ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FF41	Uncharacterized protein	0.998	113-173	KKKLKEQEAKQERKQKEREKKEKRAQEKEEKKQNEEAKKESRRVEKQQKEDDKKARKEREK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FMI4	Uncharacterized protein	0.914	88-109	VRRGSKPQQGPTKSPKRGRERR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FQA2	Putative serine/threonine-protein kinase MPS1-like protein	0.805	1185-1191	KIRGKRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FWE1	Zn(2)-C6 fungal-type domain-containing protein	0.747	712-718	RRRRQKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FY91	Regulator of nonsense transcripts UPF3	0.946	207-260	EKKANKAKEAAAAKSAKQARQEGTKGKGSASTAEESKKGKKDSRAEKSVDRPKE
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FY91	Regulator of nonsense transcripts UPF3	0.916	607-621	TRHKRTRRGRGGGKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FY91	Regulator of nonsense transcripts UPF3	0.787	423-439	KKKDEEKSREKPEKADK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FY91	Regulator of nonsense transcripts UPF3	0.701	383-393	GRTRRGGGGKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UYH9	UDP-glucose 6-dehydrogenase 1	0.992	284-303	PRRGHGRRRPRRPGPRAHRV
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V150	Morphogenesis protein	0.97	758-786	KDKKAKKLHKEKTGGGGLRKLFGRNKNRN
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V150	Morphogenesis protein	0.782	536-554	RRNKGVNRRKSTGKHSLEK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V150	Morphogenesis protein	0.72	13-19	GAAKKKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V1R4	L-fucose permease	0.703	915-919	RKRRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VDP6	Ribosomal RNA-processing protein 8	0.997	119-144	PKSEKKEKRDKKEKKEKREKAHHDKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VDP6	Ribosomal RNA-processing protein 8	0.994	57-108	KTKEGGKRRKSEGASEETPKKKEAEVKEADEETPKASKKQKKEKKEKAPKPS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VDP6	Ribosomal RNA-processing protein 8	0.86	28-36	KNKKRKRNN
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VID0	Protein yippee-like	0.887	314-326	RRRSRKVSSARKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VID0	Protein yippee-like	0.658	91-96	HLRRRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VNH6	Putative oxidoreductase	0.982	403-432	AKKKNQANKGEAKTKTEQKPQGKKKSKKAT
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F8Y4	Replication termination factor 2	0.981	199-212	LKKDKKAGGKKKRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F8Y4	Replication termination factor 2	0.909	236-248	VPRKKKERKLLRH
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FBB0	Uncharacterized protein	0.99	82-97	RRRRRRRRKQESVRKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FCL8	Dehydrocurvularin biosynthesis regulator	0.937	15-26	RSRKKRKVRKGT
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FL19	Uncharacterized protein	0.979	4-25	KKKNRLSKDARMREKKRKQRAR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FVT6	Putative HTH La-type RNA-binding protein	0.971	301-316	PKKGSRKPRKGKTSKD
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FVT6	Putative HTH La-type RNA-binding protein	0.774	71-82	SRARRAREKQRP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FVT6	Putative HTH La-type RNA-binding protein	0.676	511-520	SRGGRGGARG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G7V3	Homeobox protein 4	0.968	345-363	RPAPPRGSGRGRQRRRPKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484GA12	GATA-type transcription factor sre	0.718	71-79	KSIIKRRKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UJZ5	GTP cyclohydrolase 1	0.964	68-99	SHKKRRPSLSQPARDPRDTTAPKKKKSKQPKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UJZ5	GTP cyclohydrolase 1	0.931	44-55	KRGSKKSKRKAR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UJZ5	GTP cyclohydrolase 1	0.867	10-20	KRSKKHKRDRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UP24	rRNA-processing protein utp23	0.996	173-266	KSKFRDGIVKPERKRKREDDEEEMKEPAPTAGGKAEKSTKKKGPKGPNPLAVKKPKKATDGEKKPKTEFKTGATAEGAEGEAPTKKKRKRRHRP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UST2	Putative RNA-binding protein	0.998	703-764	LKKKGKKGKKGNMNKGEKKPVKEEKDAGAGDAKKGDGEHGDVKPMLIARKRLMRKKKSQSRG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UST2	Putative RNA-binding protein	0.947	255-278	EKEKEKERPEKKTKTAAKKEESAK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UST2	Putative RNA-binding protein	0.858	568-588	RSAKDAKEAEHQRKLKRKGIV
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VDF9	BZIP transcription factor	0.942	345-379	TRGKGKRNSTGAPATNGRRKAEEPPAKGPPSKKTK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VKH8	DNA topoisomerase I	0.989	220-252	AAKAKRGASKPATKGKAAAPAKAPAKKASAKAK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VKH8	DNA topoisomerase I	0.889	151-175	KAAAKEARSIRASDAKAKKATPKKA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VKH8	DNA topoisomerase I	0.785	811-824	LAAKLKKENKTKKI
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VKH8	DNA topoisomerase I	0.691	438-450	RGEHPKTGKYKRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VKH8	DNA topoisomerase I	0.615	802-806	KERLK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VVE5	Uncharacterized protein	0.873	107-120	AKKPSARAGRKKNG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VVE5	Uncharacterized protein	0.648	28-33	RRRARR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FC00	Uncharacterized protein	0.741	741-756	GKAGKGLLSKGKSKLR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDJ8	Uncharacterized protein	0.717	32-46	IRRPRRNVDSRPFRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FRN2	ATP-dependent DNA helicase	0.813	58-64	SKRKKKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FT04	Transcription initiation factor IIB	0.987	234-250	KRQELRRRKKELKRRRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G1X0	UPF0743 protein	0.987	210-228	PKERRRKDGSEKKDKKRKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G1X0	UPF0743 protein	0.967	310-346	PGKTKTKKRKVSSTTKKHSSRHHRDGEKGPKMIEYRP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G1X0	UPF0743 protein	0.807	283-293	KKTKHAKHKKA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UZ22	KRR1 small subunit processome component	0.978	289-318	KQKKEERLREREKDFVPPEELGHKKKKRKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V8S8	Putative nucleolar protein	0.999	162-235	KETKEGDKGEEGKRRRPGKRKRIAMRMKEREKKKKAEEAEMAKMTKEEHLKEKKKRLNRLKKLRRRAKGKDGKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VBE6	Peroxisomal abc transporter	0.844	57-73	GRRWWRRRREEKEQGRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VGZ2	Casein kinase II subunit beta	0.8	306-319	RPAPRRRAPRANAR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VMN6	Ribosome production factor 2 homolog	0.806	6-22	KPRNARSKRALEKREPK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VPN9	Uncharacterized protein	0.991	151-170	RSKRKKAAKANKANKAKKRS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VPN9	Uncharacterized protein	0.989	212-230	HAHAERGKRKKLSKAKKRS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VPN9	Uncharacterized protein	0.796	66-75	ARKKRKILEK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VRX8	Inheritance of peroxisomes protein 1	0.741	556-564	RRKKLRGFR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VRX8	Inheritance of peroxisomes protein 1	0.628	184-186	KKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VTW0	Uncharacterized protein	0.968	54-73	KLREERERERTKKKSSKKKT
