ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000016801	Claviceps purpurea (strain 20.1)	M1VVV4	Probable sterol glucosyltransferase	0.994	756-778	GKTAKRRIKHKMKSSKDKKKKRE
UP000016801	Claviceps purpurea (strain 20.1)	M1VVV4	Probable sterol glucosyltransferase	0.983	145-166	AKPHRKKEGHKSKTKHKHRPNT
UP000016801	Claviceps purpurea (strain 20.1)	M1VXQ7	Probable ATP-dependent RNA helicase	0.989	708-723	RQKKREKREKRKARER
UP000016801	Claviceps purpurea (strain 20.1)	M1VXQ7	Probable ATP-dependent RNA helicase	0.939	808-820	NNKNKKGKKGKGK
UP000016801	Claviceps purpurea (strain 20.1)	M1VXQ7	Probable ATP-dependent RNA helicase	0.756	424-430	VKEKKKK
UP000016801	Claviceps purpurea (strain 20.1)	M1VXQ7	Probable ATP-dependent RNA helicase	0.737	634-647	RREKALQSKKKMLK
UP000016801	Claviceps purpurea (strain 20.1)	M1VY57	Related to vacuolar membrane protein HMT1 (Heavy metal tolerance protein)	0.924	72-94	GGKPLPITKRKKRDDGERKLGPR
UP000016801	Claviceps purpurea (strain 20.1)	M1VZJ6	Related to P.falciparum liver stage antigen LSA-1	0.997	409-449	RKEALAKKRMERELSSREAKRAKRIKKIKSKAYHRVHRKQR
UP000016801	Claviceps purpurea (strain 20.1)	M1VZJ6	Related to P.falciparum liver stage antigen LSA-1	0.891	14-29	APKGKPAGKKNSKARS
UP000016801	Claviceps purpurea (strain 20.1)	M1VZJ6	Related to P.falciparum liver stage antigen LSA-1	0.871	829-857	EKKRHQGRFLTKVEGVKRRDRKDAKLERV
UP000016801	Claviceps purpurea (strain 20.1)	M1VZJ6	Related to P.falciparum liver stage antigen LSA-1	0.78	83-90	RKKKARGP
UP000016801	Claviceps purpurea (strain 20.1)	M1VZJ6	Related to P.falciparum liver stage antigen LSA-1	0.752	482-501	ERVGQRHKESKWAKIGSKNK
UP000016801	Claviceps purpurea (strain 20.1)	M1W1Y6	Chromosome segregation in meiosis protein	0.777	78-88	SGLPKLRKRAR
UP000016801	Claviceps purpurea (strain 20.1)	M1W538	Related to SAS10 protein, involved in silencing	0.991	562-598	EKNKGLAPKRSKDVRNPRVKRRKQYEAKQKKLKSMKP
UP000016801	Claviceps purpurea (strain 20.1)	M1W538	Related to SAS10 protein, involved in silencing	0.954	347-373	KKAKKASAKKDKAVVAAREAKKLAKAK
UP000016801	Claviceps purpurea (strain 20.1)	M1W538	Related to SAS10 protein, involved in silencing	0.844	100-110	KGKKAFKRKPR
UP000016801	Claviceps purpurea (strain 20.1)	M1W538	Related to SAS10 protein, involved in silencing	0.768	3-16	KKRKGSGRDAGPKG
UP000016801	Claviceps purpurea (strain 20.1)	M1W538	Related to SAS10 protein, involved in silencing	0.713	475-481	AAKRGKK
UP000016801	Claviceps purpurea (strain 20.1)	M1WAZ0	Uncharacterized protein	0.649	89-92	RRRR
UP000016801	Claviceps purpurea (strain 20.1)	M1WC17	Related to transcription factor atf1	0.914	363-398	KPLPKGKGKKTAASATNGRRKAEDMPTKAPPTKKAK
UP000016801	Claviceps purpurea (strain 20.1)	M1WCY4	YL1_C domain-containing protein	0.996	298-320	KPKKKKKEKPDKGGAGMRGKKNK
UP000016801	Claviceps purpurea (strain 20.1)	M1WCY4	YL1_C domain-containing protein	0.926	112-137	AKAKSTAQRKRKAQEAIPAKFRKKVR
UP000016801	Claviceps purpurea (strain 20.1)	M1WCY4	YL1_C domain-containing protein	0.759	151-157	PPRPKKK
UP000016801	Claviceps purpurea (strain 20.1)	M1WES7	Probable NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial	0.74	276-286	KPEEKKEEPKK
UP000016801	Claviceps purpurea (strain 20.1)	M1WF41	Zn(2)-C6 fungal-type domain-containing protein	0.686	384-392	GSKKEIKRR
UP000016801	Claviceps purpurea (strain 20.1)	M1WFT7	Probable deoxyribodipyrimidine photo-lyase PHR	0.62	8-10	RKS
UP000016801	Claviceps purpurea (strain 20.1)	M1WHQ5	Related to silencing protein (SIR2 gene family)	0.997	635-672	KERKEEKDKREKKKNKEVNEKKVKKAKTTKTTTEKKDK
UP000016801	Claviceps purpurea (strain 20.1)	M1WHX4	Uncharacterized protein	0.989	398-430	KRGKQSEKQKDKSREKPRSGGQKKSKGRAVSFK
UP000016801	Claviceps purpurea (strain 20.1)	M1WIW5	Related to nuclear GTPase	0.998	7-54	KPKKPQSKRGTSRLRHKIEKKSAAKQRKDRKKAKQNPEWRSKLKKDPG
UP000016801	Claviceps purpurea (strain 20.1)	M1WIW5	Related to nuclear GTPase	0.851	71-89	EKRMRKAAEAEKKRAMAKA
UP000016801	Claviceps purpurea (strain 20.1)	M1WIX9	Related to RNA-binding protein	0.705	328-339	EKKGGGKNNRNR
UP000016801	Claviceps purpurea (strain 20.1)	M1VVP3	Eukaryotic translation initiation factor 2A	0.961	525-535	NKKTKKKRGKK
UP000016801	Claviceps purpurea (strain 20.1)	M1VVP4	Related to translation initiation factor IF-2,mitochondrial	0.716	400-409	KKRQKAEKEA
UP000016801	Claviceps purpurea (strain 20.1)	M1VVP4	Related to translation initiation factor IF-2,mitochondrial	0.683	124-137	RRKTNADRRAGPAR
UP000016801	Claviceps purpurea (strain 20.1)	M1VVP4	Related to translation initiation factor IF-2,mitochondrial	0.642	374-378	KSKKS
UP000016801	Claviceps purpurea (strain 20.1)	M1VXB9	DNA helicase	0.739	151-162	KKKSKGSAPTPK
UP000016801	Claviceps purpurea (strain 20.1)	M1W2Q2	Uncharacterized protein	0.724	240-249	RRAWIRKRAK
UP000016801	Claviceps purpurea (strain 20.1)	M1W2V5	J domain-containing protein	0.968	166-188	RRRLKDKRDEKARRKLAKENMKT
UP000016801	Claviceps purpurea (strain 20.1)	M1W3G1	Uncharacterized protein	0.992	21-82	KHRRSKSERKPERERERDRDRDRDKDRDRERHRDRERDKDKVRDKDRDRDREHRHRSSKISL
UP000016801	Claviceps purpurea (strain 20.1)	M1W3G1	Uncharacterized protein	0.981	93-125	ASSRRHHKKDKDRESERERDRHKRRDPHKDKDN
UP000016801	Claviceps purpurea (strain 20.1)	M1W3G1	Uncharacterized protein	0.868	876-887	RHRRPKRRTERR
UP000016801	Claviceps purpurea (strain 20.1)	M1W529	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.737	335-341	KKPRRKR
UP000016801	Claviceps purpurea (strain 20.1)	M1W6C1	Related to protein kinase RAD53	0.857	482-492	GRRIRGKKVRR
UP000016801	Claviceps purpurea (strain 20.1)	M1W8M5	Probable 60S ribosomal protein L5	0.835	259-288	DGEAPKKTKEEWKAISKKYRQTKSSKAEKQ
UP000016801	Claviceps purpurea (strain 20.1)	M1WE56	HUN domain-containing protein	0.995	535-593	PHERPKRGRGSRGGRGGRGGAAARGGATARGGGGGPGSRGGSVTRKPRVTKAERLQRER
UP000016801	Claviceps purpurea (strain 20.1)	M1WE56	HUN domain-containing protein	0.993	74-119	PRKKPGRKPGSAAKAKAAEVPETAAKVRKPRKPRDPNAPPIQRKRK
UP000016801	Claviceps purpurea (strain 20.1)	M1WF05	Uncharacterized protein	0.972	54-71	KLREERERSKKKSSKKKS
UP000016801	Claviceps purpurea (strain 20.1)	M1WF50	Uncharacterized protein	0.816	722-731	DKKKARSKSR
UP000016801	Claviceps purpurea (strain 20.1)	M1WGB0	Related to Mx2 protein (GTPase protein)	0.976	769-793	KTKKGKKRSRLSKDVAFKPKKESIR
