-231	KLAAPKSADSKVAAKTTTKKAPAEKKTAAKKTTTAKKPAAKKATATKTAATKKAPAKKTAAKATTKKTTPKAKANTGKARKTPAAAPAVEEKAPVVLGKTKSGRVTKSTAPQAEKKAAKPRKSAATKKATPKKTKTPTKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGF1	Uncharacterized protein	0.808	1290-1307	KLEGMRKERKASSGKLAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHX9	Uncharacterized protein	0.952	4-47	TKPKPISKRSSKRKPQAEKTDYSKEKNDKLIAEFKKRGLPKPGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHX9	Uncharacterized protein	0.865	77-98	LKDARELSGNGKRGRRVKTAGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJA5	Zn(2)-C6 fungal-type domain-containing protein	0.855	56-67	ARRKTKSRSRKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNC4	DNA topoisomerase I	0.997	209-239	KPLAKKKAPAKKPALKKEEATPKKGKGKMKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNC4	DNA topoisomerase I	0.98	137-171	KKLQKEKAAIEKKAEKEAKEIRADENKAKRKAKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNC4	DNA topoisomerase I	0.908	182-201	AKKKAPAKKQSNGTAKKIKQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNC4	DNA topoisomerase I	0.755	422-436	RGRGEHPKTGKWKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNC4	DNA topoisomerase I	0.692	380-387	PAAEKKKL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PR30	Non-structural maintenance of chromosomes element 4	0.654	42-48	RRDKGKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q488	Uncharacterized protein	0.954	356-378	AKEERRRRRDRERAEEAERKRLQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4A7	Uncharacterized protein	0.985	112-130	ESPAKKAKTAPKKRGGKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4A7	Uncharacterized protein	0.873	92-103	TKGTPRKRGKKV
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4R7	Uncharacterized protein	0.757	161-167	RKARRRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WKR6	Uncharacterized protein	0.907	236-251	AKRKKKERASFASSRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WNP1	Ribos_L4_asso_C domain-containing protein	0.967	186-207	KNSRKLRAGKGKLRNRRHQQRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIA9	Uncharacterized protein	0.9	502-515	KKGPGRGNWRRKKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XIA9	Uncharacterized protein	0.849	620-638	KRIRRAHARARDKRESEGA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEL7	NUC153 domain-containing protein	0.985	581-597	AQKEAKRAKHNKKKGKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEL7	NUC153 domain-containing protein	0.976	472-489	IRKEKERKQKRKERMKAE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEL7	NUC153 domain-containing protein	0.888	400-412	DKKAKKKEAQRAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEL7	NUC153 domain-containing protein	0.73	42-59	KKAKVDRYGRKIKPETGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEL7	NUC153 domain-containing protein	0.657	665-669	KGKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PEL7	NUC153 domain-containing protein	0.607	534-535	KK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNS0	Uncharacterized protein	0.733	1201-1210	RLNKRERRRH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSG5	Uncharacterized protein	0.995	108-147	EKKFQKHKEERERKYDEKLSKNRAKREKVKLRAQKKKAGG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PTK2	Protein kinase domain-containing protein	0.619	548-550	AKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PW33	Uncharacterized protein	0.645	437-441	KEKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWX6	Uncharacterized protein	0.898	890-896	GKAKKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZL8	Uncharacterized protein	0.996	463-492	IKRPKSRGKNGSPRRKEREERVRARKMRDR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZL8	Uncharacterized protein	0.885	117-149	PPEPHRRPSKIEHPRRSISAPKHALKMLKLGGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZL8	Uncharacterized protein	0.606	409-410	RR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Y8	Uncharacterized protein	0.669	103-106	KRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q5B1	Protein kinase domain-containing protein (Fragment)	0.722	420-426	KGRRRRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGZ5	CFEM domain-containing protein	0.999	232-287	HKKPEHKKPEHKKPEHKKPHHKKPHHKKPHHKKPHHKKPHHKKPHHKTHKTHRPHK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XGZ5	CFEM domain-containing protein	0.989	143-199	PSRYRDHGKEKKGGKGWWEWVKGKGKVWHQGKKQQKEPHHKKPTHKDPHNKKPHHNK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2XZI2	Uncharacterized protein	0.62	148-151	KTRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJE5	Uncharacterized protein	0.627	186-188	KRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJS2	Uncharacterized protein	0.695	732-736	KKKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLS8	DNA replication regulator SLD2	0.993	402-460	KSKIKKKQASKKTKAATDSTASKAKPRKVNPEAHANYRALKIKNKNSKGKGGGRRFGRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PLS8	DNA replication regulator SLD2	0.988	331-359	RARKPWKKKGLKRQTRRTNMKPVLHKAKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PNN2	Stn1 domain-containing protein	0.9	178-205	QERARLHRKKQAKYDEKYRQKRAAREEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSM6	Uncharacterized protein	0.843	118-126	RRRERRRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZR1	Uncharacterized protein	0.999	977-1056	AKDKGKMALNGEPVVKAEKKKGKLSNKEKKRLQDKDDRREGAQWTKSKKATVVGKARDEKGREKQAKHKSKPKPKPKGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Z2	