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F9P2	Uncharacterized protein	0.997	322-350	KRFKKRRADGRNRPPRPERKKVKKETKEP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F9P2	Uncharacterized protein	0.902	143-158	VLRKKKQREAIRRSKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FIF3	Putative transcriptional regulatory protein	0.782	300-310	RWKDKRHAKKA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FWU4	Uncharacterized protein	0.939	162-172	PKKRGRPKKAK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FXC5	HMG-box protein STE11	0.97	103-122	TRVEKQTPRKKKERAKSSKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G135	Mitochondrial 37S ribosomal protein S27	0.995	84-103	KARGKSAPKKLKAKVEKKKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G145	tRNA pseudouridine synthase 1	0.969	53-78	NNGRQRGGKSRGPKRKHDQGRSAWSR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V4Y1	tRNA-dihydrouridine synthase 3	0.985	174-198	ARDSRDSRDGRDKKKREKREKGQNK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V8L4	Fungal transcriptional regulatory protein	0.811	23-29	RKRRRRA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VCI1	Ob-fold nucleic acid binding domain-containing protein	0.996	204-237	RRRKKEKRREEKRQEQKRLREAEEEERRRRQASP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VCI1	Ob-fold nucleic acid binding domain-containing protein	0.854	243-254	RYRDIKRKKKQA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VFI6	Coiled-coil domain-containing	0.632	20-27	AKLKNLKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VHJ0	Protein SSH4	0.906	64-78	KRPKKESLKKRESKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VMQ9	Uncharacterized protein	0.875	1341-1363	RRARRMGKTGKMSLKPRVIEKKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VQT2	Uncharacterized protein	0.986	95-126	RRRRRRDKDRGRTGTRARGSRPPPSTRSRVRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VQT2	Uncharacterized protein	0.83	63-81	PARPARARSLDHRPRPRRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VQT2	Uncharacterized protein	0.634	53-55	RRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F8A3	FHA domain-containing protein	0.736	91-100	RKRPPPKGPW
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FEA5	Peptidyl-prolyl cis-trans isomerase	0.943	391-425	QRDRRPEPNREPDQYKERPRSDRERRRSRSPGRTR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FJR1	Clr5 domain-containing protein	0.957	51-73	RFKTWGIEKNRRRKRPGLGSRGI
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FJR1	Clr5 domain-containing protein	0.664	86-94	RERGRGPGP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FVX5	Uncharacterized protein	0.876	536-547	KRARKMRDRRRH
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FVX5	Uncharacterized protein	0.727	509-517	RRDRSRRRG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FVX5	Uncharacterized protein	0.652	257-267	PDSRGSRSKSR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FVX5	Uncharacterized protein	0.649	422-429	RRQRSRSR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FVX5	Uncharacterized protein	0.605	254-255	RG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FYJ6	Glutathione S-transferase U8	0.853	49-66	RIPGTKKSDDPSKKKRNR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G468	Suppressor of glycerol defect protein 1	0.629	18-21	KKGK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G468	Suppressor of glycerol defect protein 1	0.627	63-66	KRRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G873	Putative E3 ubiquitin-protein ligase rbrA	0.916	578-594	GRKKKAAKEKGLAAEHA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VH99	Nucleolar GTP-binding protein 1	0.664	509-514	MKKRLK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VIT1	tRNA wybutosine-synthesizing protein 2	0.91	6-17	SKKPRSKKPKPE
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VSS4	Protein saf1	0.944	14-42	RKADKAKAIKKGKAEVQSRRNEKLARRNP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.997	2881-2893	SKKSKKKKKKGKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.996	2421-2436	GKKSKKANKKKKKGKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.993	4009-4020	KKGKKKKKGKKS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.992	5265-5277	GKKAKKAKKKKAK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.992	5866-5879	KKSKKDKKKKKSKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.992	6173-6184	KKGKKDKKKKKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.99	187-199	QRKKRRKKKQRAR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.99	3751-3764	KSSKKSKKKKKKDK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.99	4800-4811	KKSKKDKKKKKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.99	5443-5457	PKLSKKDKKRKKKAK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.985	5704-5716	KKSKKDKKKKKSK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.984	5093-5106	QKKSKKDKKKGKKS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.984	6434-6446	RKKSKKDKKKAKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.982	3293-3303	SKKKKKKKSKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.981	6994-7019	RKRRREAERARSPGRKSPGPRSPLPK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.974	1311-1327	ARKLSKKEKRKQKAAKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.973	3113-3126	SKKQKKKNKKGKNK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.969	4508-4522	KKMSKKDKKKNKKTK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.969	6573-6584	AKPSKKSKKKKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.968	2706-2720	KKLSKKDKKKLKKAQ
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.968	4608-4618	KKSKKDKKKKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.939	3915-3925	KKSKKKAKKAA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.928	4888-4897	KEEKKKKKKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.916	6-21	RRRSPESSRRRRRDRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.915	1506-1517	KSSKKKKSKRSK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.896	5568-5577	TSKKDKKKKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.815	1606-1618	RKKRSRDDKKIAK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDE2	Repetitive proline-rich cell wall protein 2	0.798	1076-1086	PKSAKSKKRLG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FQF6	NAD-dependent histone deacetylase HST3	0.987	374-394	GIKPPKKKKEPSEKQKKRQSL
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FTP9	Phosphoinositide phospholipase C	0.76	8-20	RRAPEGAKPHKKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FTP9	Phosphoinositide phospholipase C	0.736	419-430	KKKILIKVKKAP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FZW3	Uncharacterized protein	0.935	217-228	GKNKRKSKKGKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FZW3	Uncharacterized protein	0.667	52-55	KRRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V111	Nuclear envelope protein	0.866	165-190	AKRHVPGRGEIARGARDYPAIRKRKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V111	Nuclear envelope protein	0.699	222-230	PRSRSKGGK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V2Q5	Kelch repeat protein	0.629	488-490	RRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V562	anucleate primary sterigmata protein B	0.76	1410-1418	DRERKPRKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V7U2	Uncharacterized protein	0.989	267-279	KSNAKKKKKKAKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V7Y3	F-box lrr repeat containing protein 2	0.862	649-657	HRRRRRRAR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VDA8	54S ribosomal protein L20	0.792	179-209	HKQRLAKKLEATKERWGSIRTKAREDRTRRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VKV7	Uncharacterized protein	0.958	64-86	KRNRAAANKNRVTKSKKEPKPKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VRP8	MBOAT_2 domain-containing protein	0.983	149-195	ARRKRSNKTSSPKPSRNSSRSSSPSSSPGNGLRKRAGSKKRRQNKVK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VYV7	Lymphoid-specific helicase	0.998	50-86	RDARTAAEKKRKAALAAQRRKKKKAELSKEEKEKKAR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W2K1	Cytochrome p450	0.725	235-241	KKRKAEK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W505	Uncharacterized protein	0.614	327-329	KKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDT7	Putative transcriptional regulatory protein	0.854	16-23	RRKRRPRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FHW1	Uncharacterized protein	0.607	12-13	PK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FJM2	Nitrogen assimilation transcription factor nit-4	0.713	25-31	PPKRPRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FRH5	Uncharacterized protein	0.982	351-399	PKRRRKQPQASPAKQKQGRPKGPPKTTSNTTSKTKSSSPKAAPKRRKQK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2J9	Protein CHROMATIN REMODELING 20	0.984	409-431	RKLPKKERKAKAIWNKARRARRI