UP000016801	Claviceps purpurea (strain 20.1)	M1WHN5	Uncharacterized protein	0.999	84-107	KKRGKGAPKKKRGPPSNEKHGKKR
UP000016801	Claviceps purpurea (strain 20.1)	M1VWQ5	UDENN domain-containing protein	0.971	176-194	KRAKEKRQRTRRRRQDKAK
UP000016801	Claviceps purpurea (strain 20.1)	M1VX02	Related to cytoskeletal adaptor	0.911	265-288	SRPGRRTERTASAQKAPAKPPKKK
UP000016801	Claviceps purpurea (strain 20.1)	M1VX02	Related to cytoskeletal adaptor	0.696	162-167	RKKARA
UP000016801	Claviceps purpurea (strain 20.1)	M1VXX9	GYF domain-containing protein	0.904	314-332	KHQIKTKKIPKWKLKKLNK
UP000016801	Claviceps purpurea (strain 20.1)	M1VYY7	Related to putative human GTP-binding protein MMR1	0.956	640-660	RSKKHFKGGARMGKGKKVRTR
UP000016801	Claviceps purpurea (strain 20.1)	M1W397	Probable splicing factor PRP8 (U5 snRNP)	0.861	55-74	AQKKKEWLRDRRNRFGEKRK
UP000016801	Claviceps purpurea (strain 20.1)	M1W3A7	Related to VTC2-putative polyphosphate synthetase	0.603	146-146	K
UP000016801	Claviceps purpurea (strain 20.1)	M1W6K2	Related to telomere length regulator protein rif1	0.994	1745-1764	RRGRVQPRPARPRKRSSRRR
UP000016801	Claviceps purpurea (strain 20.1)	M1W6K2	Related to telomere length regulator protein rif1	0.902	1537-1546	RRRKRKRQSK
UP000016801	Claviceps purpurea (strain 20.1)	M1W6Y8	Uncharacterized protein	0.974	91-109	DGGAKRVPTREKTKRKRER
UP000016801	Claviceps purpurea (strain 20.1)	M1W6Y8	Uncharacterized protein	0.695	32-38	RERLKKR
UP000016801	Claviceps purpurea (strain 20.1)	M1W6Y8	Uncharacterized protein	0.676	65-78	VRRPNGKVLIKKLP
UP000016801	Claviceps purpurea (strain 20.1)	M1W7E6	Uncharacterized protein	0.77	311-327	GGGRPASVAGRRRSRAA
UP000016801	Claviceps purpurea (strain 20.1)	M1W7E6	Uncharacterized protein	0.733	352-360	KKKEKPSRK
UP000016801	Claviceps purpurea (strain 20.1)	M1W878	Uncharacterized protein	0.984	41-86	GKRGSSKGGHRSETRDHRSRHHRRHSRDSSRSRQRHEGSSRRRHRS
UP000016801	Claviceps purpurea (strain 20.1)	M1WAM9	Uncharacterized protein	0.677	305-313	RFSPRRARD
UP000016801	Claviceps purpurea (strain 20.1)	M1WAV7	Probable protein kinase ck2 catalytic subunit ck2 alpha-3	0.892	64-74	KPVKKKKIKRE
UP000016801	Claviceps purpurea (strain 20.1)	M1WBH2	Related to zinc finger protein	0.816	266-275	KKAKREKDKK
UP000016801	Claviceps purpurea (strain 20.1)	M1WCC0	tRNA (guanine(26)-N(2))-dimethyltransferase	0.944	81-91	KNAKKGKKRKR
UP000016801	Claviceps purpurea (strain 20.1)	M1WCI0	Related to dopamine-responsive protein	0.94	5-21	KRIRHGSAKKKSKKTST
UP000016801	Claviceps purpurea (strain 20.1)	M1WIA8	Uncharacterized protein	0.879	512-527	RRKTAIKKAHRRRSEP
UP000016801	Claviceps purpurea (strain 20.1)	M1VVX5	QA-1F quinic acid utilization activator QA-1F	0.697	21-26	KKPKKR
UP000016801	Claviceps purpurea (strain 20.1)	M1W030	Fe2OG dioxygenase domain-containing protein	0.822	106-113	RKKKKTKT
UP000016801	Claviceps purpurea (strain 20.1)	M1W065	Methionine aminopeptidase 2	1	54-70	AAKKKKKRKPRKKKKAA
UP000016801	Claviceps purpurea (strain 20.1)	M1W0D2	Uncharacterized protein	0.709	166-176	RKSRKFYKWKR
UP000016801	Claviceps purpurea (strain 20.1)	M1W215	Probable heat shock protein Hsp88	0.882	532-545	APKKTRKVKKQIRK
UP000016801	Claviceps purpurea (strain 20.1)	M1W2B3	Uncharacterized protein	0.998	51-101	SRAEQRERDRAEQERIRKEFEKEKATAKARLARERKKEKENAEREKKKKKG
UP000016801	Claviceps purpurea (strain 20.1)	M1W346	Related to cercosporin resistance protein	0.966	171-181	RLRRRRRRRRS
UP000016801	Claviceps purpurea (strain 20.1)	M1W4W0	Probable longevity-assurance protein LAG1	0.818	91-101	KRLSKRRRARG
UP000016801	Claviceps purpurea (strain 20.1)	M1W794	Related to F-box protein Fbl2	0.769	656-662	RRRRRRV
UP000016801	Claviceps purpurea (strain 20.1)	M1W7M6	Related to lethal(2) denticleless protein	0.92	34-49	TGRRKEKRKPSVTPRR
UP000016801	Claviceps purpurea (strain 20.1)	M1WAD4	Uncharacterized protein	0.862	943-961	RGRKRARAGEREEAGPVKR
UP000016801	Claviceps purpurea (strain 20.1)	M1WAD4	Uncharacterized protein	0.809	398-413	KLKLGKARHKESGGRK
UP000016801	Claviceps purpurea (strain 20.1)	M1WBE0	Related to PHD finger protein	0.659	709-714	RKGKRL
UP000016801	Claviceps purpurea (strain 20.1)	M1WBE0	Related to PHD finger protein	0.654	867-872	RKKLKG
UP000016801	Claviceps purpurea (strain 20.1)	M1WFK0	Protein kinase domain-containing protein	0.652	309-313	RRKIK
UP000016801	Claviceps purpurea (strain 20.1)	M1WHU8	CBF domain-containing protein	0.922	8-24	SKRKRASGDEKPAKRRR
UP000016801	Claviceps purpurea (strain 20.1)	M1VX78	Uncharacterized protein	0.928	160-171	KSPRRRPRRPKP
UP000016801	Claviceps purpurea (strain 20.1)	M1VX78	Uncharacterized protein	0.641	68-75	KGPRQARK
UP000016801	Claviceps purpurea (strain 20.1)	M1VYE1	Related to ribosomal protein YmL20,mitochondrial	0.737	193-202	KKKARWGHIR
UP000016801	Claviceps purpurea (strain 20.1)	M1VYH9	Related to RNA helicase	0.996	78-163	HRDRGGRERDRDRDPYRRRERSLDRRDGDRFRGGPRDQWDRERRRSRDRYIERPRSPGRRRNRSRDSDRDRDHRRRPESRDVGRDR
UP000016801	Claviceps purpurea (strain 20.1)	M1VYH9	Related to RNA helicase	0.808	19-47	SRRHRKDDDRRDRDRDRRDDGRDYRRRTR
UP000016801	Claviceps purpurea (strain 20.1)	M1VYH9	Related to RNA helicase	0.804	1015-1029	RKAHREKVKSGKAKD
UP000016801	Claviceps purpurea (strain 20.1)	M1VYH9	Related to RNA helicase	0.741	219-231	ERLAKLEAWKKKK
UP000016801	Claviceps purpurea (strain 20.1)	M1W208	Probable isp4 protein	0.68	100-104	TRKRR
UP000016801	Claviceps purpurea (strain 20.1)	M1W3Y8	Related to Ca2+-transporting ATPase	0.872	243-262	SKKQRKEGRSMNWRKHGKKQ
UP000016801	Claviceps purpurea (strain 20.1)	M1W668	Zds_C domain-containing protein	0.836	551-564	KDKKKEESKRAKAK
UP000016801	Claviceps purpurea (strain 20.1)	M1W668	Zds_C domain-containing protein	0.728	610-623	KRDSHRKNESKKEK
UP000016801	Claviceps purpurea (strain 20.1)	M1W668	Zds_C domain-containing protein	0.712	635-645	SKRREEKEKAT
UP000016801	Claviceps purpurea (strain 20.1)	M1W668	Zds_C domain-containing protein	0.654	519-524	EKKSKK
UP000016801	Claviceps purpurea (strain 20.1)	M1W748	Uncharacterized protein	0.978	66-90	GKGKKGKDKKATLGKGGSKKSFAKE
UP000016801	Claviceps purpurea (strain 20.1)	M1W748	Uncharacterized protein	0.929	11-41	KAKAPKATHSKKQASKVGKRGTKPSIDKVHR