BUD22 domain-containing protein	0.913	158-170	SKAPAKKRRARAK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Z2	BUD22 domain-containing protein	0.886	43-59	KAGKGFERQKLGRRKKN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Z2	BUD22 domain-containing protein	0.796	421-430	AAKRAKEKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1Z2	BUD22 domain-containing protein	0.707	326-335	KKNRRGQRAR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3T4	HECT-type E3 ubiquitin transferase	0.739	3243-3252	TKKGKGRESK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3T4	HECT-type E3 ubiquitin transferase	0.684	2832-2844	EAERAKREAQEKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Y6	Pescadillo homolog	0.927	617-657	KRKSTKAAAQTKRTQAEKAAAEEVERRKMMMPRRKRKTYEK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q3Y6	Pescadillo homolog	0.911	663-682	ARKDEESEKLRAKRRRIEKG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y0A3	Uncharacterized protein (Fragment)	0.71	308-317	KKRGKDPKLR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLP3	Uncharacterized protein	0.916	158-174	RPPRRVRKKPAGQLKQK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YMB2	Uncharacterized protein	0.921	100-111	PKRTGRKRKRGS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCW8	RNA cytidine acetyltransferase	0.986	69-85	HRKKREKKIKKEVKRGI
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCW8	RNA cytidine acetyltransferase	0.98	1016-1062	KKKGEKAGGATFGVKTGKKRKAGEGELAKVQKEAERLGEKSGKKHKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PDL4	Uncharacterized protein	0.683	461-467	KKRRPDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFE7	DNA polymerase II subunit A	0.817	1277-1291	KKKWKIQRAARTRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGJ0	DNA-directed RNA polymerase	0.978	1090-1105	AAEPAKKKRRTKKERE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGJ0	DNA-directed RNA polymerase	0.844	553-561	ASKKKKGRS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PH81	Uncharacterized protein	0.677	144-157	GKRAVREPPTKIRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIR9	PHD-type domain-containing protein	0.86	334-365	PRISLKVKSPHKDPNRHRSHHGKVSVSPRKRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIR9	PHD-type domain-containing protein	0.818	158-172	KKKERATRTRAVKRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PIR9	PHD-type domain-containing protein	0.792	537-550	KPKPKQRAKTKQSP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PJS0	Leucine carboxyl methyltransferase 1	0.772	30-41	RGPRLRGRRGGP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PKG9	Uncharacterized protein	0.965	68-89	KRVTRKRKAGDDKAATPKKKKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRH5	BZIP domain-containing protein	0.919	361-390	RNGRGKKGATGKAANGKRKNDDPSVKGANK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZM8	O-acyltransferase	0.601	84-85	RR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZQ3	Uncharacterized protein (Fragment)	0.915	113-137	RRKSYAHKKRLSRRQSVRSVRSKKT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q477	Uncharacterized protein	0.988	608-635	EKKRAAKKAKKEAEKAEADRKAAATKKS
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4B8	SLD3 domain-containing protein	0.976	321-336	KPQQRKKRKWKAKRDK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q4B8	SLD3 domain-containing protein	0.97	515-545	PTPKRRTASKSRRPGEPAVRQAPEKKPRRPL
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2D3	Uncharacterized protein	0.891	70-86	QRGRGRGRGGARGRVGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2D3	Uncharacterized protein	0.883	23-36	RQRRRPGRGRGNKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2D3	Uncharacterized protein	0.677	1091-1098	KKKPEKVM
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCW4	Uncharacterized protein	0.866	368-386	KKAPAPPPPPPPSRRKSGE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCW4	Uncharacterized protein	0.649	48-52	RIKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHY1	Uncharacterized protein	0.989	492-518	RAWKKRRREEKKVLRQRENRRLGRRIA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHY1	Uncharacterized protein	0.982	172-194	KKSKSQEKKEEADKKKKSKPGKE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHY1	Uncharacterized protein	0.979	98-112	AKARKKAKNEKRKRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHY1	Uncharacterized protein	0.979	238-249	RASKKKRKRSKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHY1	Uncharacterized protein	0.921	61-88	KKKLNGTTLKGAKVKIEEAKPQKKRKLA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHY1	Uncharacterized protein	0.798	264-273	KPSKIKKARK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI02	Uncharacterized protein	0.613	37-40	KTRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PI02	Uncharacterized protein	0.612	43-45	RKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN38	PHD domain-containing protein	0.97	372-392	TPPPADKAPVKRGPGKKPGKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN38	PHD domain-containing protein	0.732	320-341	KERERARNEAASRRQDRARSRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PN38	PHD domain-containing protein	0.627	248-252	RRGKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQZ8	Uncharacterized protein	0.989	113-177	EHRRPSRRNDEYGREGERRRSSLDDPRRRSSRRDERPPPPREERRRDRDDRYRDEPPPPRRRSER