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2J9	Protein CHROMATIN REMODELING 20	0.855	731-745	LPSSRSKTKKLKKTK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2J9	Protein CHROMATIN REMODELING 20	0.734	795-800	KKRKKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2J9	Protein CHROMATIN REMODELING 20	0.725	192-197	PKKKRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V141	Putative transcriptional regulatory protein	0.762	810-823	KKPNPNKRKSFAGK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V1T8	E3 ubiquitin-protein ligase Zswim2	0.923	36-71	PKGKRKAESDESQPPAKKPRNDPTAEKRLRRFRAKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VF73	Transcriptional adapter 2	0.817	157-167	KKKRRIEERKD
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VK24	Uncharacterized protein	0.6	71-71	R
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VK95	Uncharacterized protein	0.983	265-294	SRRSRDSGRGARRQDPPPPKPRPAKREHRP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VK95	Uncharacterized protein	0.768	332-353	HKHLEKRAMKLAERRGGPLPPR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VK95	Uncharacterized protein	0.751	411-418	RAERRGRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VK95	Uncharacterized protein	0.73	133-139	EKKRKEE
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VPE6	Chromatin structure-remodeling complex subunit rsc7	0.98	133-157	PRRRGRGGWRGRGGRRPAPGQAPPK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VPE6	Chromatin structure-remodeling complex subunit rsc7	0.914	103-116	IRRKRLGRPPKNKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FCX9	Uncharacterized protein	0.946	831-842	KKRGGKPSKKRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FCX9	Uncharacterized protein	0.825	1439-1451	KNKPPRAKLRAKS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FCX9	Uncharacterized protein	0.787	651-661	KRNARRKLAKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FL77	Separase	0.892	1996-2015	SKKKTGGLFAGVEKKKGKKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FL77	Separase	0.816	1688-1704	LPSRRQVRGKKTSKGPK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FZI1	Required for respiratory growth protein 9, mitochondrial	0.994	55-91	KRSQAPKPKRRKNHDRRGPDRERQFKDANKEKPAKKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G7H1	Cleft lip and palate transmembrane protein 1-like protein	0.865	640-646	GKAKKRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V1C9	Elongation factor 3	0.996	1021-1045	KKKAKLTSSEARKKKKERMARRKRG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V338	Ankyrin repeat protein	0.992	1197-1226	AKKAVVPAEKRDKRRKRIDRRERTERLTRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V7F4	Duf500 and uba ts-n domain protein	0.641	34-38	KPPKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VBG0	Cell division control protein 1	0.68	634-639	KSKHKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VGJ7	Maltose o-acetyltransferase	0.69	59-65	AKKRGPR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VN58	Ubiquitin carboxyl-terminal hydrolase	0.99	597-638	EKSKDEKKREKKEQEAAEKARKQAEKDKTKEKEKREREARAR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VWD9	60S ribosomal export protein NMD3	0.942	394-413	KKHYPRKRRNRTRNWKLKRL
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F9N2	Multifunctional cytochrome P450 monooxygenase	0.644	27-33	RKKSNRP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FD05	Cytokinesis protein sepH	0.948	491-528	RKKSDRYAEPLKLQPPAKPSPRKHSRTSSRPKSPLKPP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FJJ9	Uncharacterized protein	0.936	51-66	RRRETPARRRRRLRER
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FK12	Nuclear GTPase SLIP-GC	0.618	773-775	KRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FMR0	60S ribosomal protein L38	0.781	16-31	RRKDASSARIKRNRKS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FMR0	60S ribosomal protein L38	0.608	76-77	PK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FWP1	Uncharacterized protein	0.771	292-310	GGGGRPASAAHRKEEKKEG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FWP1	Uncharacterized protein	0.673	251-255	KKKKE
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G9N0	Zinc finger protein 554	0.951	463-474	KKPSGVRKGKKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V0A8	Catabolite repression protein crec	0.69	177-183	KKKIPKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V241	Inner kinetochore subunit cnp20	0.901	537-552	PLPPADPRKKRRVAKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V241	Inner kinetochore subunit cnp20	0.868	113-126	PGGKKRRESIRPRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V5Q7	5-methylcytosine g t mismatch-specific dna	0.953	17-54	PREKKASRSKSERSLRPDKEKGDREHRSHRVSSRSSKS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V5Q7	5-methylcytosine g t mismatch-specific dna	0.867	873-884	RHRRPKRRTERR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V5Q7	5-methylcytosine g t mismatch-specific dna	0.782	71-93	HRRHRTREERDRDRERDKDRNRD
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V5Q7	5-methylcytosine g t mismatch-specific dna	0.754	184-200	KPRRVSSKKDSRPPSPP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V5Q7	5-methylcytosine g t mismatch-specific dna	0.679	206-222	GKRRSDTPESRKDREER
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V6B1	ATP-dependent RNA helicase DBP8	0.911	528-540	GGKRKRTKQKLRA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VHY2	C-5 cytosine methyltransferase	0.919	85-94	RRPRKPRRKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VLY5	Nitrogen assimilation transcription factor nira	0.693	32-37	KKKSRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VQE2	Uncharacterized protein	0.824	272-280	RRKRRIGKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W015	GTP-binding protein rhoC	0.861	276-283	PLKKKKKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FCK2	RF_PROK_I domain-containing protein	0.825	159-189	KKKKHAEVAKSFNEGRLKTKKQQSSKKQNRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FD49	Uncharacterized protein	0.863	331-343	RERERDRHRPPRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FL52	Uncharacterized protein	0.994	408-459	RRGRGDREGGSGHRGRGRGEWRGRGGHRGEGRGGRGRGGQRGGSVSMRGPRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FL52	Uncharacterized protein	0.822	17-25	SARKKKAKA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FWC7	Peroxin-5	0.736	245-253	DKKGPKPAR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FWC7	Peroxin-5	0.662	89-92	KRKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FXR6	Protein LTV1	0.801	296-301	RRKKRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G0N4	Diacylglycerol O-acyltransferase	0.996	47-151	KPVEKQEKPIKKPAKKQEDRPVEKHEKPVEEPIEKQEKPVKKPAKKQEDRSIEKQEKKSVEKHEKKPVEKHKKEPAEKHEKKPVEEPIEKQEKKTVEKHEKKPAE
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G4R8	Uncharacterized protein	0.918	15-37	RPRRPRRGRDDARFARLAKSPRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4US57	Cytochrome c oxidase-assembly factor cox-23	0.636	77-83	RKEERKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VHB3	Red-like protein	0.994	514-528	GGKAKRKRGPKKRKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VHB3	Red-like protein	0.627	214-217	GKKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VHW1	rRNA adenine N(6)-methyltransferase	0.946	322-339	KAPEKTKSKRKKTKVAAL