UP000016801	Claviceps purpurea (strain 20.1)	M1WBA6	Uncharacterized protein	0.931	526-539	RETKAKKRRMGKGR
UP000016801	Claviceps purpurea (strain 20.1)	M1WDX6	Pkinase_fungal domain-containing protein	0.705	161-168	HRKGKWKR
UP000016801	Claviceps purpurea (strain 20.1)	M1WE25	Uncharacterized protein	0.95	108-118	LRKKRRAKRAG
UP000016801	Claviceps purpurea (strain 20.1)	M1WF56	Probable pre-mRNA splicing factor ATP-dependent RNA helicase PRP16	0.641	939-942	RKKA
UP000016801	Claviceps purpurea (strain 20.1)	M1WFF7	Related to transcription factor	0.898	772-789	GAKKKPSSQKPPPKGGKP
UP000016801	Claviceps purpurea (strain 20.1)	M1WFF7	Related to transcription factor	0.72	457-466	PKSRRSHKRK
UP000016801	Claviceps purpurea (strain 20.1)	M1WFK6	Mitochondrial distribution and morphology protein 34	0.87	359-371	HRSRTGRKKKTRV
UP000016801	Claviceps purpurea (strain 20.1)	M1WHI8	Related to RNA binding protein NRD1 protein	0.872	406-457	HGRSRSRSPDRGWGARDSPRGGRDRGSHGRNSPSNGRGGSDYRQRSPAGRRG
UP000016801	Claviceps purpurea (strain 20.1)	M1WHI8	Related to RNA binding protein NRD1 protein	0.763	646-663	EPSRGHSRRNREGPPARK
UP000016801	Claviceps purpurea (strain 20.1)	M1VV03	Uncharacterized protein	0.841	271-300	GEAKEDDRRSRSTRRHAPTHHHGHGRRHRS
UP000016801	Claviceps purpurea (strain 20.1)	M1VV03	Uncharacterized protein	0.635	261-269	KKMHKGGEA
UP000016801	Claviceps purpurea (strain 20.1)	M1VWT6	Metallophos domain-containing protein	0.92	203-214	TPKERKKPKPRI
UP000016801	Claviceps purpurea (strain 20.1)	M1VYJ6	C2H2-type domain-containing protein	0.722	194-201	RRPPRPPK
UP000016801	Claviceps purpurea (strain 20.1)	M1VZC8	rRNA-processing protein	0.996	24-118	MRKNGKQWHEPKKAFRPTKGLTTYEKRTKERAAMLQMKAKEKELKDDKEQARKEKIDKIRERRAKKEERERYEKMAETMHRKRVERLKRKEKRNK
UP000016801	Claviceps purpurea (strain 20.1)	M1W620	Probable mitochondrial ribosomal protein L2 of the large subunit	0.943	326-380	HGGGRGKSKSRRHPVTPWGRPTKSGYKTRREHNVNRWVVTPRPRNHGKRRTSSKA
UP000016801	Claviceps purpurea (strain 20.1)	M1W620	Probable mitochondrial ribosomal protein L2 of the large subunit	0.925	85-126	KGRPHLPLTIPKKGQGKGGRNSTGRITVRHRGGGVKRRIRIV
UP000016801	Claviceps purpurea (strain 20.1)	M1W652	Related to ubiquitin-protein ligase	0.797	551-564	KPHKSVKRLARKAK
UP000016801	Claviceps purpurea (strain 20.1)	M1W932	Related to RNA annealing protein	0.961	185-211	GAAKSGNGANGAANKKRRGRNARPVKK
UP000016801	Claviceps purpurea (strain 20.1)	M1W932	Related to RNA annealing protein	0.633	46-51	SKPARG
UP000016801	Claviceps purpurea (strain 20.1)	M1W9B2	Probable MBP1-transcription factor, subunit of the MBF factor	0.799	128-146	RHATKPKTSRAKLPPPPKW
UP000016801	Claviceps purpurea (strain 20.1)	M1WB11	Probable NADH dehydrogenase (Ubiquinone) 49K chain	0.636	51-54	DKKK
UP000016801	Claviceps purpurea (strain 20.1)	M1WBC7	ATP-dependent DNA helicase II subunit 2	0.806	556-567	KVPPKAKGRRNR
UP000016801	Claviceps purpurea (strain 20.1)	M1WBG0	Protein kinase domain-containing protein	0.892	654-664	KGGRKKRKIER
UP000016801	Claviceps purpurea (strain 20.1)	M1WBP1	Related to a-agglutinin core protein AGA1	0.788	152-160	KRPRRIRKK
UP000016801	Claviceps purpurea (strain 20.1)	M1WHN2	Related to signal recognition particle protein Sec65	0.989	292-305	GGKKKKDKKGKGKS
UP000016801	Claviceps purpurea (strain 20.1)	M1WIL0	Probable cellobiose dehydrogenase	0.714	573-586	SRRSRRSMQERRAR
UP000016801	Claviceps purpurea (strain 20.1)	M1VVG4	Gamma-tubulin	0.778	304-312	KSRSKKRKA
UP000016801	Claviceps purpurea (strain 20.1)	M1VVG4	Gamma-tubulin	0.699	322-328	SKKGKRR
UP000016801	Claviceps purpurea (strain 20.1)	M1VZI5	CHY-type domain-containing protein	0.962	676-705	WEGGRGTRDQRTMSRKDPRKYKRLGEKKKD
UP000016801	Claviceps purpurea (strain 20.1)	M1VZI5	CHY-type domain-containing protein	0.797	182-197	KPRGKPSGKQGPMKPK
UP000016801	Claviceps purpurea (strain 20.1)	M1VZI5	CHY-type domain-containing protein	0.612	672-674	GRG
UP000016801	Claviceps purpurea (strain 20.1)	M1W1M5	PXA domain-containing protein	0.841	278-292	KKGGHKRTKSARGSK
UP000016801	Claviceps purpurea (strain 20.1)	M1W306	Related to IST2 protein	0.601	901-901	R
UP000016801	Claviceps purpurea (strain 20.1)	M1W342	Related to DnaJ-like protein	0.965	484-503	KKDKDEDKKRKDKKEKHHRH
UP000016801	Claviceps purpurea (strain 20.1)	M1W5K2	Related to maleylacetate reductase	0.744	235-252	KPHRRNRERDSSSRSSRK
UP000016801	Claviceps purpurea (strain 20.1)	M1W5U0	Uncharacterized protein	0.769	344-359	KKPAPAPPPPPRRGHS
UP000016801	Claviceps purpurea (strain 20.1)	M1W5U0	Uncharacterized protein	0.645	251-264	RKLALRPPPPSSRH
UP000016801	Claviceps purpurea (strain 20.1)	M1W5W7	Probable ATP dependent RNA helicase	0.997	588-623	HKRGKGRAQRKGKSKVMKRGSKGDPLKTFKARRKMK
UP000016801	Claviceps purpurea (strain 20.1)	M1W5W7	Probable ATP dependent RNA helicase	0.982	381-399	AERTKKRKEQKKRASKRDK
UP000016801	Claviceps purpurea (strain 20.1)	M1W8E7	Probable YBT1-Vacuolar, `full-size` ABC protein transporting bile acids	0.795	991-1000	KKKDKAKAKK
UP000016801	Claviceps purpurea (strain 20.1)	M1WAM0	PWWP domain-containing protein	0.988	386-436	AAAPTPKSAGAKVTKIKPKKAKETKEATEKKVEPAESKLSPEARHKRKVKE
UP000016801	Claviceps purpurea (strain 20.1)	M1WAM0	PWWP domain-containing protein	0.89	347-374	KKTKKRKAEDGAATPQRPDSVKKPKIKL
UP000016801	Claviceps purpurea (strain 20.1)	M1WAM0	PWWP domain-containing protein	0.866	153-173	KNKGGRRRSTGGGLARKASRA
UP000016801	Claviceps purpurea (strain 20.1)	M1WAM0	PWWP domain-containing protein	0.759	320-328	PKKTKKSKS
UP000016801	Claviceps purpurea (strain 20.1)	M1WB66	Uncharacterized protein	0.912	340-361	KKKEANKRASKKSNSKPSSRSK
UP000016801	Claviceps purpurea (strain 20.1)	M1WCZ9	Protein kinase domain-containing protein	0.977	78-108	RPRKVNKIEPRHLKRRQRDLRRGLQAKKRQR
UP000016801	Claviceps purpurea (strain 20.1)	M1WCZ9	Protein kinase domain-containing protein	0.709	133-146	KRERQAKERARALK
UP000016801	Claviceps purpurea (strain 20.1)	M1WD55	Probable serine/threonine protein kinase (SNF1)	0.605	30-31	RR
UP000016801	Claviceps purpurea (strain 20.1)	M1VU80	RING-type domain-containing protein	0.675	116-121	RRRREK
UP000016801	Claviceps purpurea (strain 20.1)	M1VU80	RING-type domain-containing protein	0.642	368-371	GRRR
UP000016801	Claviceps purpurea (strain 20.1)	M1VXN7	Cytochrome b561 domain-containing protein	0.923	631-647	RPRRRDSSRRRRAGERA