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWB7	Protein SDA1	0.996	648-711	TARRKEKKEAEGKSTTNKEKARKKNFMMTLGKAKRKGKRSLVEHRRILKAHVDRGKRGGRRGNN
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWB7	Protein SDA1	0.986	209-233	NKKSTKRNKEIKAAQAKVKRKEKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZ82	Uncharacterized protein	0.959	233-250	RTKSARGKKSKGKAPARG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1J8	Uncharacterized protein	0.831	113-121	TKKGRKPKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1J8	Uncharacterized protein	0.607	87-88	KK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2I1	Uncharacterized protein (Fragment)	0.928	129-146	RKKRDAKRAAKAEERRLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y2W8	Uncharacterized protein	0.851	587-596	KPSQKKRKRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLW3	Uncharacterized protein	0.998	1023-1040	RRKREKKPKEKRQKRKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLW3	Uncharacterized protein	0.956	1067-1081	PRQKKKRRLERKGTA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLW3	Uncharacterized protein	0.823	957-991	RKTREEEMRKREDEKRAALEKAEEQKRKILDERRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGU4	Replication termination factor 2	0.985	196-210	HSLKKAPGGKKRKKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PQD7	Fe2OG dioxygenase domain-containing protein	0.962	542-552	RRSAKKKKKKA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PZP7	Uncharacterized protein	0.758	23-57	NRKERRADAKQNGKPIEAPTSHPKLKLAQPDRSRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCR8	Lon protease homolog, mitochondrial	0.627	143-147	KGKGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFV5	Uncharacterized protein	0.642	235-238	RRKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGV8	AAA domain-containing protein	0.952	490-503	PGPSKSKKKGKKQG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PGV8	AAA domain-containing protein	0.731	593-601	RRPRKRSLK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PHB5	Uncharacterized protein	0.978	170-253	SGRRKKVRIWVRPKGEVVREKSVKGTAKIPGKKMPSAASNGEAKKRPAAQAKMPAKMAKTTMRAKQVNESEKQERKQPKTKAKH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP28	Class I unconventional myosin	0.903	1175-1194	GKKVPPAPPTKRPAGRKPAP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PP28	Class I unconventional myosin	0.839	972-995	PTPKGKRVPGKAITSGKLLKKSAG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1L8	AAA domain-containing protein	0.999	29-52	PRRPHKKARKRKSSPTKKPAKRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1L8	AAA domain-containing protein	0.874	126-140	ARPKGRRPAHAEKKP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1L8	AAA domain-containing protein	0.853	411-431	GGRRSGRLRGKTHSNRSRSRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1L8	AAA domain-containing protein	0.766	456-466	RIRRERPRRQR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1L8	AAA domain-containing protein	0.742	333-342	GGRSLRPRRK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q1L8	AAA domain-containing protein	0.658	1137-1141	RKKRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q2A9	WD_REPEATS_REGION domain-containing protein	0.674	709-715	GRRRMRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2WK97	Uncharacterized protein	0.903	300-311	GKKPRRGRKVPK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5Q1	Zn(2)-C6 fungal-type domain-containing protein	0.906	69-83	KRKRGPYKKDKPARQ
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2Y5Q1	Zn(2)-C6 fungal-type domain-containing protein	0.781	586-594	ARRVRRRRH
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKT5	Uncharacterized protein	0.997	163-216	KKPLRKKRPWDKGGADKVKMKKKKFRYETKAERAVTRQKQKSQNKKFAKARREG
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YKT5	Uncharacterized protein	0.967	34-64	KRKAARKEAAKEAAIKRDKEEKVRERKQLRE
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	M2YLB6	Uncharacterized protein	0.886	129-142	RALRRDGRSRKRRR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC78	ATP-dependent DNA helicase	0.987	519-535	RGRKAKGGRRAKRPLKK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC78	ATP-dependent DNA helicase	0.913	726-739	PKPRGRPKKAPPPP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC78	ATP-dependent DNA helicase	0.9	563-581	FGPKKTVVRKKSIPAKKRT
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PC78	ATP-dependent DNA helicase	0.6	772-772	R
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PCF2	RF_PROK_I domain-containing protein (Fragment)	0.954	170-192	AGRRKMKEFQSRKKSARRGGGGR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFL3	Uncharacterized protein	0.985	551-565	PKKKKGGGRKRTKAA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFL3	Uncharacterized protein	0.862	296-308	AGKKKATPKPRRP
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PFQ5	AMP-binding domain-containing protein (Fragment)	0.941	6-41	RKRKAEQQPAAPPLRRPKPSTKHKGTGDPGDPPRGK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PRI9	Uncharacterized protein	0.885	185-212	KRKKKEQGRSPHSGQDGSIRPPAAPRKR
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PSC9	W2 domain-containing protein	0.992	141-165	LKSQPKKGKKDKSTKKADRKARKEA
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1PWK3	Uncharacterized protein	0.602	36-37	PK
UP000016933	Dothistroma septosporum (strain NZE10 / CBS 128990)	N1Q0M2	Deacetylase sirtuin-type domain-containing protein (Fragment)	0.604	48-48	R