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VJ75	UBA domain-containing protein 7	0.961	754-773	PKPKPKPRPAAPARPRPAAT
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VJ75	UBA domain-containing protein 7	0.914	337-363	AKAKAQGKNPAPAPRRGREDGRRDGPS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VJ75	UBA domain-containing protein 7	0.655	106-112	RRKEEEK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VJ75	UBA domain-containing protein 7	0.653	583-592	RPPSPKPAPR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VJW2	Glycoside hydrolase family 74 protein	0.655	748-763	KTLRGRTLRLGRAAHK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VMU6	54S ribosomal protein L37	0.924	197-214	KREALRKAMRKERKAKIK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VMU6	54S ribosomal protein L37	0.888	139-152	KSKKQRKAAAKKQK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FQK9	Putative S-adenosyl-L-methionine-dependent RNA methyltransferase RSM22	0.809	783-794	TRRNKGGKKAAR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FQK9	Putative S-adenosyl-L-methionine-dependent RNA methyltransferase RSM22	0.78	748-760	AQRAKAAGSKKRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FUQ4	Choline kinase	0.986	84-104	KKKKASRKSKTSPRRRSPQSK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2S7	Uncharacterized protein	0.999	84-99	ARRQKKKKKKKKKKWK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2S7	Uncharacterized protein	0.914	1173-1181	KKTKKKKGK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2S7	Uncharacterized protein	0.688	40-49	KRTHGRPRRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VDJ9	Transcriptional regulatory protein moc3	0.78	20-31	GRPRRVRPSRAR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VH41	Ubiquitin carboxyl-terminal hydrolase	0.731	582-592	PPVRSNRKKPP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VST9	DNA replication ATP-dependent helicase/nuclease	0.884	1554-1592	KAKKRLSPRKGVSLKVPKFTMGDDKENRRPEPKRAKIGE
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VST9	DNA replication ATP-dependent helicase/nuclease	0.734	128-135	RKGRKRAR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W1V1	Uncharacterized protein	0.637	587-592	RRFRRG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W2F2	Pheromone-regulated membrane protein	0.946	440-453	IKQERPRPKKRRSG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FPC9	Protein SQS1	0.908	415-427	ALRRRKGKAAKHR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FPC9	Protein SQS1	0.621	6-8	KRG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G047	Mitogen-activated protein kinase-binding protein 1	0.799	803-818	RNSGRRSPPRPVPKRA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G047	Mitogen-activated protein kinase-binding protein 1	0.612	864-867	KASR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2D8	DUF1752 domain-containing protein	0.949	404-423	KRSKTKKKTPLMRKKSAKAA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G636	Histidine--tRNA ligase	0.625	370-372	KKS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G6E8	Uncharacterized protein	0.611	179-180	RK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G812	Uncharacterized protein	0.993	136-162	KKARKKKKVKNWAGSILTRKEKRRAKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G812	Uncharacterized protein	0.683	586-595	KHKSSKTKRL
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484GA02	Uncharacterized protein	0.986	120-185	GKRRGKDVEGKSCRCRKNKNKAAGAKNNGTAADDGKGKKNNGKENGKNKDGKNKDGKKNEGKGKEG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484GA02	Uncharacterized protein	0.897	251-282	ENKGKGKDENKGKDNGKKNNEGKDQGKGKENG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484GA02	Uncharacterized protein	0.877	95-114	KNNEGKNNEGKKNDGKKKGK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484GA02	Uncharacterized protein	0.669	296-303	KKKNGGEK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UQD7	N-alpha-acetyltransferase 40	0.618	227-229	AKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UQZ1	Pre-mRNA-splicing factor	0.999	88-194	ERRKRSGLQDIRKRQMGDIKAILGGGGDRPRRSREKSHKRDASQPRRRRSRRSESPERSGRRHHRSRRDESESEREDRQRHKSDRRRSRSPDDRSRRHRHRSPLESK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UQZ1	Pre-mRNA-splicing factor	0.858	218-245	SRSHRSRRDMSKERKGFSIKGSSRRIQK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UQZ1	Pre-mRNA-splicing factor	0.616	205-207	KHR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V5L1	E3 ubiquitin-protein ligase RNF13	0.89	323-356	RKNRKKQKAAATTPTSTPKPTATPKAKASKKAKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V5L1	E3 ubiquitin-protein ligase RNF13	0.822	597-608	ARIRRRRWRAPK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V5L1	E3 ubiquitin-protein ligase RNF13	0.767	149-161	GKPGHHKRDKPGK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V5L1	E3 ubiquitin-protein ligase RNF13	0.731	416-424	KAAKRGKSK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V9K0	LEC14B protein	0.84	158-170	NRRRRTRRAQPKF
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VIJ8	40S ribosomal protein S24	0.993	103-135	IEKASRQQRKQRKNRQKTLRGTAKVKGAKKKKE
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VK05	Double-strand break repair protein	0.999	581-619	RQPAKRGTKAAAPKKAPAKKAPAKKAPAKKAPAKGRKKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VTB2	Zn 2cys6 transcription factor	0.648	57-63	RRPPGPR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VTJ8	JmjC domain-containing protein	0.999	1358-1392	GPSMRGRGGGRGRGGGRGRGRGRGRGRGRGRGRGN
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VTJ8	JmjC domain-containing protein	0.998	571-586	KPKKKKYKRKKKKGEL
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VTJ8	JmjC domain-containing protein	0.93	1127-1139	VKRRRGRPPKNKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VTJ8	JmjC domain-containing protein	0.807	866-875	RSHHRKKPKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VTJ8	JmjC domain-containing protein	0.769	1174-1187	ARGRKFKITSRKSR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VTJ8	JmjC domain-containing protein	0.751	1020-1028	PKRRGRPPK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VTJ8	JmjC domain-containing protein	0.607	1317-1318	RR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FBB6	Uncharacterized protein	0.974	236-247	KIRTRRKKRRRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FCC0	Uncharacterized protein	0.835	774-783	SSRRRSKRPR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FHB2	E3 ubiquitin-protein ligase HERC2	0.955	553-571	IERRRKRAARKQLHDRWRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FJ11	ATP citrate synthase	0.989	756-775	KPDPKRNRRKRKDARTRTKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FNN5	ATP-dependent RNA helicase DBP10	0.993	820-873	VRKKRIAEAKEKRIGQFKDGAGSRKEIKGVEDIRKARVEKQKKMEKNARPSKKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FNN5	ATP-dependent RNA helicase DBP10	0.857	347-358	KKRKREGEGRGK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FNN5	ATP-dependent RNA helicase DBP10	0.678	595-607	RKRITPHRGNKPK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FS13	Uncharacterized protein	0.868	92-100	PKKERKKRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FU94	Uncharacterized protein	0.908	916-930	KAKKEKKRSLWKTKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FUB8	Homeobox expressed in ES cells 1	0.617	84-87	KAKH