UP000016801	Claviceps purpurea (strain 20.1)	M1VXN7	Cytochrome b561 domain-containing protein	0.88	827-838	RRRRRRLERRGA
UP000016801	Claviceps purpurea (strain 20.1)	M1VXN7	Cytochrome b561 domain-containing protein	0.644	521-527	SRRPPPP
UP000016801	Claviceps purpurea (strain 20.1)	M1VXN7	Cytochrome b561 domain-containing protein	0.642	483-488	ERRARK
UP000016801	Claviceps purpurea (strain 20.1)	M1VZL9	Related to RIM15-protein kinase involved in expression of meiotic genes	0.799	1782-1792	KGRHRRRSSKP
UP000016801	Claviceps purpurea (strain 20.1)	M1W581	Uncharacterized protein	0.692	184-193	RKREEKRLKG
UP000016801	Claviceps purpurea (strain 20.1)	M1W7B3	Related to NOL1R protein	0.849	375-391	KKKKPPREDPSNQRKRK
UP000016801	Claviceps purpurea (strain 20.1)	M1W7P3	Related to na+/k+/2cl-cotransporter	0.971	616-636	AKMSRRPPRQKNNRSGRRRRR
UP000016801	Claviceps purpurea (strain 20.1)	M1W7Q6	Related to muscle-derived protein	0.684	27-33	KKAKGKK
UP000016801	Claviceps purpurea (strain 20.1)	M1W7R8	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.954	419-450	RAGSRRGGGGGGGRGGDSRGRGGRGRGSNRGG
UP000016801	Claviceps purpurea (strain 20.1)	M1W7R8	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.845	341-356	KKAKKQQRQKDKSKGK
UP000016801	Claviceps purpurea (strain 20.1)	M1W9J3	BZIP domain-containing protein	0.917	82-137	KKQTKKRKSWGQVLPEPKTNLPPRKRAKTDDEKEQRRVERVLRNRRAAQSSRERKR
UP000016801	Claviceps purpurea (strain 20.1)	M1WBJ5	Chromatin modification-related protein	0.667	324-331	RKKPPTKS
UP000016801	Claviceps purpurea (strain 20.1)	M1WCU9	Uncharacterized protein	0.951	161-232	RIKFRQKTKRSPKPKPPEVVHRAAPSEKGVEEERATPSASPPKKRVVSDEHWRKTRVRKSPSRKVSSSRRDR
UP000016801	Claviceps purpurea (strain 20.1)	M1WCU9	Uncharacterized protein	0.623	497-499	PKR
UP000016801	Claviceps purpurea (strain 20.1)	M1WE47	tRNA (guanine(9)-N1)-methyltransferase	0.993	38-61	EDGKEDRKKRRREKRTATKARQRE
UP000016801	Claviceps purpurea (strain 20.1)	M1WE47	tRNA (guanine(9)-N1)-methyltransferase	0.623	30-33	RLRR
UP000016801	Claviceps purpurea (strain 20.1)	M1WGW2	Uncharacterized protein (Fragment)	0.688	766-770	KKRKR
UP000016801	Claviceps purpurea (strain 20.1)	M1WH71	HTH La-type RNA-binding domain-containing protein	0.906	139-148	RRPRKGKKSK
UP000016801	Claviceps purpurea (strain 20.1)	M1WIN3	Uncharacterized protein	0.998	91-116	ASTKDSPRKASEKKSKKKSPKKGKGK
UP000016801	Claviceps purpurea (strain 20.1)	M1WIN3	Uncharacterized protein	0.963	144-156	KNNKKAKKGKKGK
UP000016801	Claviceps purpurea (strain 20.1)	M1WIN3	Uncharacterized protein	0.936	2090-2120	AGKKGSEDKARKARQDERNKKSREEEQKPSG
UP000016801	Claviceps purpurea (strain 20.1)	M1VU28	Pre-rRNA-processing protein IPI1	0.833	6-21	KKKKEKQKDFQKPKYK
UP000016801	Claviceps purpurea (strain 20.1)	M1VVK7	mRNA cap guanine-N7 methyltransferase	0.947	328-348	KAAAKKAAKKEKDNEKKKEEQ
UP000016801	Claviceps purpurea (strain 20.1)	M1VVK7	mRNA cap guanine-N7 methyltransferase	0.887	46-77	RRAISPSDQPRKQKRPGTRARISEAEREAIRR
UP000016801	Claviceps purpurea (strain 20.1)	M1VVK7	mRNA cap guanine-N7 methyltransferase	0.68	220-232	GRGGGRGGSNRRP
UP000016801	Claviceps purpurea (strain 20.1)	M1VVU8	Uncharacterized protein	0.982	113-133	RVRRWRANGRGRRGRGRAKAK
UP000016801	Claviceps purpurea (strain 20.1)	M1VWK2	tRNA-dihydrouridine synthase 3	0.961	364-377	AKKRRKKDKDAGKR
UP000016801	Claviceps purpurea (strain 20.1)	M1VWK2	tRNA-dihydrouridine synthase 3	0.899	490-536	PKEALAKGAIRPSKKELKAGGKVPVQMKGEAKGEEGEVKAQSGGKRR
UP000016801	Claviceps purpurea (strain 20.1)	M1W0W3	Related to component of actin cortical patches LAS17	0.78	464-477	RPKPPRIEKDKKGP
UP000016801	Claviceps purpurea (strain 20.1)	M1W0W3	Related to component of actin cortical patches LAS17	0.601	412-412	R
UP000016801	Claviceps purpurea (strain 20.1)	M1W156	Uncharacterized protein	0.654	163-170	KKSAKTRK
UP000016801	Claviceps purpurea (strain 20.1)	M1W344	Related to Y.lipolytica glyoxylate pathway regulator GPR1	0.734	274-282	DRKDRKKSE
UP000016801	Claviceps purpurea (strain 20.1)	M1W4F1	Related to ser/thr protein kinase KIN4	0.664	1100-1105	RRGKAR
UP000016801	Claviceps purpurea (strain 20.1)	M1W4K7	Probable ribosomal protein S12	0.629	189-192	KKPK
UP000016801	Claviceps purpurea (strain 20.1)	M1W4T6	Nucleolar protein 58	0.99	585-599	EAKKEKRQKKKKRHS
UP000016801	Claviceps purpurea (strain 20.1)	M1W4T6	Nucleolar protein 58	0.964	543-575	KKELKKLRKAEAQSTPSKTATAPSPEKKKKRKH
UP000016801	Claviceps purpurea (strain 20.1)	M1W4T6	Nucleolar protein 58	0.813	459-468	KKSKKEKKAK
UP000016801	Claviceps purpurea (strain 20.1)	M1W7H2	Related to LIM homeobox protein	0.879	48-59	HPKGKRKRTAAK
UP000016801	Claviceps purpurea (strain 20.1)	M1W7H2	Related to LIM homeobox protein	0.762	556-561	RKRKKH
UP000016801	Claviceps purpurea (strain 20.1)	M1W7Y3	Uncharacterized protein	0.792	3-22	RKRKIPPRAAARQEQAARKR
UP000016801	Claviceps purpurea (strain 20.1)	M1W966	Transcription initiation factor IIE subunit beta	0.903	260-274	KPKVQKKRASKRGGK
UP000016801	Claviceps purpurea (strain 20.1)	M1WFW7	Uncharacterized protein	0.659	419-422	KRKR
UP000016801	Claviceps purpurea (strain 20.1)	M1WHA7	Related to vanadate resistance protein Gog5p,member of the triose phosphate translocater family of me	0.96	163-175	KDRARKQKKRRKN
UP000016801	Claviceps purpurea (strain 20.1)	M1VVM1	Related to monooxygenase	0.841	102-116	PPNKRRRLNREKLRK
UP000016801	Claviceps purpurea (strain 20.1)	M1VWD2	DUF2040 domain-containing protein	0.791	140-156	KPKKKEAAKEDAERKPK
UP000016801	Claviceps purpurea (strain 20.1)	M1VWD2	DUF2040 domain-containing protein	0.788	318-337	KKKEEVKRDAGRSREPEKKS
UP000016801	Claviceps purpurea (strain 20.1)	M1VWD2	DUF2040 domain-containing protein	0.727	402-412	RKKAAEEAKKK
UP000016801	Claviceps purpurea (strain 20.1)	M1VWD2	DUF2040 domain-containing protein	0.705	82-90	PKKSKPGPP
UP000016801	Claviceps purpurea (strain 20.1)	M1VYE3	Uncharacterized protein	0.93	216-236	ARRRPEGARGPSRSRQPRRRP
UP000016801	Claviceps purpurea (strain 20.1)	M1VYE3	Uncharacterized protein	0.878	71-89	RGRPRGSRNKKKTVPDHLR
UP000016801	Claviceps purpurea (strain 20.1)	M1W0H2	Uncharacterized protein	0.744	767-774	KRKRDRKA
UP000016801	Claviceps purpurea (strain 20.1)	M1W494	Uncharacterized protein	0.705	108-121	KHWRKLGGRLIRRK