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G9C6	UPF0390 protein	0.984	64-92	AGHLELIGKGKKAKKEEKGLAKGGSRKYG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G9C6	UPF0390 protein	0.917	11-49	RPAPTGKPKQKQVKNASRVAKPQKAKHGLAADKMQKKFA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UT95	HECT-type E3 ubiquitin transferase	0.821	2876-2906	RQEEERKKIEEEERRIREAKEAEEKAAREKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V5L2	FAM50 family protein	0.97	77-88	SKPKKRKKKVGG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VFM5	Protein kri1	0.995	570-590	EKKRKDRKKLGKKARLRQWRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VFM5	Protein kri1	0.993	310-347	RKEAASSRKRQRESEREKKEEEKRVRKEEKARLRKLKL
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VFM5	Protein kri1	0.986	474-502	RPSKKRKTSKDIKKERLASKKAAKAERAK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VFM5	Protein kri1	0.985	645-656	KKRKRSRGKKKA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VFM5	Protein kri1	0.974	416-426	GKKKRKRPKKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VFM5	Protein kri1	0.696	50-61	KKREEKQRLEEK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VIA0	Putative U3 small nucleolar RNA-associated protein 7	0.977	490-512	IKKRARGKNGALKKYLRKQRKKN
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VIA0	Putative U3 small nucleolar RNA-associated protein 7	0.797	35-63	EREKMRRLKEANKSYGRGKSVNVKNIRDK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VRL4	Ribosome biogenesis protein NSA2 homolog	0.988	16-66	RRLDHFERKRKKEAREAHKASKDAQNLRGLRAKLHAEKRRKEKIQMKKQIK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FAG3	SH3 domain-containing protein	0.957	381-394	AKKEKAKRPPPKKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FAG3	SH3 domain-containing protein	0.701	548-552	PRKKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FCT4	Putative methyltransferase	0.803	436-446	RRSRWRPRKRP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FFB2	General negative regulator of transcription subunit 4	0.991	1060-1102	GRKKKQKKEKPAPAPSFAAKKAAEKVITPPEPPKKEEPPAPKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FFB2	General negative regulator of transcription subunit 4	0.794	1113-1128	PPKGKAAKVAAKAKAV
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FG26	U1 snRNP-associated protein usp106	0.655	249-265	RGPRSGGGGGGYRGRGG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FKX3	Global transcription regulator sge1	0.884	189-202	PGEKKRAMKRTKKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FMR9	UPF0648 protein	0.821	1075-1102	SKKVREEATKKESGKLRARSLFNRGRQK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FMR9	UPF0648 protein	0.795	132-155	PPPRSETWKHLMKLKDRIKRAHRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FNL5	Splicing factor U2af large subunit A	0.997	658-748	SKRSSHKSRRDRDEKRRDREKDKYRDEDDHHRKSSHRSHRDRDRDRDRDRDREYDRDRKDRDRDREKDRKRDRHRDREHRHRSSRKHSPEP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FNL5	Splicing factor U2af large subunit A	0.993	562-627	TKDKDRGRRREATADRERETDIREISRERRYERGDRHRRRRRRSESRSAVGDRDDEYRRRKYKSRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FNL5	Splicing factor U2af large subunit A	0.923	836-853	RGREDGDDGKRSRRKGRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FNL5	Splicing factor U2af large subunit A	0.742	91-102	KKREEAKAKGKD
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FTP1	Putative transcription initiation factor TFIID 111 kDa subunit	0.949	340-354	KQPPPKKKRPPPPKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FTP1	Putative transcription initiation factor TFIID 111 kDa subunit	0.876	190-205	PKKARWIEKKPTKKPK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G176	Uncharacterized protein	0.978	409-446	LLKRKKKQLPERRSSRNGKAMGHGRMATDRPPSRVSKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G5J9	BTB/POZ domain-containing protein 1	0.993	1567-1602	RREAKEKARGDKSKDSRRGRRVRGGGGASGGGKGRG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G5J9	BTB/POZ domain-containing protein 1	0.671	1216-1220	RRKSK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G755	Peptidase_S8 domain-containing protein	0.881	54-65	RQPPRKPRKPHR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UZ33	Tetratricopeptide repeat protein	0.997	1038-1086	KVKRKKKVSARGDGEGRPKKGSRKKKADTDGEESGEERPTKKKRRLTKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V6P0	Swim zinc finger family protein	0.755	262-269	KPKKPIKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VDR7	Uncharacterized protein	0.671	286-292	ARGRSKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VEU0	C6 finger domain-containing protein	0.824	14-23	RRKSHKKSRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VEY2	Protein dip1	0.96	463-480	PKKIPPKAPPPRRRTKLK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VH63	Putative WD repeat-containing protein	0.991	11-49	NKKRKRTAAPEAPKKRIAASKTANRAPPRASGKKSSGTR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VH63	Putative WD repeat-containing protein	0.978	217-231	RKKPKKPPAPPRKRP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FM50	Uncharacterized protein	0.873	113-126	RHQRPRRPPRRPSR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G3L6	CCHC-type domain-containing protein	0.775	660-682	EKGGKHGDGGASGGFKIRKRTQK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G3L6	CCHC-type domain-containing protein	0.6	441-441	K
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G6J3	ATP-dependent DNA helicase hus2/rqh1	0.981	1345-1386	RGRGGGRGGKKSGFRRGSAGGSSFKRGGVTKRRSTGGTSRRS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G6J3	ATP-dependent DNA helicase hus2/rqh1	0.84	1055-1065	ASKPKRRAKAS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G6J3	ATP-dependent DNA helicase hus2/rqh1	0.657	1099-1102	KRRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G6J3	ATP-dependent DNA helicase hus2/rqh1	0.606	1412-1413	KR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G7F1	Interferon-induced GTP-binding protein Mx1	0.695	736-751	RDERERDRERERERER
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G841	Anucleate primary sterigmata protein A	0.946	1505-1523	RARRRSKELRRRQSRSRHR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G841	Anucleate primary sterigmata protein A	0.902	200-222	SRRSSKKSRRSATPPNRKTPSPP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G841	Anucleate primary sterigmata protein A	0.666	1059-1076	SIRKVRSAAAIPRNQRSR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V212	Tyrosine--tRNA ligase	0.99	355-375	KKKKKKQPKDKGSRYPGGAKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V6I8	ABC transporter	0.813	1098-1112	RGKGKFRGRYRGRGR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VIS1	Flavin carrier protein 2	0.641	626-629	RKRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VK17	Cell wall biogenesis protein phosphatase	0.809	488-497	REKEEKKKRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VYX6	HNHc domain-containing protein	0.99	657-685	PAKGPAKGPAKGPAKGPAKGPAKGPAKGP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VYX6	HNHc domain-containing protein	0.746	323-333	ERQQKQKKRQR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VYX6	HNHc domain-containing protein	0.615	125-126	KK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FFZ3	Putative ubiquitin carboxyl-terminal hydrolase 3	0.812	899-910	ARRAAKSRPRRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FFZ3	Putative ubiquitin carboxyl-terminal hydrolase 3	0.807	478-509	SKQRREKQRETMSKPKDVGKAEKSPERGVARN
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G0H7	B-block_TFIIIC domain-containing protein	0.797	726-735	QRRKKQRQKH
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V0J2	PEX11 domain protein	0.921	248-264	LRAIVMKRREHRKRWRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V6S1	Geranylgeranyl pyrophosphate synthetase	0.998	680-725	KIKDAPKFDRKETRPGRRPAKARKPREAIRKVTSHARESLRPKKRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V6S1	Geranylgeranyl pyrophosphate synthetase	0.988	115-208	EKEAAKSRLARIARRERLLEREKKMEIARAKRARENEARARAAAEDIVKERELKAARLERAEKKRQKAQERAQERAKERAEKQVAAAKTASQKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V6S1	Geranylgeranyl pyrophosphate synthetase	0.888	749-763	KKRRSGIRSRRGKIE