UP000016801	Claviceps purpurea (strain 20.1)	M1W7X6	Related to GTP-binding protein Bms1p, required for distinct steps of 40S ribosome biogenesis	0.995	1108-1167	AKRRAKKAENHAAFKKKLAENEDKKEAREKRESKEFWRKNGRKRAAAEDGGGGGGGKRRR
UP000016801	Claviceps purpurea (strain 20.1)	M1W7X6	Related to GTP-binding protein Bms1p, required for distinct steps of 40S ribosome biogenesis	0.99	6-40	KPHRKSKEKKDKKKHTGDPNPKAFAFSKPGKLQKA
UP000016801	Claviceps purpurea (strain 20.1)	M1W7X6	Related to GTP-binding protein Bms1p, required for distinct steps of 40S ribosome biogenesis	0.778	181-190	KDAKKRLKRR
UP000016801	Claviceps purpurea (strain 20.1)	M1WA89	Uncharacterized protein	0.845	461-488	AKDKERWARLRKVKSLFDTKGSKKFKRE
UP000016801	Claviceps purpurea (strain 20.1)	M1WB17	Related to ribosomal protein L19, mitochondrial	0.99	220-247	GAQTGKGEKSGKREKRRKAEQSRKDEKS
UP000016801	Claviceps purpurea (strain 20.1)	M1WB17	Related to ribosomal protein L19, mitochondrial	0.909	166-183	RRPKRARRARVTYMRKPK
UP000016801	Claviceps purpurea (strain 20.1)	M1WB17	Related to ribosomal protein L19, mitochondrial	0.627	213-216	KKGP
UP000016801	Claviceps purpurea (strain 20.1)	M1WB99	Uncharacterized protein	0.759	98-106	KRSSRRRGR
UP000016801	Claviceps purpurea (strain 20.1)	M1WC73	Uncharacterized protein	0.992	298-340	KRRRARRVQSREQMKRGDRGRPGRERERNREMEKDRSREREKG
UP000016801	Claviceps purpurea (strain 20.1)	M1WDZ3	Uncharacterized protein	0.998	210-302	NAKAEQKAARRKAKEEKRAKKEAKRQKQEDEEKKQLPSRPATQEQTKEQRRATRAAEKSRHPEDKAARKLERRKTKEERRAKKEARRRDHARK
UP000016801	Claviceps purpurea (strain 20.1)	M1WDZ3	Uncharacterized protein	0.993	149-194	KPLKKKGTKTKENTKDKTKDKTRARTKDKTRAKIKDKTKEKMKSKT
UP000016801	Claviceps purpurea (strain 20.1)	M1WH10	Related to peroxisomal ATP carrier	0.624	330-335	RIREKR
UP000016801	Claviceps purpurea (strain 20.1)	M1WHB5	CCHC-type domain-containing protein	0.99	375-402	GKLYKKSKDKSHRSRKDAKPSSRRRKHG
UP000016801	Claviceps purpurea (strain 20.1)	M1WHV0	Telomere_reg-2 domain-containing protein	0.775	551-559	RPKPKPKAK
UP000016801	Claviceps purpurea (strain 20.1)	M1WHZ6	Uncharacterized protein	0.755	146-154	RKIKRRARR
UP000016801	Claviceps purpurea (strain 20.1)	M1VU60	Endoplasmic reticulum chaperone BiP	0.719	203-208	ARKKKN
UP000016801	Claviceps purpurea (strain 20.1)	M1VVB5	Phospholipid-transporting ATPase	0.922	156-174	IRKLRPGRNKGRAGKGVSR
UP000016801	Claviceps purpurea (strain 20.1)	M1VVB5	Phospholipid-transporting ATPase	0.889	694-707	LDRRSRGRSRRPRH
UP000016801	Claviceps purpurea (strain 20.1)	M1VVG7	Related to NsdD protein	0.977	484-561	AKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKSIKS
UP000016801	Claviceps purpurea (strain 20.1)	M1W0C0	Uncharacterized protein	0.984	68-100	PNQERKLRDEKRQRRDQKRERHVEKRKKMLQQA
UP000016801	Claviceps purpurea (strain 20.1)	M1W2X6	Related to translation initiation factor eIF-4F	0.626	780-785	KAEAKK
UP000016801	Claviceps purpurea (strain 20.1)	M1W2X6	Related to translation initiation factor eIF-4F	0.606	774-775	KR
UP000016801	Claviceps purpurea (strain 20.1)	M1W468	DNA mismatch repair protein	0.626	194-196	KKG
UP000016801	Claviceps purpurea (strain 20.1)	M1W503	Uncharacterized protein	0.923	369-384	AERKAKLKKQKSAAKK
UP000016801	Claviceps purpurea (strain 20.1)	M1W503	Uncharacterized protein	0.911	189-204	AKRPKVDGKRPKRADK
UP000016801	Claviceps purpurea (strain 20.1)	M1W503	Uncharacterized protein	0.826	344-352	APKKKAKKQ
UP000016801	Claviceps purpurea (strain 20.1)	M1WBR9	Stress response protein NST1	0.996	635-784	RAKKAKNAQKKKDKAAQKKQALAEEKARREADKAAEEAARLEAERKRIAEQKQKAEDKRKQKEAQKKAEEEARLRKEAERLRRIHEQREKQAEQERKAREAKEREKRLKEEQRQREKEARQQKEREAQERKEKQERDRREKEARAAKTLK
UP000016801	Claviceps purpurea (strain 20.1)	M1WBR9	Stress response protein NST1	0.986	153-163	KGKKNKKKKKK
UP000016801	Claviceps purpurea (strain 20.1)	M1WBR9	Stress response protein NST1	0.899	80-92	NRKKQKRRQKALA
UP000016801	Claviceps purpurea (strain 20.1)	M1WBV0	PHD domain-containing protein	0.978	319-356	TRKSKSNRHQRERSEKEDKDRQRLEAASKRKGRAERRR
UP000016801	Claviceps purpurea (strain 20.1)	M1WBV0	PHD domain-containing protein	0.837	409-421	KRGARSSRRAKGK
UP000016801	Claviceps purpurea (strain 20.1)	M1WE73	Uncharacterized protein	0.951	183-196	DRPKRQRRPKRGHK
UP000016801	Claviceps purpurea (strain 20.1)	M1WHM9	Ribosome biogenesis protein RLP24	0.859	100-119	RARRERAFYKKRMVGKKARE
UP000016801	Claviceps purpurea (strain 20.1)	M1WHM9	Ribosome biogenesis protein RLP24	0.779	41-58	KHRRNPNKLKWTKASRIK
UP000016801	Claviceps purpurea (strain 20.1)	M1WIR1	Uncharacterized protein	0.906	704-715	RLKRRKRRLMKH
UP000016801	Claviceps purpurea (strain 20.1)	M1VV93	Cysteinyl-tRNA synthetase	0.882	709-741	EEKAAREAEKAAKKEEARLAREKAEQEAREKAK
UP000016801	Claviceps purpurea (strain 20.1)	M1VV93	Cysteinyl-tRNA synthetase	0.606	788-789	RK
UP000016801	Claviceps purpurea (strain 20.1)	M1VY37	Uncharacterized protein	0.885	123-143	KDRRRQASLRAKKSSQKRSPK
UP000016801	Claviceps purpurea (strain 20.1)	M1VZE1	Zn(2)-C6 fungal-type domain-containing protein	0.652	16-21	KRRDSR
UP000016801	Claviceps purpurea (strain 20.1)	M1W0V5	Uncharacterized protein	0.651	625-631	RPKAHKP
UP000016801	Claviceps purpurea (strain 20.1)	M1W3V9	Related to helicases of the Snf2/Rad54 family	0.906	167-202	DRAGKKRKFSRESSPIIGSSPPPTPPPKKSQKRRLT
UP000016801	Claviceps purpurea (strain 20.1)	M1W5X1	Uncharacterized protein	0.938	88-102	PRRPPKRSPRRRLLT
UP000016801	Claviceps purpurea (strain 20.1)	M1W5X1	Uncharacterized protein	0.636	124-127	PRRR
UP000016801	Claviceps purpurea (strain 20.1)	M1W8D0	ASXH domain-containing protein	0.923	3-14	PRRKPRRKQKSK
UP000016801	Claviceps purpurea (strain 20.1)	M1WFB3	Uncharacterized protein	0.87	206-226	HERASNKRKRLSSSRWRARFK
UP000016801	Claviceps purpurea (strain 20.1)	M1WGL4	Uncharacterized protein	0.712	190-199	PPRRAARGRW
UP000016801	Claviceps purpurea (strain 20.1)	M1WGN8	HTH CENPB-type domain-containing protein	0.91	26-37	KPKPKRGPKKLR
UP000016801	Claviceps purpurea (strain 20.1)	M1WHV7	Uncharacterized protein	0.923	26-81	DAKADGKAEGKANAKSNTRGSGEKHEKSSFEGPKERRKSPWQKASLYLPKSKKVAP
UP000016801	Claviceps purpurea (strain 20.1)	M1WIR6	Uncharacterized protein	0.999	376-404	PKPRNRKKRATKKEPRGRKPKKEKKLSQR
UP000016801	Claviceps purpurea (strain 20.1)	M1WIR6	Uncharacterized protein	0.992	829-856	AKKSTPAAAAKRGSKAKAPKSGKRSRKP
UP000016801	Claviceps purpurea (strain 20.1)	M1WIR6	Uncharacterized protein	0.922	110-119	ARRRRKSKKR
UP000016801	Claviceps purpurea (strain 20.1)	M1WIR6	Uncharacterized protein	0.84	162-179	KRRLSHSAEGRPRRKQRS
UP000016801	Claviceps purpurea (strain 20.1)	M1WIR6	Uncharacterized protein	0.803	66-88	KKAKRNKHNQSQTKDKSDKKGKK
UP000016801	Claviceps purpurea (strain 20.1)	M1WIR6	Uncharacterized protein	0.683	336-342	RSARKKA
UP000016801	Claviceps purpurea (strain 20.1)	M1VWB1	SANT domain-containing protein	0.987	607-619	GRRKKGKGKRKGR
UP000016801	Claviceps purpurea (strain 20.1)	M1VWB1	SANT domain-containing protein	0.84	349-369	KKFSRHDELRERERKARMKAK
UP000016801	Claviceps purpurea (strain 20.1)	M1VWB1	SANT domain-containing protein	0.813	296-312	PAPRKRKTPAPNANGSR
UP000016801	Claviceps purpurea (strain 20.1)	M1VWB1	SANT domain-containing protein	0.761	275-283	RPKKRQRRT
UP000016801	Claviceps purpurea (strain 20.1)	M1VWB1	SANT domain-containing protein	0.68	7-21	KKGGLAFKPKAPIAR
UP000016801	Claviceps purpurea (strain 20.1)	M1VWH1	Uncharacterized protein	0.74	187-194	KRKGRRAG
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.997	2751-2762	KGKKKKKKGKKK
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.997	4045-4059	KKKGKKGKKGKKSKP
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.996	2458-2470	KSKKGKKKKKKSK
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.995	3528-3540	KKGKKKKKNKKAK
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.994	2947-2958	GKKAKKKKKKKG
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.981	626-768	RTHERDSIRRDKEAEPEPSRKSKRDSHSSKQPDEKEHKRHSHHEEDEAPRKRREKTVEHHHHHPEAESSRKSKRSDRDHREKERERDGDRSTKSGSSSKSAKRESRKHDDREERRKEERIAEDLEQRRKEERAAQAHEERRKE
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.979	3073-3084	ATGKKNKKKKKR
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.963	4282-4296	AKTTKKNDKKGKKRK
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.956	1110-1127	GKDKDKKQKSKSKKSKSR
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.952	2240-2252	KERKKARKQRKSR
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.94	3806-3818	RKLSKKEKRNKKK
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.923	3311-3321	LSKKAKRKNKK
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.895	3944-3955	SSKKKQKKGKSR
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.888	4870-4882	GGRKKAKGKQNKI
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.882	1413-1426	RHRSKKERRKLERA
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.869	575-593	SKREARREERRAERKEGLP
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.837	178-192	SERRVRRRRSGLINK
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.821	1552-1563	RKSKSKSKSKRH
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.718	1457-1465	KKEKEKRER
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.706	1377-1387	DKKRLEKESKR
UP000016801	Claviceps purpurea (strain 20.1)	M1W322	Uncharacterized protein	0.703	603-613	EPKGKEKETKR
UP000016801	Claviceps purpurea (strain 20.1)	M1W3J0	WD_REPEATS_REGION domain-containing protein	0.693	55-59	KRRRK
UP000016801	Claviceps purpurea (strain 20.1)	M1W4A8	Uncharacterized protein	0.862	86-99	KKLKKDRKLQRAKR
UP000016801	Claviceps purpurea (strain 20.1)	M1W547	ERCC4 domain-containing protein	0.979	324-366	HKPPKKARAPKKATTTRPKQTAAEREAEKENKRREREQLKAEK
UP000016801	Claviceps purpurea (strain 20.1)	M1W750	Uncharacterized protein	0.874	173-210	PTSHRHKRRSSTAVPQRSSTARPSAPSHRPKPKAPHVK
UP000016801	Claviceps purpurea (strain 20.1)	M1W8N8	Uncharacterized protein	0.931	485-496	REKKRRRRPLPR
UP000016801	Claviceps purpurea (strain 20.1)	M1W972	Uncharacterized protein	0.779	36-47	KEKDERYRKRRR
UP000016801	Claviceps purpurea (strain 20.1)	M1WBA8	Zn(2)-C6 fungal-type domain-containing protein	0.73	62-67	PRKKRQ
UP000016801	Claviceps purpurea (strain 20.1)	M1WBU7	DH domain-containing protein	0.701	1139-1148	KRSHRHRRPI
UP000016801	Claviceps purpurea (strain 20.1)	M1WEH3	FCP1 homology domain-containing protein	0.634	138-141	KPRR
UP000016801	Claviceps purpurea (strain 20.1)	M1WGH4	Uncharacterized protein	0.994	364-403	EARKKKEEEQRKKEEEQRKKEEEEKKEGERRKKEEERKKQ
UP000016801	Claviceps purpurea (strain 20.1)	M1WHR3	Uncharacterized protein	0.822	283-290	KKKPEKKR
UP000016801	Claviceps purpurea (strain 20.1)	M1WHR3	Uncharacterized protein	0.772	152-160	SRKPRKSRA
UP000016801	Claviceps purpurea (strain 20.1)	M1VTU0	Related to tRNA binding protein ARC1	0.979	180-198	GDKPKKEKKEKAPKPQKAP
UP000016801	Claviceps purpurea (strain 20.1)	M1VV29	Uncharacterized protein	0.648	506-510	RKGKE
UP000016801	Claviceps purpurea (strain 20.1)	M1VX30	Non-specific serine/threonine protein kinase	0.762	565-583	ARNKVKKDKVLKFIKAVEK
UP000016801	Claviceps purpurea (strain 20.1)	M1VYE7	ENDO3c domain-containing protein	0.959	49-90	KRAARSRTAASPSPKKAKREPSSSPDAHRHKPVKIKDELAKA
UP000016801	Claviceps purpurea (strain 20.1)	M1VYT4	AAA domain-containing protein	0.924	532-541	VPKKKRKKNK
UP000016801	Claviceps purpurea (strain 20.1)	M1VYT4	AAA domain-containing protein	0.885	688-701	KAKKGKPGSKAKSK
UP000016801	Claviceps purpurea (strain 20.1)	M1VYT4	AAA domain-containing protein	0.708	55-62	KRRKTSKP
UP000016801	Claviceps purpurea (strain 20.1)	M1VYT4	AAA domain-containing protein	0.651	353-358	PARPKK
UP000016801	Claviceps purpurea (strain 20.1)	M1W201	Stc1 domain-containing protein	0.775	358-370	PAAKRKGGWHKAP
UP000016801	Claviceps purpurea (strain 20.1)	M1W4I6	Related to syntaxin-binding protein sec1-like protein	0.909	712-728	GKLHKEKKRRNFLGMKK
UP000016801	Claviceps purpurea (strain 20.1)	M1W592	C3H1-type domain-containing protein	0.969	1416-1449	ERDRDRDRDRGESRDKDGKDGRKKKATLPPHKPA
UP000016801	Claviceps purpurea (strain 20.1)	M1W592	C3H1-type domain-containing protein	0.918	920-933	RAKRLRKEARKKLR
UP000016801	Claviceps purpurea (strain 20.1)	M1W592	C3H1-type domain-containing protein	0.874	517-536	KNKAEKKAKKSLEGDRQKPV
UP000016801	Claviceps purpurea (strain 20.1)	M1W592	C3H1-type domain-containing protein	0.662	337-340	KRKR
UP000016801	Claviceps purpurea (strain 20.1)	M1W7R2	Probable RHO1 protein	0.864	262-271	LKLPKRKKRR