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V6S1	Geranylgeranyl pyrophosphate synthetase	0.78	29-47	KRPPRRPLPRQTVERRRGP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V845	Nitrogen permease regulator 3	0.995	146-159	KKKKKKKGKSERAK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VBV3	Dimethylaniline monooxygenase	0.635	452-458	RKGMWRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VC04	Mtf2 domain-containing protein	0.934	335-354	RHARRIRHSIRFREGKRQRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W242	5'-3' exoribonuclease 1	0.989	1368-1390	RGRGRGRGGRGGRGRGGPRGRGG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W242	5'-3' exoribonuclease 1	0.638	1326-1331	RGRGRG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W2P0	Proteasome regulatory particle subunit	0.814	26-35	KDPKKGKKAA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F7X3	Uncharacterized protein	0.873	260-275	RREKRLNPKNPKPKPK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FBL1	Uncharacterized protein	0.787	116-129	RLRGSKSRTEKKRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FET2	Sterol uptake control protein 2	0.667	33-45	RNRSTGKRVSHRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FPJ6	Pre-mRNA-splicing factor prp46	0.73	76-85	PMKSRRRLKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FWN2	Non-specific serine/threonine protein kinase	0.964	144-166	RERERDRDRDRYPEKRRPRSRKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FWN2	Non-specific serine/threonine protein kinase	0.691	61-73	RRSRSPPPRGYKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FYX0	Uncharacterized protein	0.938	334-364	SRRKREEREARLKAQEEEERKRREFKARPIR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FYX0	Uncharacterized protein	0.903	479-516	RERRERELKARLAREQAAERSRQAGREWAEKQRRKRLG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V135	Proteasome subunit alpha type 6	0.924	117-127	AKKKKSKKSAK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V135	Proteasome subunit alpha type 6	0.768	412-419	KKPAGKRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VBA9	26S proteasome regulatory subunit 4-like protein	0.988	16-45	DEKDKKKEKPKYEPPPRPTTRVGRKKRKAA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VGN9	Cytochrome p450 oxidoreductase	0.674	29-34	KKKKGY
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VKS0	Pre-rRNA processing protein	0.89	18-49	KAFKSGKHASKGALRDAAKGRLGGEKGQRKTP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VPJ4	Uncharacterized protein	0.84	478-493	SAKPRRRNHQSRSRRS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FC03	Pre-mRNA-splicing factor sap114	0.696	468-475	KLRAGKRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FFJ9	Putative membrane protein	0.973	1071-1086	AGAGAKGKKRSKKSKA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FFJ9	Putative membrane protein	0.827	20-27	AAKRRRRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FRP4	Uncharacterized protein	0.948	231-274	PASSRRRSEGHPRKSSGGGSRNITKEEKRARVEAAERRAREKAA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FRP4	Uncharacterized protein	0.625	731-738	RRGSASRP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FTJ6	Uncharacterized protein	0.996	190-220	RDDKKRSKDEHKHSKSSKSDRKPDKKKNHKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G6H6	Aly/REF export factor 2	0.996	230-282	RSRSPMPRRRGGGGGRRPGARREGGRDGGREGGRDQDGGRGGRGAGRDGRARK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G6H6	Aly/REF export factor 2	0.933	16-43	KKNNGPRNRHGGGGGGGGAPRRRERERQ
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G7Z2	DUF3824 domain-containing protein	0.926	551-564	RRERRARRRSRSRL
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G7Z2	DUF3824 domain-containing protein	0.906	455-473	SRSRSRSRGRKSRSGSVAK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G7Z2	DUF3824 domain-containing protein	0.884	489-509	RNKSKSHSRSRSRSKSRIRTG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G7Z2	DUF3824 domain-containing protein	0.692	527-533	KNRKDKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UK31	J domain-containing protein spf31	0.974	197-213	KGKSGDGKKKKKMKPIG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UXW3	Mitochondrial import receptor subunit	0.624	41-46	RRNERR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V140	Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28	0.997	21-79	VVKDKKKHKPRHRDRSRERERDREHERDRDRDRDHRSEKPHRRRSRSRSPARPSKQYRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V140	Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28	0.755	155-171	RRLKEKDDKRSKGGESR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V3V3	Eukaryotic translation initiation factor 3 subunit A	0.996	800-873	RRDEFEKRRRDAERELEKQIAARKKEYRDRKLREKREREEKERALREAEERAAKEKEEQERRAEAKRAELQRLK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V3V3	Eukaryotic translation initiation factor 3 subunit A	0.842	652-673	QKEREEKRMKAERDRVRKEELK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V3V3	Eukaryotic translation initiation factor 3 subunit A	0.682	899-905	ARRKAER
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VBJ0	ATP-dependent rRNA helicase RRP3	0.961	459-478	KGGKKGPSFKGGMKGPKRRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VH92	Brct domain protein	0.801	837-847	RPARRTRRKPG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VH92	Brct domain protein	0.658	743-747	PRKKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VMV8	Elongation factor 1-beta	0.763	131-139	KKKKENKPK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VW06	Mitochondrial distribution and morphology protein 34	0.723	364-370	GRKKKTR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VZQ3	ARS-binding protein 2	0.679	346-353	RKRKWVKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W0K8	Mediator of RNA polymerase II transcription subunit 19	0.606	332-333	RR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FJI4	Uncharacterized protein	0.9	197-208	RHRRRRGGGRRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FRA9	Uncharacterized protein	0.928	524-550	RRPARGAKTPIAAAKPRTRGRAQKSKA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FRA9	Uncharacterized protein	0.61	439-440	RR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FRF2	Protein PAL1	0.997	211-240	EKKAKEARRRERERRARESKDKDPKKPSRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FRF2	Protein PAL1	0.953	109-151	KPSRPDGNRPPTNRPPGPPGRDNMPPPGRRGPPPPGHRPSRSQ
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FRF2	Protein PAL1	0.854	172-193	PPRPAGPPGSPQRRPQERRPRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FSJ7	RNA-binding protein 8A-B	0.991	134-169	PPGGKGGNRGGARAQNRGRGRSRSRSRSRSRSRSAE
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FU83	Uncharacterized protein	0.641	20-24	RKAKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FXW5	DUF4210 domain-containing protein	0.837	519-534	RKAQRAKRRSASPRAP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G9B1	Zinc finger protein klf1	0.939	55-66	ARKRRRSRKGLD
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V1A7	Ph domain-containing protein	0.935	40-55	RPTGKVKKRRKALPPG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V3W2	Uncharacterized protein	0.626	16-22	KGKFWRS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V507	UV damage endonuclease UvdE	0.991	558-573	KNGGQKKKAKKTKKKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V507	UV damage endonuclease UvdE	0.686	623-630	PKKREVKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V5W4	L10-interacting MYB domain-containing protein	0.775	156-165	PKRIMKPKRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V838	Pumilio domain-containing protein	0.974	662-686	KAQREADKNEKGAKKGKKGGVKSEK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V838	Pumilio domain-containing protein	0.967	8-36	AGSKRKSASAGKGVSDGKSKKIKVEKKKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V838	Pumilio domain-containing protein	0.754	69-82	KQAQEKGKKEGAKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V838	Pumilio domain-containing protein	0.651	124-133	KKIWERLRRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VD25	SWR1-complex protein 5	0.987	75-86	KKAKKKRKKTKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VPL0	tRNA (Carboxymethyluridine(34)-5-O)-methyltransferase	0.756	168-177	KSKSKSKSKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VPM9	C6 finger domain-containing protein	0.635	12-16	APKRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VS40	Chromatin-remodeling ATPase INO80	0.997	467-491	KPAKEKKEKKEKKDKKEKKEDKPEE