UP000016801	Claviceps purpurea (strain 20.1)	M1W840	Probable dityrosine transporter	0.902	264-273	QRRRREKRRR
UP000016801	Claviceps purpurea (strain 20.1)	M1WCH6	Zn(2)-C6 fungal-type domain-containing protein	0.823	163-181	KRRGPPNKHAEAAKAAKRA
UP000016801	Claviceps purpurea (strain 20.1)	M1WDJ1	Btz domain-containing protein	0.617	15-17	RKI
UP000016801	Claviceps purpurea (strain 20.1)	M1WGT9	Uncharacterized protein	0.907	368-385	AARKKRMREERGLRPRLR
UP000016801	Claviceps purpurea (strain 20.1)	M1WGV3	Related to dna-dependent rna polymerase I subunit a43 (Rpa43)	0.99	14-50	REKRSKKDKSSKSKSERKRAREEDAAADGERKHKKTK
UP000016801	Claviceps purpurea (strain 20.1)	M1WGV3	Related to dna-dependent rna polymerase I subunit a43 (Rpa43)	0.984	143-157	KSEKKEKKKNKKREP
UP000016801	Claviceps purpurea (strain 20.1)	M1WGV3	Related to dna-dependent rna polymerase I subunit a43 (Rpa43)	0.962	71-86	KKEKKARKSSKKESRL
UP000016801	Claviceps purpurea (strain 20.1)	M1WGV3	Related to dna-dependent rna polymerase I subunit a43 (Rpa43)	0.934	424-437	RREKKGGRKMERRR
UP000016801	Claviceps purpurea (strain 20.1)	M1WGV3	Related to dna-dependent rna polymerase I subunit a43 (Rpa43)	0.675	117-122	KKKKVK
UP000016801	Claviceps purpurea (strain 20.1)	M1WGX4	Dimer_Tnp_hAT domain-containing protein	0.606	559-560	RK
UP000016801	Claviceps purpurea (strain 20.1)	M1VUK4	Probable U5 snRNP 100 kD protein	0.861	100-117	RPAAKGEKKNDKKNGEKK
UP000016801	Claviceps purpurea (strain 20.1)	M1VUK4	Probable U5 snRNP 100 kD protein	0.805	18-59	AAAKPRFIPKAQRERLAAEKAKQEEEERRQKSAEEAQRRREE
UP000016801	Claviceps purpurea (strain 20.1)	M1VUK4	Probable U5 snRNP 100 kD protein	0.718	693-725	KPVKGGGGRRNDEGAGGGGGGGGGGGGGGGGGG
UP000016801	Claviceps purpurea (strain 20.1)	M1VUK4	Probable U5 snRNP 100 kD protein	0.605	201-202	RK
UP000016801	Claviceps purpurea (strain 20.1)	M1VX69	Uncharacterized protein	0.729	1063-1082	KSKKIRDDEARRGVGKLRSR
UP000016801	Claviceps purpurea (strain 20.1)	M1VYS9	Related to transcription initiation factor TFIIIC	0.845	59-73	RVRGTRGPRKAAKPR
UP000016801	Claviceps purpurea (strain 20.1)	M1VYS9	Related to transcription initiation factor TFIIIC	0.766	537-551	PRRYRPKRLAAPDKR
UP000016801	Claviceps purpurea (strain 20.1)	M1W1G7	Uncharacterized protein	0.997	511-537	RSRRPQPRRGRGRGRGRGRKEPPPTSR
UP000016801	Claviceps purpurea (strain 20.1)	M1W1G7	Uncharacterized protein	0.892	3-18	RPKRARRAPPVKEPKP
UP000016801	Claviceps purpurea (strain 20.1)	M1W1G7	Uncharacterized protein	0.739	318-327	PRRRSTRKRN
UP000016801	Claviceps purpurea (strain 20.1)	M1W1G7	Uncharacterized protein	0.618	551-553	PKR
UP000016801	Claviceps purpurea (strain 20.1)	M1W2S4	Uncharacterized protein	0.739	123-143	RPRLRAPRDRPAIELPPRKRA
UP000016801	Claviceps purpurea (strain 20.1)	M1W2S4	Uncharacterized protein	0.728	539-546	KRNARRRK
UP000016801	Claviceps purpurea (strain 20.1)	M1W5M2	Elongator complex protein 1	0.979	1202-1217	SKNRRREEKKRARGRK
UP000016801	Claviceps purpurea (strain 20.1)	M1W5Q2	Uncharacterized protein	0.967	110-135	VRNGGQKRKRASRLQTAKRRKPATSR
UP000016801	Claviceps purpurea (strain 20.1)	M1W5Q2	Uncharacterized protein	0.62	10-14	PRNRR
UP000016801	Claviceps purpurea (strain 20.1)	M1W7F7	PUM-HD domain-containing protein	0.974	9-43	GNKRKAMPSGPNAKGRSDSKKARIEEPKARKPAPA
UP000016801	Claviceps purpurea (strain 20.1)	M1W7F7	PUM-HD domain-containing protein	0.966	658-672	EKKADKGAKKGKKKF
UP000016801	Claviceps purpurea (strain 20.1)	M1W7T4	Uncharacterized protein	0.98	312-323	PKKKKNKSKKKK
UP000016801	Claviceps purpurea (strain 20.1)	M1W7T4	Uncharacterized protein	0.823	1151-1166	KKRPAGIGLGRKSKRG
UP000016801	Claviceps purpurea (strain 20.1)	M1W8H6	Related to cutinase transcription factor 1 beta	0.662	62-69	GRYPRRSR
UP000016801	Claviceps purpurea (strain 20.1)	M1W9L5	Related to SGD1-involved in HOG pathway	0.984	44-64	RKELRKQQRATKKRKRRSDPG
UP000016801	Claviceps purpurea (strain 20.1)	M1WA65	VASt domain-containing protein	0.934	16-27	TAKRRRRKEKSE
UP000016801	Claviceps purpurea (strain 20.1)	M1WA65	VASt domain-containing protein	0.929	974-988	SGNLKGKRKLKRSKA
UP000016801	Claviceps purpurea (strain 20.1)	M1WB60	Uncharacterized protein	0.999	156-186	REKRRAKQEARDRERRKKRSEKQKKKHKDKS
UP000016801	Claviceps purpurea (strain 20.1)	M1WB60	Uncharacterized protein	0.982	345-373	GSRERDRNREREREREERRARRGGYRRGK
UP000016801	Claviceps purpurea (strain 20.1)	M1WEH0	NUC173 domain-containing protein	0.993	1209-1290	KISPRRGGGNDRGRSSRGRRGGGDMRGGGGGGGGGSRGGRGRDGGSRGRSGRGGIAAGRRGLGVDKRHGPSGQGVGKSWRGR
UP000016801	Claviceps purpurea (strain 20.1)	M1WEH0	NUC173 domain-containing protein	0.889	1002-1014	RKTKERTKKRKDA
UP000016801	Claviceps purpurea (strain 20.1)	M1WEH0	NUC173 domain-containing protein	0.843	1167-1181	GKDAAKRGRGGKLKF
UP000016801	Claviceps purpurea (strain 20.1)	M1WHP8	Related to origin recognition complex subunit 3	0.899	30-42	PHKKRRVARPPRR
UP000016801	Claviceps purpurea (strain 20.1)	M1WII1	Uncharacterized protein	0.733	319-325	RRRRRHR
UP000016801	Claviceps purpurea (strain 20.1)	M1VTV2	Related to Ca2+/H+-exchanging protein, vacuolar	0.999	432-458	GGRYRKYRRHRRSRRRHRRRRHEEKKN
UP000016801	Claviceps purpurea (strain 20.1)	M1VTV2	Related to Ca2+/H+-exchanging protein, vacuolar	0.894	355-368	RKVKKVLRGGRRRK
UP000016801	Claviceps purpurea (strain 20.1)	M1VVN1	Fibronectin type-III domain-containing protein	0.926	924-946	KEKEKEKDKEKDKDRTKEKGKSK
UP000016801	Claviceps purpurea (strain 20.1)	M1VX19	DNA polymerase	0.862	92-103	RGRPGKEAKKKR
UP000016801	Claviceps purpurea (strain 20.1)	M1VXP0	Probable peroxin-6	0.861	251-260	RGRHKKRSKR
UP000016801	Claviceps purpurea (strain 20.1)	M1VXP0	Probable peroxin-6	0.724	1348-1356	RSKGKGKGK
UP000016801	Claviceps purpurea (strain 20.1)	M1VXP0	Probable peroxin-6	0.68	14-20	RSTRRRR
UP000016801	Claviceps purpurea (strain 20.1)	M1VY58	ECM11 domain-containing protein	0.907	323-356	KKQHAPHDKFARDGTHKPAKHPRNVQQKDKKRRR
UP000016801	Claviceps purpurea (strain 20.1)	M1VY95	Uncharacterized protein	0.768	85-95	KKLSAKKSKKD
UP000016801	Claviceps purpurea (strain 20.1)	M1VZD7	RNase H domain-containing protein	0.872	231-240	RRRGRRHRRA
UP000016801	Claviceps purpurea (strain 20.1)	M1W027	zf-CCHC_2 domain-containing protein	0.85	160-181	KPKLKAKTEPEPKMKAKTSKSK