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VS40	Chromatin-remodeling ATPase INO80	0.988	120-187	PEPKERSGTPLARKEKKERVPRKSKSRASDLRDAAMSTPKSSRRSSSKQETPAPRVPAKRQANGASKQ
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VS40	Chromatin-remodeling ATPase INO80	0.981	383-401	KPKGKGRSGPRPKKSKEQK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VS40	Chromatin-remodeling ATPase INO80	0.972	1579-1596	AKGAKKRRVGGKKAKTLK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VS40	Chromatin-remodeling ATPase INO80	0.964	1529-1540	KAPKKKGGKRKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VS40	Chromatin-remodeling ATPase INO80	0.913	290-304	KERKKDMQRKRRREK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VS40	Chromatin-remodeling ATPase INO80	0.796	428-444	KIRIKFNKKSRDKDKEK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VS40	Chromatin-remodeling ATPase INO80	0.646	66-74	KPKSRSPPP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VTW9	Upf0183 domain containing protein	0.845	1191-1202	RRRRRRFRWARR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VTW9	Upf0183 domain containing protein	0.701	590-597	KRDKKGRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F8T0	Condensin complex subunit 1	0.701	155-162	RGRGKPKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FMK3	Uncharacterized protein	0.974	1014-1043	PKSKPESKPEPEPKSRPEPKPKPEPKSERR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FMK3	Uncharacterized protein	0.826	1252-1272	RRAAKPRSPTKPTAARTRGRA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FMK3	Uncharacterized protein	0.668	1138-1144	PKSPKKA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FMK3	Uncharacterized protein	0.603	1168-1168	R
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FNW2	D-lactate dehydrogenase	0.637	275-279	RRRPR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FQA8	Uncharacterized protein	0.99	106-123	KREKDDKKKNSKKKKPKA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FX80	Uncharacterized protein	0.999	7-21	LKVKKNKKKKRKKKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FXL8	Uncharacterized protein	0.615	405-407	RRG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FXU0	Uncharacterized protein	0.944	83-118	LRRQEREEYRRIQKEMREEETKKKKKAAQVAEARRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G3C9	Tyrosinase	0.727	541-554	RKLKARHAHRNHRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UNY0	Endoglucanase-4	0.841	320-331	KRRRRLARRMAR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UXK3	Duf814 domain-containing protein	0.97	1056-1074	GKGGQQGKGGRGGRGSKKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UXK3	Duf814 domain-containing protein	0.93	841-857	QRPAKRGQRAKAKKIAA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V195	RNA family	0.676	83-88	FKPKKA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V195	RNA family	0.615	104-107	RKSR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VK23	3-phytase	0.879	30-45	PRRSGSSGRRKKPLPS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VKD6	Uncharacterized protein	0.678	271-278	PKKSRNAK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VM01	ABC multidrug transporter	0.856	1475-1487	QKSKSKKEAKGKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VUE2	Cactin	0.785	14-29	RRSRSPSSRRDRHRER
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484F8T9	Uncharacterized protein	0.614	160-163	RRPR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FL92	Uncharacterized protein	0.81	464-474	KGRKRKDAPKV
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FL92	Uncharacterized protein	0.752	125-142	SAGSRKHRISKNTSPKAR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FNS2	L-arabinose-responsive transcription regulator ARA1	0.716	42-47	KKRKRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FQJ9	Calcium/calmodulin-dependent protein kinase type 1	0.692	34-49	RERRIRLQEKWERRRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FUB7	Phospholipid-transporting ATPase	0.68	45-50	AHKKKN
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FZU6	SEH-associated protein 4	0.754	901-911	KKSKRGGRPTI
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V3R1	DnaJ domain containing protein	0.604	46-46	K
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VBF2	Uncharacterized protein	0.961	374-407	RKGLAAKPKEMAQKKGKSLTAAQRRKKGLPVRKA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VH59	ABC transporter family protein	0.999	290-319	KEAASAAPGQDKGKKKDKKKKGKKGDAKGG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VH59	ABC transporter family protein	0.722	572-585	KGPKKGPAQPAGPK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VHH4	Uncharacterized protein	0.667	421-434	GKRLSKQAGSKLSK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VYQ9	Uncharacterized protein	0.613	644-646	RRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FG42	Transcriptional repressor tup12	0.993	223-266	KPVKASSTKAKKKRKAEELKAKVEDDAKPKSAAGKKETAAKKSK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FHT3	Transcription activator AMTR1	0.827	110-120	RKARRPPPRRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FHT3	Transcription activator AMTR1	0.631	50-52	KKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G5R8	Helo_like_N domain-containing protein	0.756	370-377	SKRKRWRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UNM2	Uncharacterized protein	0.823	154-166	IKAKEEREKRRRG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V0Z4	U3 small nucleolar RNA-associated protein 11	0.802	260-272	RGGKKIMVRTRKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V3S2	Glycosylphosphatidylinositol anchor biosynthesis protein 11	0.778	98-107	RKPRPGEKKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VFE7	Uncharacterized protein	0.965	131-143	KPKTSRRKKKSKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VH22	Uncharacterized protein	0.931	86-95	RRRRRRRRER
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VIS8	Calpain-like protein	0.999	676-699	KKKAEAKKKKDDKKAKRKRKQKKA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VIS8	Calpain-like protein	0.847	776-810	DESKKDESKKDDKKDGEKKDETKDEEKKEDKEEKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VZG8	Duf726 domain containing protein	0.87	137-148	RFGHKKRPKRSR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W3B6	Uncharacterized protein	0.802	133-148	QQRRSSSGSKKSPKGK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDD2	Uncharacterized protein	0.747	407-424	LARLTRANERFRERRHRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FDD2	Uncharacterized protein	0.605	392-393	RR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FF05	Uncharacterized protein	0.958	466-493	KELEKKSLPERPKSSKKDRGTKGTGKKD
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FGC6	DNA-(apurinic or apyrimidinic site) lyase	0.978	311-368	EKPKGSKRKAKGAVKNDDDQKPSKKAKAANTKVKQESPEAVRPPPAKRSRAFKTEGIK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FGC6	DNA-(apurinic or apyrimidinic site) lyase	0.7	384-392	RRRSQRLRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FMV8	Uncharacterized protein	0.998	363-393	KKQPMPKTRKRLASDATKRKHKKRPRKNQKP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FVS3	Uncharacterized protein	0.634	584-588	KRLKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FWP2	Uncharacterized protein	0.986	1115-1133	RKKAQKPKKAAAKPKKTNH