UP000016801	Claviceps purpurea (strain 20.1)	M1W027	zf-CCHC_2 domain-containing protein	0.811	514-523	KKKTTRKRPR
UP000016801	Claviceps purpurea (strain 20.1)	M1W223	Related to apopolysialoglycoprotein	0.998	213-237	ALRRRPPPPKRKSKAGPGRGKKKVK
UP000016801	Claviceps purpurea (strain 20.1)	M1W410	Uncharacterized protein	0.889	152-169	KKKMKDKNKNKKETEKEK
UP000016801	Claviceps purpurea (strain 20.1)	M1W4R6	Related to GTP-binding protein beta subunit-like protein	0.877	66-78	PKKKTSHAKKRHR
UP000016801	Claviceps purpurea (strain 20.1)	M1W671	Uncharacterized protein	0.937	144-183	PRRRKRVGASAKEVSKRRRTMGDNSDSKEETRRRKNDKSR
UP000016801	Claviceps purpurea (strain 20.1)	M1WBZ5	Probable recombinational repair protein mus-23	0.997	1117-1153	KPKGRAAARGSKTTAAKAAAKKAPARKAPARGRGRKA
UP000016801	Claviceps purpurea (strain 20.1)	M1WBZ5	Probable recombinational repair protein mus-23	0.777	1182-1202	KATTRGRRAAPSTAKKPATGR
UP000016801	Claviceps purpurea (strain 20.1)	M1WCQ7	Related to mRNA splicing factor	0.993	98-159	RDRRGGGSEGGREGGRDAARESVRESGRDSGRRSPRRGRSPSPRRSARDYSPRKDDRRDRDR
UP000016801	Claviceps purpurea (strain 20.1)	M1WE30	Related to GATA transcription factor	0.82	288-296	KRKRRRESH
UP000016801	Claviceps purpurea (strain 20.1)	M1WHS4	Uncharacterized protein	0.962	931-963	ARSFKEREREREREREREREREAKGEGRGESKG
UP000016801	Claviceps purpurea (strain 20.1)	M1WHS4	Uncharacterized protein	0.651	869-874	RRHRRV
UP000016801	Claviceps purpurea (strain 20.1)	M1WHS4	Uncharacterized protein	0.65	515-536	RKEVPRQQRGPEPGPSHERPRE
UP000016801	Claviceps purpurea (strain 20.1)	M1WIU0	Related to polycomb group protein MEDEA	0.996	1031-1076	LQHRSRRKYGQLQRSGRRSELSNKARGKRGGARPGSGRPRKHPRLI
UP000016801	Claviceps purpurea (strain 20.1)	M1WIU0	Related to polycomb group protein MEDEA	0.991	884-928	ARKPESKATKGARLARSQVHRPVPLKGVKVDTKRKGRGRPRIKRE
UP000016801	Claviceps purpurea (strain 20.1)	M1WIU0	Related to polycomb group protein MEDEA	0.931	1145-1195	KEGREVHKMVMPKTRRARRDVREKADGVGDKNVKVEKRGERAARIRRLPAK
UP000016801	Claviceps purpurea (strain 20.1)	M1VWR0	WW domain-containing protein	0.996	279-311	KAERSNKRISKSELKAFKEKRKARKEEKRRAWL
UP000016801	Claviceps purpurea (strain 20.1)	M1W1F9	Related to PAN1-actin-cytoskeleton assembly protein	0.961	1141-1160	GKLRKEEEKKRKKAAMAEAK
UP000016801	Claviceps purpurea (strain 20.1)	M1W3P4	Probable ATP-binding cassette transporter protein YOR1	0.996	325-343	GKTSKKKNKKNKKGKKDKL
UP000016801	Claviceps purpurea (strain 20.1)	M1W3P4	Probable ATP-binding cassette transporter protein YOR1	0.837	889-897	RKKRRANKK
UP000016801	Claviceps purpurea (strain 20.1)	M1W6M6	CUE domain-containing protein	0.954	119-175	KAARQKAKESSPPPSNNKFSPGDVRHPTRGGRAVSEGARGRGRGSERGGRGGAGRGR
UP000016801	Claviceps purpurea (strain 20.1)	M1W6M6	CUE domain-containing protein	0.686	12-27	RGRGSGRGSRGGFAGR
UP000016801	Claviceps purpurea (strain 20.1)	M1W7K2	Uncharacterized protein	0.833	207-223	QRRRQRGRQREVVRRRR
UP000016801	Claviceps purpurea (strain 20.1)	M1W7X8	NUC-1 transcription factor NUC-1	0.655	321-340	VKARGNPGIKNSPITKPQRR
UP000016801	Claviceps purpurea (strain 20.1)	M1W8E2	Protein kinase domain-containing protein	0.629	99-106	KRERQIKR
UP000016801	Claviceps purpurea (strain 20.1)	M1W9L9	Bms1-type G domain-containing protein	0.909	38-69	SHKPFKSKAASKHELRDRAKGRVPNERGQRKT
UP000016801	Claviceps purpurea (strain 20.1)	M1WAT9	Uncharacterized protein	0.992	1069-1097	GGGGGGGGKGKGGGTKGSGKGGKGEKGKK
UP000016801	Claviceps purpurea (strain 20.1)	M1WAT9	Uncharacterized protein	0.969	855-871	LKKAPPKRGQKGKAKKM
UP000016801	Claviceps purpurea (strain 20.1)	M1WAT9	Uncharacterized protein	0.836	179-196	KKAASMPAAKKVKGKPGG
UP000016801	Claviceps purpurea (strain 20.1)	M1WAT9	Uncharacterized protein	0.737	992-1006	KAKMQPGPVKKGKAV
UP000016801	Claviceps purpurea (strain 20.1)	M1WB13	DNA helicase	0.856	802-824	RKGKGKKESNAFFKKIGRENARR
UP000016801	Claviceps purpurea (strain 20.1)	M1WB13	DNA helicase	0.757	767-774	RKKKGARR
UP000016801	Claviceps purpurea (strain 20.1)	M1WDM2	SCA7 domain-containing protein	0.999	164-215	KKGNNAAKKPGKKPQDEKKGGKKRKADGDPEKGPRAKKKKDEPKPKVPKPKG
UP000016801	Claviceps purpurea (strain 20.1)	M1WDM2	SCA7 domain-containing protein	0.986	119-147	KLKKEKAQRKKEAREARERAKEAAREKEA
UP000016801	Claviceps purpurea (strain 20.1)	M1WDM2	SCA7 domain-containing protein	0.95	12-41	EKTIKVASKTGKKFGAIKLKKVPPKHSKPG
UP000016801	Claviceps purpurea (strain 20.1)	M1WI84	SWR1-complex protein 4	0.692	59-68	KKRRFASRKP
UP000016801	Claviceps purpurea (strain 20.1)	M1WIZ8	Uncharacterized protein	0.922	450-463	PRRSGRKRTRRTKS
UP000016801	Claviceps purpurea (strain 20.1)	M1WIZ8	Uncharacterized protein	0.868	295-305	RSGRRDRRKRR
UP000016801	Claviceps purpurea (strain 20.1)	M1WIZ8	Uncharacterized protein	0.765	326-333	PRDRRKRR
UP000016801	Claviceps purpurea (strain 20.1)	M1VUG4	Uncharacterized protein	0.986	132-174	KARKMEEIREARKVEAQKKDEEKKSRLEDTKDSLRKKRKRKSA
UP000016801	Claviceps purpurea (strain 20.1)	M1VUG4	Uncharacterized protein	0.908	24-72	SSKGGASAGAKRSDTDGITKRSRKPKGPVVSQQVKEKNRTAMLKRPKKK
UP000016801	Claviceps purpurea (strain 20.1)	M1VUG4	Uncharacterized protein	0.788	94-102	KPKGKKKGK
UP000016801	Claviceps purpurea (strain 20.1)	M1VUG4	Uncharacterized protein	0.643	12-20	KHAGPKGGS
UP000016801	Claviceps purpurea (strain 20.1)	M1VUP3	DUF4210 domain-containing protein	0.832	125-139	RPPSRAKRRMGSPRA
UP000016801	Claviceps purpurea (strain 20.1)	M1VV54	Related to URK1	0.927	1293-1338	AKIKKGAGKKSGIGGFARENASRSKVLVRESERRREERKVRGAERR
UP000016801	Claviceps purpurea (strain 20.1)	M1VV54	Related to URK1	0.682	1134-1142	HPRRSKNTK
UP000016801	Claviceps purpurea (strain 20.1)	M1VV54	Related to URK1	0.674	1028-1033	KRMKRR
UP000016801	Claviceps purpurea (strain 20.1)	M1VV79	Uncharacterized protein	0.778	386-395	RAWRRRRQRE
UP000016801	Claviceps purpurea (strain 20.1)	M1VX45	Related to tetrahydrofolylpolyglutamate synthase	0.958	718-737	KENVRKKRERRSPSRKSLEK
UP000016801	Claviceps purpurea (strain 20.1)	M1VX45	Related to tetrahydrofolylpolyglutamate synthase	0.918	653-681	ARKEPKADTKDKKPFRDAKFGGAKRIRGN
UP000016801	Claviceps purpurea (strain 20.1)	M1VXW4	Uncharacterized protein	0.713	215-221	KRKQKKK
UP000016801	Claviceps purpurea (strain 20.1)	M1VXZ3	Uncharacterized protein	0.975	104-116	PRRRRRRRPRATS