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FWP2	Uncharacterized protein	0.962	654-677	YKPPAKRPRRSKGSTAARKTPQQK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FWP2	Uncharacterized protein	0.834	639-647	KKSRRKRSA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FWP2	Uncharacterized protein	0.706	699-706	KRGRGRPR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G091	Dual specificity protein kinase lkh1	0.836	679-692	RPPRAFRKKRLSAW
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G091	Dual specificity protein kinase lkh1	0.772	738-752	RRGGRLRNIVRRIRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G091	Dual specificity protein kinase lkh1	0.704	78-82	PKKRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2E0	Kelch repeat-containing protein 3	0.996	3-37	KAKKGKSDEKAAKAAAKKAKQANKGEKKAKSKAAK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2E0	Kelch repeat-containing protein 3	0.984	841-866	SRGRKRKTKPKLSYKEQKERRILKKF
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2E0	Kelch repeat-containing protein 3	0.837	385-404	RKARQQKKAAPEQRGGRRAR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2E0	Kelch repeat-containing protein 3	0.825	320-333	ERRKKPANAPSPKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2E0	Kelch repeat-containing protein 3	0.697	885-900	GGKKTQAKPRVAGSAR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G619	Uncharacterized protein	0.979	206-224	PRLKKQSPIRRRGRRRRSE
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484GAF5	Uncharacterized protein	0.996	474-510	KKKRVHRRRKHKNDDGSKEKESAPKHQRSRRHKNHRQ
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4ULS0	Glutaminyl-tRNA synthetase	0.995	33-75	ELKKRLAKRAKKAATEKAKAAKDAVAKAAGAGEAKPKPAPKPK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V5A2	Oxidase ustYa	0.636	45-48	KPKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VB74	Uncharacterized protein	0.945	907-942	PTKRKRGRQSKAQPVEEPKPRPEETTPKRGRAAAKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VB74	Uncharacterized protein	0.929	862-873	AKGRKRGPRGKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VB74	Uncharacterized protein	0.782	819-829	KPGPGPKRRSR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VD63	Glucan 4-alpha-glucosidase	0.993	302-314	GIRKKKRKEKKRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VDK8	Cell cycle control protein	0.927	268-278	GGKGKKGKKRP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VDK8	Cell cycle control protein	0.858	19-27	KPTKKRKRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VES6	C2H2 finger domain-containing protein	0.883	490-515	QKSRGLTHSRGGGPTPVKAKGRKNRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VES6	C2H2 finger domain-containing protein	0.635	480-484	RRKGN
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VLD4	Modin	0.85	134-157	KRARPDEEKPPESRALQRKGRKSK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VLM2	Sphingosine N-acyltransferase-like protein FUM17	0.803	23-37	RRRRKSSIRGHGHGH
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VLM2	Sphingosine N-acyltransferase-like protein FUM17	0.653	55-60	SKRSRA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W5D8	U3 small nucleolar RNA-associated protein 12	0.996	312-331	KKSLARKRRRRREKAGKEGK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FH90	Putative membrane protein	0.689	289-294	RRKRHR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FI93	Autophagy-related protein 23	0.986	513-527	SKNSKKNKKKKKGGA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FI93	Autophagy-related protein 23	0.719	48-55	ARRPRPKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FI93	Autophagy-related protein 23	0.656	971-978	KEKEWRKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FIN0	Cytokinesis protein sepA	0.954	1648-1672	RESLRRSRRQTAEEERRMRRRRREK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FIN0	Cytokinesis protein sepA	0.817	1557-1568	RDRRRRARLKDR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FNV4	DNA repair protein rhp54	0.664	63-66	RKKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FYU5	Ribosomal protein L15	0.97	1086-1117	RGLTATGKKSRGLNKGHRYNKTKAGRRKTWKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484FYU5	Ribosomal protein L15	0.947	964-1002	SRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKKPVAKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G288	Uncharacterized protein	0.672	94-105	SGKLTRSHRGRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G2B0	BZIP domain-containing protein	0.784	101-110	RNYRKKLKRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G3Q9	Transcription factor TFIIIB component B	0.982	230-262	APKPKRQRKKKDDAAADGEAAPKRQARPRKKKT
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G3Q9	Transcription factor TFIIIB component B	0.941	611-623	GKRKRGTGKAKKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G3Q9	Transcription factor TFIIIB component B	0.832	329-345	RHREKQAKARDRLKAKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G3Q9	Transcription factor TFIIIB component B	0.773	202-211	APAKRVPKKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G3Q9	Transcription factor TFIIIB component B	0.748	7-24	KKGGMGIKPKMPMARPRA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G3Q9	Transcription factor TFIIIB component B	0.687	279-286	KPKRFPRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G517	INO80 complex subunit 2	0.749	442-455	KLLKKQAPKTKGKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G517	INO80 complex subunit 2	0.676	422-430	RRRRNLSEK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G6J8	Pre-mRNA-splicing factor sap145	0.845	11-21	MRRAKKKEQKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G6J8	Pre-mRNA-splicing factor sap145	0.841	535-552	RKRQKVDEKRTKEKKESK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G6J8	Pre-mRNA-splicing factor sap145	0.662	133-137	KKKRK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	A0A484G6X2	Seryl-tRNA synthetase	0.862	131-145	EKVDKSKPKAPKKAP
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UQ26	Patatin-like phospholipase domain-containing protein	0.851	144-156	KRGSRRRGNRAKG
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UTT5	DNA repair and recombination protein RAD26	0.991	268-285	GRKRRKGAPAKGKKQKKA
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UTT5	DNA repair and recombination protein RAD26	0.842	231-238	RPRKKRKR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UVE4	Uncharacterized protein	0.931	251-268	RSQKRRNNKRRSKASANK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4UVE4	Uncharacterized protein	0.914	207-225	HNKHHGRRGAKSSKPRGPH
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V244	Abhydrolase domain-containing protein mpaH	0.739	409-421	KRIGRPERPAKAK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V6G4	Uncharacterized protein	0.61	84-86	RPK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V7J1	Uncharacterized protein	0.996	71-99	KPKKRGRGRPKGSVNKKSTPVKKAAKKQK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V7J1	Uncharacterized protein	0.768	16-26	PRRRRSGRISS
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V7J1	Uncharacterized protein	0.715	283-305	PRRWRRVLNGERFKRTFLPKAAK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4V909	tRNA(Ile)-2-lysyl-cytidine synthase	0.892	409-428	PRRRRLDSGKRREARLAHRR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4VZP8	Uncharacterized protein	0.982	55-69	EQKKKKETKGKGGKK
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W0Z9	G patch domain-containing protein 11	0.611	36-37	KR
UP000014480	Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422)	N4W176	Dynactin arp1 p62 subunit ro2	0.8	174-187	KPKLTPKEHKERKK